1RFHA

Solution structure of the c1 domain of nore1, a novel ras effector
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
PRVLAERGEGHRFVELALRGGPGWCDLCGREVLRQALRCANCKFTCHSECRSLIQLDCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ras association (RalGDS/AF-6) domain family 5
publication title The solution structure of C1 domain of Nore1
rcsb
source organism Mus musculus
molecule tags Metal binding protein
total genus 8
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2003-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1rfhA01
5FUVA 2JA1A 5FUYA 4FKDA 3UEJA 1KBEA 1W4RA 2QPOA 2QQEA 2YUUA 3UGDA 1RFHA 3E2IA 1XX6A 2ORVA 2WVJA 2GVIA 2ROWA 3KY9A 1XA6A 4L9MA 4UXIA 2J9RA 4UXHA 4B6DA 1TBNA 5FUWA 2ELIA 1R79A 1FARA 2ORWA 1FAQA 2ENNA 2UZ3A 1PTRA 3UEYA 2QQ0A 3UGLA 1KBFA 1PTQA 1XBTA 2ENZA 2E73A 4UXJA 2B8TA 3CXLA 5FUXA 1TBOA 2FNFX 3UFFA 2VRWB 3BJIA 3UGIA 2J87A 1Y8FA 2DB6A
chains in the Genus database with same CATH superfamily
4A24A 1TBQR 2LEOA 1CT4I 2WCYA 1CSOI 1TIHA 1UUCA 1WGCA 2KMRA 1X4SA 1M8BA 2NU2I 2RC4A 2SGDI 3R5DA 2CJSC 2DIPA 5EX0A 1W4RA 2NU1I 2QQEA 1HDLA 1BMOA 3RU0A 3OVOA 3VDPA 2ARPF 1SGQI 2GVIA 5J8FA 3KY9A 4SGBI 1X74A 2JZMA 3HH2C 1CT0I 5E3PA 1CT2I 1HEVA 1TOTA 1KBFA 3UGLA 2V1CA 3TJQA 1IY5A 3OXGA 1TGSI 2UVOA 2BUSA 2E73A 3VE5A 3CXLA 1SGPI 5FUXA 2NU0I 1MJ9A 3SGQI 1TBRR 3TOAA 2KMQA 2K9HA 1Z2IA 2KMPA 1K7TA 1Y1BA 3MEKA 1V1HA 1Y8FA 1SGDI 2E5RA 2DB6A 2N71A 5FUVA 2JA1A 1ULMA 2QQDA 1OVOA 1R0RI 2DKVA 2M5XA 5FUYA 3FSYA 2KCXA 1SGEI 3VDUA 2XRCA 2WGCA 3QWPA 1DS3I 3QAHA 1OMTA 2JW6A 3D00A 3UGDA 5HQ8A 1RFHA 3B4VC 1XX6A 2ORVA 4GI3C 1YU6C 4L9MA 2J9RA 4UXHA 5CCMA 2SGEI 4E1RA 2ORWA 1PPFI 1OMUA 3TO9A 3UEYA 1SGYI 1YTPA 1XBTA 2ENZA 3QTLD 3UOEA 1K7UA 3TO7A 4E1PA 2FNFX 9WGAA 2N52A 1WTJA 2VRWB 1N13A 1Z7KB 7WGAA 1MJAA 1P9GA 1MJBA 3TO6A 3FC3A 1DS2I 2OD1A 1Q9BA 1M8CA 1PCEA 2CWGA 1SGRI 2L7XA 3OXFA 2SGFI 3PDNA 1UVFA 5EX3A 2QQCA 2A20A 1CGII 1FY7A 4FKDA 5CCLA 3UEJA 2SGPI 1KBEA 1PJUA 1SGNI 1TURA 2X3TA 4DNCA 2OZUA 1AN1I 1U5KA 2V53A 2RIJA 3E59A 5HI7A 2GIVA 1Y1CA 2OU2A 2P6AC 2ROWA 3R5AA 5DAEA 1OYVI 1XA6A 5J8CA 3SEKC 4B6DA 1S20A 2ELIA 1FARA 1FAQA 5E3QA 2ENNA 2UZ3A 2GKTI 1UHAA 3R5CA 1W3SA 3TOBA 1IW4A 1LR9A 2B0UC 2F3CI 2LUYA 4UXJA 5JHWC 2KMOA 1TBOA 1ULNA 3BJIA 5E3RA 3UGIA 1NXUA 1LR8A 2YQPA 2J87A 1PTQA 1CHOI 1WKXA 1CGJI 2Y0MA 4WP4A 1HPTA 4JCVE 3SGBI 2W0TA 1VDDA 1HJAI 1TUSA 4AMLA 1KMAA 1WGTA 1IY6A 2QPOA 2ODDA 1K7VA 2L8EA 2LB7A 3R5BA 2CWHA 2YUUA 2JYYA 3GOXA 3E2IA 2N17A 2PQ8A 1CE3A 2WVJA 2X52A 1H0ZA 1BUSA 4UXIA 2NU4I 1TBNA 1UVGA 3OXLA 1R79A 5FUWA 2NU3I 2GKVA 1PTRA 2JXDA 2QQ0A 4HGUA 4MPIA 2SGQI 2GKRI 1LR7A 1NUBA 2V1CC 2B8TA 1MT1A 1V1IA 2CWFA 2N1AB 4OVOA 3FSXA 3UFFA 1ULKA 1FYBA 1P9ZA 2OVOA 2ERWA 3OL0A
chains in the Genus database with same CATH topology
4A24A 1TBQR 2LEOA 1CT4I 2WCYA 1CSOI 1TIHA 1UUCA 2KMRA 5HQ8A 1X4SA 1M8BA 2NU2I 2SGDI 5EX0A 2CJSC 2DIPA 1W4RA 2NU1I 2QQEA 1HDLA 1BMOA 3RU0A 3OVOA 2ARPF 1SGQI 2GVIA 3KY9A 4SGBI 1X74A 2JZMA 3HH2C 1CT0I 1CT2I 1TOTA 1KBFA 3UGLA 2V1CA 3TJQA 1IY5A 3OXGA 1TGSI 3VE5A 2BUSA 2E73A 3CXLA 1SGPI 5FUXA 2NU0I 3SGQI 1TBRR 2KMQA 2K9HA 2KMPA 3MEKA 1Y1BA 1V1HA 1Y8FA 1SGDI 2E5RA 2DB6A 2N71A 5FUVA 2JA1A 2QQDA 1OVOA 1R0RI 5FUYA 2M5XA 2KCXA 1SGEI 3VDUA 2XRCA 3QWPA 1DS3I 1OMTA 2JW6A 3D00A 3UGDA 1RFHA 3B4VC 1XX6A 2ORVA 4GI3C 1YU6C 4L9MA 2J9RA 4UXHA 5CCMA 2SGEI 4E1RA 2ORWA 1PPFI 1OMUA 3UEYA 1SGYI 1YTPA 1XBTA 2ENZA 3QTLD 4E1PA 2FNFX 2N52A 2VRWB 1N13A 1Z7KB 3FC3A 1DS2I 2OD1A 1M8CA 1PCEA 2L7XA 1SGRI 3OXFA 3PDNA 2SGFI 5EX3A 1UVFA 3VDPA 2QQCA 2A20A 1CGII 4FKDA 3UEJA 2SGPI 1KBEA 1PJUA 1SGNI 1TURA 1AN1I 1U5KA 2V53A 3E59A 5HI7A 1Y1CA 2P6AC 2ROWA 5DAEA 1OYVI 1XA6A 3SEKC 4B6DA 2ELIA 1FARA 1FAQA 2ENNA 2UZ3A 2GKTI 1W3SA 1IW4A 1LR9A 2B0UC 2F3CI 2LUYA 4UXJA 5JHWC 2KMOA 1TBOA 3BJIA 3UGIA 1LR8A 2YQPA 2J87A 1PTQA 1CHOI 3SGBI 1CGJI 1HPTA 4JCVE 2W0TA 1VDDA 1HJAI 1TUSA 1KMAA 1IY6A 2QPOA 2ODDA 2L8EA 2YUUA 3GOXA 2JYYA 3E2IA 2N17A 1CE3A 2WVJA 1H0ZA 1BUSA 4UXIA 2NU4I 1TBNA 1UVGA 3OXLA 1R79A 5FUWA 2NU3I 2GKVA 1PTRA 2JXDA 2QQ0A 4HGUA 2SGQI 2GKRI 1LR7A 1NUBA 2V1CC 2B8TA 1MT1A 1V1IA 4OVOA 2N1AB 3UFFA 1FYBA 5CCLA 2OVOA 2ERWA 3OL0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FUV A;  2JA1 A;  5FUY A;  4FKD A;  3UEJ A;  1KBE A;  1W4R A;  2QPO A;  2QQE A;  2YUU A;  3UGD A;  1RFH A;  3E2I A;  1XX6 A;  2ORV A;  2WVJ A;  2GVI A;  2ROW A;  3KY9 A;  1XA6 A;  4L9M A;  4UXI A;  2J9R A;  4UXH A;  4B6D A;  1TBN A;  5FUW A;  2ELI A;  1R79 A;  1FAR A;  2ORW A;  1FAQ A;  2ENN A;  2UZ3 A;  1PTR A;  3UEY A;  2QQ0 A;  3UGL A;  1KBF A;  1PTQ A;  1XBT A;  2ENZ A;  2E73 A;  4UXJ A;  2B8T A;  3CXL A;  5FUX A;  1TBO A;  2FNF X;  3UFF A;  2VRW B;  3BJI A;  3UGI A;  2J87 A;  1Y8F A;  2DB6 A; 
#chains in the Genus database with same CATH topology
 4A24 A;  1TBQ R;  2LEO A;  1CT4 I;  2WCY A;  1CSO I;  1TIH A;  1UUC A;  1WGC A;  2KMR A;  1X4S A;  1M8B A;  2NU2 I;  2RC4 A;  2SGD I;  3R5D A;  2CJS C;  2DIP A;  5EX0 A;  1W4R A;  2NU1 I;  2QQE A;  1HDL A;  1BMO A;  3RU0 A;  3OVO A;  3VDP A;  2ARP F;  1SGQ I;  2GVI A;  5J8F A;  3KY9 A;  4SGB I;  1X74 A;  2JZM A;  3HH2 C;  1CT0 I;  5E3P A;  1CT2 I;  1HEV A;  1TOT A;  1KBF A;  3UGL A;  2V1C A;  3TJQ A;  1IY5 A;  3OXG A;  1TGS I;  2UVO A;  2BUS A;  2E73 A;  3VE5 A;  3CXL A;  1SGP I;  5FUX A;  2NU0 I;  1MJ9 A;  3SGQ I;  1TBR R;  3TOA A;  2KMQ A;  2K9H A;  1Z2I A;  2KMP A;  1K7T A;  1Y1B A;  3MEK A;  1V1H A;  1Y8F A;  1SGD I;  2E5R A;  2DB6 A;  2N71 A;  5FUV A;  2JA1 A;  1ULM A;  2QQD A;  1OVO A;  1R0R I;  2DKV A;  2M5X A;  5FUY A;  3FSY A;  2KCX A;  1SGE I;  3VDU A;  2XRC A;  2WGC A;  3QWP A;  1DS3 I;  3QAH A;  1OMT A;  2JW6 A;  3D00 A;  3UGD A;  5HQ8 A;  1RFH A;  3B4V C;  1XX6 A;  2ORV A;  4GI3 C;  1YU6 C;  4L9M A;  2J9R A;  4UXH A;  5CCM A;  2SGE I;  4E1R A;  2ORW A;  1PPF I;  1OMU A;  3TO9 A;  3UEY A;  1SGY I;  1YTP A;  1XBT A;  2ENZ A;  3QTL D;  3UOE A;  1K7U A;  3TO7 A;  4E1P A;  2FNF X;  9WGA A;  2N52 A;  1WTJ A;  2VRW B;  1N13 A;  1Z7K B;  7WGA A;  1MJA A;  1P9G A;  1MJB A;  3TO6 A;  3FC3 A;  1DS2 I;  2OD1 A;  1Q9B A;  1M8C A;  1PCE A;  2CWG A;  1SGR I;  2L7X A;  3OXF A;  2SGF I;  3PDN A;  1UVF A;  5EX3 A;  2QQC A;  2A20 A;  1CGI I;  1FY7 A;  4FKD A;  5CCL A;  3UEJ A;  2SGP I;  1KBE A;  1PJU A;  1SGN I;  1TUR A;  2X3T A;  4DNC A;  2OZU A;  1AN1 I;  1U5K A;  2V53 A;  2RIJ A;  3E59 A;  5HI7 A;  2GIV A;  1Y1C A;  2OU2 A;  2P6A C;  2ROW A;  3R5A A;  5DAE A;  1OYV I;  1XA6 A;  5J8C A;  3SEK C;  4B6D A;  1S20 A;  2ELI A;  1FAR A;  1FAQ A;  5E3Q A;  2ENN A;  2UZ3 A;  2GKT I;  1UHA A;  3R5C A;  1W3S A;  3TOB A;  1IW4 A;  1LR9 A;  2B0U C;  2F3C I;  2LUY A;  4UXJ A;  5JHW C;  2KMO A;  1TBO A;  1ULN A;  3BJI A;  5E3R A;  3UGI A;  1NXU A;  1LR8 A;  2YQP A;  2J87 A;  1PTQ A;  1CHO I;  1WKX A;  1CGJ I;  2Y0M A;  4WP4 A;  1HPT A;  4JCV E;  3SGB I;  2W0T A;  1VDD A;  1HJA I;  1TUS A;  4AML A;  1KMA A;  1WGT A;  1IY6 A;  2QPO A;  2ODD A;  1K7V A;  2L8E A;  2LB7 A;  3R5B A;  2CWH A;  2YUU A;  2JYY A;  3GOX A;  3E2I A;  2N17 A;  2PQ8 A;  1CE3 A;  2WVJ A;  2X52 A;  1H0Z A;  1BUS A;  4UXI A;  2NU4 I;  1TBN A;  1UVG A;  3OXL A;  1R79 A;  5FUW A;  2NU3 I;  2GKV A;  1PTR A;  2JXD A;  2QQ0 A;  4HGU A;  4MPI A;  2SGQ I;  2GKR I;  1LR7 A;  1NUB A;  2V1C C;  2B8T A;  1MT1 A;  1V1I A;  2CWF A;  2N1A B;  4OVO A;  3FSX A;  3UFF A;  1ULK A;  1FYB A;  1P9Z A;  2OVO A;  2ERW A;  3OL0 A; 
#chains in the Genus database with same CATH homology
 4A24 A;  1TBQ R;  2LEO A;  1CT4 I;  2WCY A;  1CSO I;  1TIH A;  1UUC A;  2KMR A;  5HQ8 A;  1X4S A;  1M8B A;  2NU2 I;  2SGD I;  5EX0 A;  2CJS C;  2DIP A;  1W4R A;  2NU1 I;  2QQE A;  1HDL A;  1BMO A;  3RU0 A;  3OVO A;  2ARP F;  1SGQ I;  2GVI A;  3KY9 A;  4SGB I;  1X74 A;  2JZM A;  3HH2 C;  1CT0 I;  1CT2 I;  1TOT A;  1KBF A;  3UGL A;  2V1C A;  3TJQ A;  1IY5 A;  3OXG A;  1TGS I;  3VE5 A;  2BUS A;  2E73 A;  3CXL A;  1SGP I;  5FUX A;  2NU0 I;  3SGQ I;  1TBR R;  2KMQ A;  2K9H A;  2KMP A;  3MEK A;  1Y1B A;  1V1H A;  1Y8F A;  1SGD I;  2E5R A;  2DB6 A;  2N71 A;  5FUV A;  2JA1 A;  2QQD A;  1OVO A;  1R0R I;  5FUY A;  2M5X A;  2KCX A;  1SGE I;  3VDU A;  2XRC A;  3QWP A;  1DS3 I;  1OMT A;  2JW6 A;  3D00 A;  3UGD A;  1RFH A;  3B4V C;  1XX6 A;  2ORV A;  4GI3 C;  1YU6 C;  4L9M A;  2J9R A;  4UXH A;  5CCM A;  2SGE I;  4E1R A;  2ORW A;  1PPF I;  1OMU A;  3UEY A;  1SGY I;  1YTP A;  1XBT A;  2ENZ A;  3QTL D;  4E1P A;  2FNF X;  2N52 A;  2VRW B;  1N13 A;  1Z7K B;  3FC3 A;  1DS2 I;  2OD1 A;  1M8C A;  1PCE A;  2L7X A;  1SGR I;  3OXF A;  3PDN A;  2SGF I;  5EX3 A;  1UVF A;  3VDP A;  2QQC A;  2A20 A;  1CGI I;  4FKD A;  3UEJ A;  2SGP I;  1KBE A;  1PJU A;  1SGN I;  1TUR A;  1AN1 I;  1U5K A;  2V53 A;  3E59 A;  5HI7 A;  1Y1C A;  2P6A C;  2ROW A;  5DAE A;  1OYV I;  1XA6 A;  3SEK C;  4B6D A;  2ELI A;  1FAR A;  1FAQ A;  2ENN A;  2UZ3 A;  2GKT I;  1W3S A;  1IW4 A;  1LR9 A;  2B0U C;  2F3C I;  2LUY A;  4UXJ A;  5JHW C;  2KMO A;  1TBO A;  3BJI A;  3UGI A;  1LR8 A;  2YQP A;  2J87 A;  1PTQ A;  1CHO I;  3SGB I;  1CGJ I;  1HPT A;  4JCV E;  2W0T A;  1VDD A;  1HJA I;  1TUS A;  1KMA A;  1IY6 A;  2QPO A;  2ODD A;  2L8E A;  2YUU A;  3GOX A;  2JYY A;  3E2I A;  2N17 A;  1CE3 A;  2WVJ A;  1H0Z A;  1BUS A;  4UXI A;  2NU4 I;  1TBN A;  1UVG A;  3OXL A;  1R79 A;  5FUW A;  2NU3 I;  2GKV A;  1PTR A;  2JXD A;  2QQ0 A;  4HGU A;  2SGQ I;  2GKR I;  1LR7 A;  1NUB A;  2V1C C;  2B8T A;  1MT1 A;  1V1I A;  4OVO A;  2N1A B;  3UFF A;  1FYB A;  5CCL A;  2OVO A;  2ERW A;  3OL0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...