1RFHA

Solution structure of the c1 domain of nore1, a novel ras effector
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
PRVLAERGEGHRFVELALRGGPGWCDLCGREVLRQALRCANCKFTCHSECRSLIQLDCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Ras association (RalGDS/AF-6) domain family 5
publication title The solution structure of C1 domain of Nore1
rcsb
source organism Mus musculus
total genus 8
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2003-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1rfhA01
2UZ3A 1XX6A 2ORWA 4UXJA 2J87A 3UGDA 2E73A 1XA6A 2ELIA 2B8TA 1TBOA 2QQ0A 2WVJA 1PTQA 2ORVA 3CXLA 1R79A 1KBEA 1W4RA 5FUVA 2YUUA 5FUYA 3UFFA 5FUXA 5FUWA 2DB6A 2JA1A 2J9RA 1Y8FA 2QQEA 2ROWA 3UEYA 1FARA 1PTRA 4UXIA 3UGLA 1TBNA 4B6DA 3KY9A 2ENNA 3E2IA 4L9MA 3UGIA 3BJIA 2GVIA 2ENZA 1XBTA 1RFHA 3UEJA 2QPOA 4UXHA 4FKDA 1KBFA 1FAQA 2FNFX 2VRWB
chains in the Genus database with same CATH superfamily
1TBRR 1LR7A 5EX0A 1XX6A 2V1CC 4UXJA 1UVGA 2F3CI 2WGCA 2GIVA 1X74A 5E3QA 4AMLA 2JZMA 5J8CA 3VE5A 2KMRA 2QQ0A 2WVJA 2SGQI 2XRCA 3OVOA 4WP4A 3TO6A 4A24A 1MJBA 3UOEA 3R5AA 2GKRI 1ULMA 3TJQA 1LR9A 1K7UA 2DB6A 2JA1A 7WGAA 5DAEA 1LR8A 2GKVA 1PTRA 2M5XA 1Y1BA 2K9HA 4MPIA 1U5KA 1H0ZA 1TBNA 3KY9A 1MT1A 2NU4I 1KMAA 1BUSA 1XBTA 3UEJA 4UXHA 5E3PA 2SGDI 1P9ZA 4SGBI 3D00A 3SGQI 4E1PA 3SGBI 1TBQR 2NU1I 3UGDA 3E59A 1XA6A 3TOBA 1PCEA 2ELIA 2V1CA 2W0TA 2N71A 1Z2IA 4GI3C 2SGFI 1TIHA 2OD1A 1R79A 3CXLA 3PDNA 2CWGA 2KMPA 1KBEA 3VDUA 2A20A 4DNCA 2SGPI 2CWFA 5FUVA 3TOAA 5CCMA 5FUYA 1Z7KB 2N52A 1SGYI 2OZUA 5HQ8A 5FUXA 5FUWA 1FYBA 3TO7A 1K7TA 2QQEA 1M8CA 2ROWA 1CE3A 1BMOA 1NXUA 9WGAA 1WTJA 1MJ9A 4B6DA 1X4SA 1WGCA 4L9MA 1DS2I 1RFHA 2KMOA 1CSOI 2PQ8A 2QPOA 2LB7A 2CWHA 2Y0MA 1CT2I 1K7VA 1YTPA 2UZ3A 3FSYA 5JHWC 3GOXA 1SGEI 2ORWA 2J87A 2WCYA 2NU0I 2E73A 2P6AC 1SGPI 2LUYA 2GKTI 5EX3A 3OXFA 3VDPA 2YQPA 1TBOA 1V1IA 2RIJA 1PTQA 3QWPA 3RU0A 3SEKC 5HI7A 2X3TA 1S20A 1W4RA 4JCVE 1CT0I 1TURA 1WKXA 2YUUA 4HGUA 4E1RA 3HH2C 1UHAA 3UFFA 1WGTA 2JYYA 2KCXA 1Y8FA 2N1AB 1DS3I 2QQCA 3QAHA 1OVOA 1TOTA 3UGLA 2N17A 1NUBA 1CT4I 1R0RI 2ENNA 2L7XA 2LEOA 3E2IA 1P9GA 2V53A 2DIPA 3BJIA 3OXGA 1ULNA 2GVIA 3FSXA 3R5BA 3UGIA 4FKDA 1W3SA 2SGEI 1FAQA 1AN1I 1V1HA 2BUSA 2VRWB 5E3RA 3R5DA 1SGDI 2X52A 1CHOI 1YU6C 1UVFA 1TUSA 2ODDA 5J8FA 2B0UC 2B8TA 3OL0A 3MEKA 1IY6A 1SGNI 1TGSI 1PPFI 1HJAI 1UUCA 1SGQI 1MJAA 2ERWA 2ORVA 2QQDA 3OXLA 1SGRI 2NU3I 2JW6A 1CGJI 2JXDA 3FC3A 1PJUA 3R5CA 1OMUA 1OYVI 1Q9BA 3B4VC 1HEVA 2NU2I 2DKVA 1HPTA 2J9RA 1ULKA 1HDLA 3UEYA 1FARA 3TO9A 3QTLD 1OMTA 1VDDA 2ARPF 2OVOA 4UXIA 2RC4A 1CGII 2E5RA 1FY7A 1IW4A 1IY5A 1N13A 4OVOA 1Y1CA 2ENZA 2UVOA 2OU2A 2KMQA 1M8BA 2CJSC 1KBFA 2FNFX 2L8EA 5CCLA
chains in the Genus database with same CATH topology
1TBRR 1LR7A 5EX0A 1XX6A 2V1CC 4UXJA 1UVGA 2F3CI 1X74A 2JZMA 3VE5A 2KMRA 2QQ0A 2WVJA 2SGQI 2XRCA 3OVOA 4A24A 2GKRI 3TJQA 1LR9A 2DB6A 2JA1A 5DAEA 1LR8A 2GKVA 1PTRA 2M5XA 1Y1BA 2K9HA 1H0ZA 1U5KA 1TBNA 3KY9A 1MT1A 2NU4I 1KMAA 1BUSA 1XBTA 3UEJA 4UXHA 2SGDI 4SGBI 3D00A 3SGQI 4E1PA 3SGBI 1TBQR 2NU1I 3UGDA 3E59A 1XA6A 1PCEA 2ELIA 2V1CA 2W0TA 2N71A 4GI3C 2SGFI 1TIHA 2OD1A 1R79A 3CXLA 3PDNA 3VDUA 2KMPA 1KBEA 2A20A 5CCMA 2SGPI 5FUVA 5FUYA 1Z7KB 2N52A 1SGYI 5HQ8A 5FUXA 5FUWA 1FYBA 2QQEA 1M8CA 2ROWA 1CE3A 1BMOA 4B6DA 1X4SA 4L9MA 1DS2I 1RFHA 2KMOA 1CSOI 2QPOA 1CT2I 1YTPA 2UZ3A 5JHWC 3GOXA 1SGEI 2ORWA 2J87A 2WCYA 2NU0I 2E73A 2P6AC 1SGPI 2LUYA 2GKTI 5EX3A 3OXFA 3VDPA 2YQPA 1TBOA 1V1IA 1PTQA 3QWPA 3RU0A 3SEKC 5HI7A 1W4RA 4JCVE 1CT0I 1TURA 2YUUA 4HGUA 4E1RA 3HH2C 3UFFA 2JYYA 2KCXA 1Y8FA 2N1AB 1DS3I 2QQCA 1OVOA 1TOTA 3UGLA 2N17A 1NUBA 1CT4I 1R0RI 2ENNA 2L7XA 2LEOA 3E2IA 2V53A 2DIPA 3BJIA 3OXGA 2GVIA 3UGIA 4FKDA 1W3SA 2SGEI 1FAQA 1AN1I 2BUSA 1V1HA 2VRWB 1SGDI 1CHOI 1YU6C 1UVFA 1TUSA 2ODDA 2B0UC 2B8TA 3OL0A 3MEKA 1IY6A 1SGNI 1TGSI 1PPFI 1HJAI 1UUCA 1SGQI 2ERWA 2ORVA 2QQDA 3OXLA 1SGRI 2NU3I 2JW6A 1CGJI 2JXDA 3FC3A 1PJUA 1OMUA 1OYVI 3B4VC 2NU2I 1HPTA 2J9RA 1HDLA 3UEYA 1FARA 3QTLD 2ARPF 1OMTA 1VDDA 2OVOA 4UXIA 1IY5A 1CGII 2E5RA 1IW4A 1N13A 4OVOA 1Y1CA 2ENZA 2KMQA 1M8BA 2CJSC 1KBFA 2FNFX 2L8EA 5CCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZ3 A;  1XX6 A;  2ORW A;  4UXJ A;  2J87 A;  3UGD A;  2E73 A;  1XA6 A;  2ELI A;  2B8T A;  1TBO A;  2QQ0 A;  2WVJ A;  1PTQ A;  2ORV A;  3CXL A;  1R79 A;  1KBE A;  1W4R A;  5FUV A;  2YUU A;  5FUY A;  3UFF A;  5FUX A;  5FUW A;  2DB6 A;  2JA1 A;  2J9R A;  1Y8F A;  2QQE A;  2ROW A;  3UEY A;  1FAR A;  1PTR A;  4UXI A;  3UGL A;  1TBN A;  4B6D A;  3KY9 A;  2ENN A;  3E2I A;  4L9M A;  3UGI A;  3BJI A;  2GVI A;  2ENZ A;  1XBT A;  1RFH A;  3UEJ A;  2QPO A;  4UXH A;  4FKD A;  1KBF A;  1FAQ A;  2FNF X;  2VRW B; 
#chains in the Genus database with same CATH topology
 1TBR R;  1LR7 A;  5EX0 A;  1XX6 A;  2V1C C;  4UXJ A;  1UVG A;  2F3C I;  2WGC A;  2GIV A;  1X74 A;  5E3Q A;  4AML A;  2JZM A;  5J8C A;  3VE5 A;  2KMR A;  2QQ0 A;  2WVJ A;  2SGQ I;  2XRC A;  3OVO A;  4WP4 A;  3TO6 A;  4A24 A;  1MJB A;  3UOE A;  3R5A A;  2GKR I;  1ULM A;  3TJQ A;  1LR9 A;  1K7U A;  2DB6 A;  2JA1 A;  7WGA A;  5DAE A;  1LR8 A;  2GKV A;  1PTR A;  2M5X A;  1Y1B A;  2K9H A;  4MPI A;  1U5K A;  1H0Z A;  1TBN A;  3KY9 A;  1MT1 A;  2NU4 I;  1KMA A;  1BUS A;  1XBT A;  3UEJ A;  4UXH A;  5E3P A;  2SGD I;  1P9Z A;  4SGB I;  3D00 A;  3SGQ I;  4E1P A;  3SGB I;  1TBQ R;  2NU1 I;  3UGD A;  3E59 A;  1XA6 A;  3TOB A;  1PCE A;  2ELI A;  2V1C A;  2W0T A;  2N71 A;  1Z2I A;  4GI3 C;  2SGF I;  1TIH A;  2OD1 A;  1R79 A;  3CXL A;  3PDN A;  2CWG A;  2KMP A;  1KBE A;  3VDU A;  2A20 A;  4DNC A;  2SGP I;  2CWF A;  5FUV A;  3TOA A;  5CCM A;  5FUY A;  1Z7K B;  2N52 A;  1SGY I;  2OZU A;  5HQ8 A;  5FUX A;  5FUW A;  1FYB A;  3TO7 A;  1K7T A;  2QQE A;  1M8C A;  2ROW A;  1CE3 A;  1BMO A;  1NXU A;  9WGA A;  1WTJ A;  1MJ9 A;  4B6D A;  1X4S A;  1WGC A;  4L9M A;  1DS2 I;  1RFH A;  2KMO A;  1CSO I;  2PQ8 A;  2QPO A;  2LB7 A;  2CWH A;  2Y0M A;  1CT2 I;  1K7V A;  1YTP A;  2UZ3 A;  3FSY A;  5JHW C;  3GOX A;  1SGE I;  2ORW A;  2J87 A;  2WCY A;  2NU0 I;  2E73 A;  2P6A C;  1SGP I;  2LUY A;  2GKT I;  5EX3 A;  3OXF A;  3VDP A;  2YQP A;  1TBO A;  1V1I A;  2RIJ A;  1PTQ A;  3QWP A;  3RU0 A;  3SEK C;  5HI7 A;  2X3T A;  1S20 A;  1W4R A;  4JCV E;  1CT0 I;  1TUR A;  1WKX A;  2YUU A;  4HGU A;  4E1R A;  3HH2 C;  1UHA A;  3UFF A;  1WGT A;  2JYY A;  2KCX A;  1Y8F A;  2N1A B;  1DS3 I;  2QQC A;  3QAH A;  1OVO A;  1TOT A;  3UGL A;  2N17 A;  1NUB A;  1CT4 I;  1R0R I;  2ENN A;  2L7X A;  2LEO A;  3E2I A;  1P9G A;  2V53 A;  2DIP A;  3BJI A;  3OXG A;  1ULN A;  2GVI A;  3FSX A;  3R5B A;  3UGI A;  4FKD A;  1W3S A;  2SGE I;  1FAQ A;  1AN1 I;  1V1H A;  2BUS A;  2VRW B;  5E3R A;  3R5D A;  1SGD I;  2X52 A;  1CHO I;  1YU6 C;  1UVF A;  1TUS A;  2ODD A;  5J8F A;  2B0U C;  2B8T A;  3OL0 A;  3MEK A;  1IY6 A;  1SGN I;  1TGS I;  1PPF I;  1HJA I;  1UUC A;  1SGQ I;  1MJA A;  2ERW A;  2ORV A;  2QQD A;  3OXL A;  1SGR I;  2NU3 I;  2JW6 A;  1CGJ I;  2JXD A;  3FC3 A;  1PJU A;  3R5C A;  1OMU A;  1OYV I;  1Q9B A;  3B4V C;  1HEV A;  2NU2 I;  2DKV A;  1HPT A;  2J9R A;  1ULK A;  1HDL A;  3UEY A;  1FAR A;  3TO9 A;  3QTL D;  1OMT A;  1VDD A;  2ARP F;  2OVO A;  4UXI A;  2RC4 A;  1CGI I;  2E5R A;  1FY7 A;  1IW4 A;  1IY5 A;  1N13 A;  4OVO A;  1Y1C A;  2ENZ A;  2UVO A;  2OU2 A;  2KMQ A;  1M8B A;  2CJS C;  1KBF A;  2FNF X;  2L8E A;  5CCL A; 
#chains in the Genus database with same CATH homology
 1TBR R;  1LR7 A;  5EX0 A;  1XX6 A;  2V1C C;  4UXJ A;  1UVG A;  2F3C I;  1X74 A;  2JZM A;  3VE5 A;  2KMR A;  2QQ0 A;  2WVJ A;  2SGQ I;  2XRC A;  3OVO A;  4A24 A;  2GKR I;  3TJQ A;  1LR9 A;  2DB6 A;  2JA1 A;  5DAE A;  1LR8 A;  2GKV A;  1PTR A;  2M5X A;  1Y1B A;  2K9H A;  1H0Z A;  1U5K A;  1TBN A;  3KY9 A;  1MT1 A;  2NU4 I;  1KMA A;  1BUS A;  1XBT A;  3UEJ A;  4UXH A;  2SGD I;  4SGB I;  3D00 A;  3SGQ I;  4E1P A;  3SGB I;  1TBQ R;  2NU1 I;  3UGD A;  3E59 A;  1XA6 A;  1PCE A;  2ELI A;  2V1C A;  2W0T A;  2N71 A;  4GI3 C;  2SGF I;  1TIH A;  2OD1 A;  1R79 A;  3CXL A;  3PDN A;  3VDU A;  2KMP A;  1KBE A;  2A20 A;  5CCM A;  2SGP I;  5FUV A;  5FUY A;  1Z7K B;  2N52 A;  1SGY I;  5HQ8 A;  5FUX A;  5FUW A;  1FYB A;  2QQE A;  1M8C A;  2ROW A;  1CE3 A;  1BMO A;  4B6D A;  1X4S A;  4L9M A;  1DS2 I;  1RFH A;  2KMO A;  1CSO I;  2QPO A;  1CT2 I;  1YTP A;  2UZ3 A;  5JHW C;  3GOX A;  1SGE I;  2ORW A;  2J87 A;  2WCY A;  2NU0 I;  2E73 A;  2P6A C;  1SGP I;  2LUY A;  2GKT I;  5EX3 A;  3OXF A;  3VDP A;  2YQP A;  1TBO A;  1V1I A;  1PTQ A;  3QWP A;  3RU0 A;  3SEK C;  5HI7 A;  1W4R A;  4JCV E;  1CT0 I;  1TUR A;  2YUU A;  4HGU A;  4E1R A;  3HH2 C;  3UFF A;  2JYY A;  2KCX A;  1Y8F A;  2N1A B;  1DS3 I;  2QQC A;  1OVO A;  1TOT A;  3UGL A;  2N17 A;  1NUB A;  1CT4 I;  1R0R I;  2ENN A;  2L7X A;  2LEO A;  3E2I A;  2V53 A;  2DIP A;  3BJI A;  3OXG A;  2GVI A;  3UGI A;  4FKD A;  1W3S A;  2SGE I;  1FAQ A;  1AN1 I;  2BUS A;  1V1H A;  2VRW B;  1SGD I;  1CHO I;  1YU6 C;  1UVF A;  1TUS A;  2ODD A;  2B0U C;  2B8T A;  3OL0 A;  3MEK A;  1IY6 A;  1SGN I;  1TGS I;  1PPF I;  1HJA I;  1UUC A;  1SGQ I;  2ERW A;  2ORV A;  2QQD A;  3OXL A;  1SGR I;  2NU3 I;  2JW6 A;  1CGJ I;  2JXD A;  3FC3 A;  1PJU A;  1OMU A;  1OYV I;  3B4V C;  2NU2 I;  1HPT A;  2J9R A;  1HDL A;  3UEY A;  1FAR A;  3QTL D;  2ARP F;  1OMT A;  1VDD A;  2OVO A;  4UXI A;  1IY5 A;  1CGI I;  2E5R A;  1IW4 A;  1N13 A;  4OVO A;  1Y1C A;  2ENZ A;  2KMQ A;  1M8B A;  2CJS C;  1KBF A;  2FNF X;  2L8E A;  5CCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...