1RFHA

Solution structure of the c1 domain of nore1, a novel ras effector
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
b'PRVLAERGEGHRFVELALRGGPGWCDLCGREVLRQALRCANCKFTCHSECRSLIQLDCR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ras association (RalGDS/AF-6) domain family 5
publication title The solution structure of C1 domain of Nore1
rcsb
source organism Mus musculus
molecule tags Metal binding protein
total genus 8
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2003-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1rfhA01
4FKDA 3BJIA 2B8TA 2JA1A 4L9MA 5FUXA 1Y8FA 1XA6A 3UFFA 1XBTA 2VRWB 2ENZA 2GVIA 1FARA 2J9RA 3CXLA 1TBOA 3UEYA 4UXIA 2QQEA 2UZ3A 3UGLA 3UEJA 1TBNA 4B6DA 3UGIA 1PTRA 2E73A 2WVJA 3UGDA 1RFHA 3E2IA 1PTQA 1FAQA 2J87A 2ROWA 4UXHA 2ENNA 1W4RA 1XX6A 2QPOA 2QQ0A 2DB6A 4UXJA 1R79A 2FNFX 2ORWA 5FUWA 1KBEA 3KY9A 5FUVA 2ELIA 5FUYA 2ORVA 1KBFA 2YUUA
chains in the Genus database with same CATH superfamily
4FKDA 1TBRR 1TGSI 1LR8A 1CT4I 1Y8FA 3FSXA 2GKRI 2L7XA 2VRWB 5CCMA 2GVIA 2V53A 1KMAA 4JCVE 1FARA 2F3CI 1K7UA 2Y0MA 3R5DA 1K7VA 5J8CA 1BMOA 4UXIA 2QQEA 4OVOA 1ULNA 2CWGA 2UZ3A 3UEJA 1ULMA 2LEOA 4B6DA 1CHOI 5HI7A 3B4VC 3R5BA 1MJ9A 1M8BA 3UGIA 1LR9A 1CE3A 3OXFA 1OYVI 2LUYA 2N17A 3E2IA 3SEKC 2KMPA 1SGNI 1FAQA 4UXHA 3GOXA 1W4RA 4UXJA 2RC4A 5EX0A 2DB6A 2ODDA 5E3PA 1HPTA 2ORWA 1LR7A 1SGPI 3TOAA 1CGJI 5EX3A 1X74A 5JHWC 3E59A 1K7TA 1SGDI 2B8TA 1WGTA 5FUXA 3FC3A 1XA6A 3OXGA 1IY5A 1N13A 2A20A 2ENZA 3VDUA 1WGCA 1VDDA 1H0ZA 2JYYA 2B0UC 2K9HA 4E1PA 1TBOA 2WGCA 1Z7KB 3TOBA 2ARPF 5HQ8A 1TBNA 5E3RA 3TJQA 1M8CA 2KMOA 2CWHA 1OMTA 2N52A 2P6AC 2WCYA 1PTRA 1RFHA 1TUSA 1X4SA 2GIVA 2X52A 1P9ZA 2KMQA 2SGDI 1FYBA 2ROWA 1PCEA 2V1CA 3OVOA 2M5XA 1Q9BA 1AN1I 1OMUA 2ENNA 4SGBI 2NU2I 2FNFX 2PQ8A 1NXUA 1UVFA 1KBEA 2GKTI 3KY9A 5DAEA 3OL0A 5FUVA 1TIHA 3MEKA 4E1RA 3R5CA 2KCXA 1CSOI 1HEVA 1W3SA 2ERWA 1SGRI 1Z2IA 2W0TA 1YTPA 3UOEA 1P9GA 3SGQI 1TURA 1Y1BA 2NU4I 2SGQI 2OVOA 2SGEI 2X3TA 3CXLA 1DS2I 2NU3I 7WGAA 1CGII 2SGPI 2GKVA 1DS3I 1PJUA 2NU0I 2OD1A 3RU0A 1WTJA 3UGLA 5J8FA 2NU1I 4DNCA 1PPFI 2OZUA 1YU6C 3D00A 2YQPA 1S20A 3TO9A 2CJSC 3QWPA 1PTQA 2J87A 2CWFA 4WP4A 2SGFI 1U5KA 1XX6A 2JZMA 3OXLA 3QTLD 3FSYA 1R79A 1SGYI 1SGQI 5FUWA 5E3QA 2V1CC 1V1HA 1NUBA 2ELIA 5FUYA 2BUSA 3TO6A 1ULKA 2YUUA 1V1IA 3BJIA 1WKXA 1Y1CA 2JA1A 2QQCA 4L9MA 2DIPA 2KMRA 2QQDA 1XBTA 1R0RI 1UUCA 2XRCA 4GI3C 1OVOA 3QAHA 4AMLA 2LB7A 2E5RA 1IW4A 2J9RA 1MT1A 1UVGA 3TO7A 3UEYA 2JW6A 2OU2A 2UVOA 3UFFA 1TBQR 1MJBA 1SGEI 3R5AA 1CT0I 1UHAA 2L8EA 3PDNA 1IY6A 1HJAI 2E73A 2WVJA 1CT2I 3UGDA 3VE5A 4MPIA 3SGBI 4A24A 1BUSA 1HDLA 1MJAA 3VDPA 2N71A 1TOTA 2QPOA 2QQ0A 5CCLA 9WGAA 2RIJA 2N1AB 2JXDA 4HGUA 1FY7A 2DKVA 2ORVA 1KBFA 3HH2C
chains in the Genus database with same CATH topology
4FKDA 1TBRR 1TGSI 1LR8A 1CT4I 1Y8FA 5CCMA 2GKRI 2L7XA 2VRWB 1KMAA 2GVIA 2V53A 4JCVE 1FARA 2F3CI 1BMOA 4UXIA 2QQEA 4OVOA 2UZ3A 3UEJA 2LEOA 4B6DA 1CHOI 5HI7A 3B4VC 1M8BA 3UGIA 1LR9A 1CE3A 3OXFA 1OYVI 2LUYA 2N17A 3E2IA 3SEKC 2KMPA 1SGNI 1FAQA 4UXHA 3GOXA 1W4RA 4UXJA 5EX0A 2DB6A 2ODDA 1HPTA 2ORWA 1LR7A 1SGPI 1CGJI 5EX3A 1X74A 5JHWC 3E59A 1SGDI 2B8TA 5FUXA 3FC3A 1XA6A 3OXGA 1IY5A 1N13A 2A20A 2ENZA 3VDUA 1VDDA 1H0ZA 2JYYA 2B0UC 2K9HA 4E1PA 1TBOA 1Z7KB 5HQ8A 2ARPF 1TBNA 3TJQA 1M8CA 2KMOA 1OMTA 2N52A 2P6AC 2WCYA 1PTRA 1RFHA 1TUSA 1X4SA 1FYBA 2KMQA 2SGDI 2ROWA 1PCEA 2V1CA 3OVOA 2M5XA 2ENNA 1AN1I 1OMUA 4SGBI 2NU2I 2FNFX 1UVFA 1KBEA 2GKTI 3KY9A 5DAEA 3OL0A 5FUVA 1TIHA 3MEKA 4E1RA 2KCXA 1CSOI 1W3SA 2ERWA 1SGRI 2W0TA 1YTPA 3SGQI 1TURA 1Y1BA 2NU4I 2SGQI 2OVOA 2SGEI 3CXLA 1DS2I 2NU3I 1CGII 2SGPI 2GKVA 1DS3I 1PJUA 2NU0I 2OD1A 3RU0A 3UGLA 2NU1I 1PPFI 1YU6C 3D00A 2YQPA 2CJSC 3QWPA 1PTQA 2J87A 2SGFI 1U5KA 1XX6A 2JZMA 3OXLA 3QTLD 1R79A 1SGYI 1SGQI 5FUWA 2V1CC 1V1HA 1NUBA 2ELIA 5FUYA 2BUSA 2YUUA 1V1IA 3BJIA 1Y1CA 2JA1A 2QQCA 4L9MA 3UFFA 2DIPA 2KMRA 2QQDA 1XBTA 1R0RI 1UUCA 2XRCA 4GI3C 1OVOA 1IW4A 2E5RA 2J9RA 1MT1A 1UVGA 3UEYA 2JW6A 1TBQR 1SGEI 1CT0I 2L8EA 3PDNA 1IY6A 1HJAI 2E73A 2WVJA 1CT2I 3UGDA 3VE5A 3SGBI 4A24A 1BUSA 1HDLA 3VDPA 2N71A 1TOTA 2QPOA 2QQ0A 5CCLA 2N1AB 2JXDA 4HGUA 2ORVA 1KBFA 3HH2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FKD A;  3BJI A;  2B8T A;  2JA1 A;  4L9M A;  5FUX A;  1Y8F A;  1XA6 A;  3UFF A;  1XBT A;  2VRW B;  2ENZ A;  2GVI A;  1FAR A;  2J9R A;  3CXL A;  1TBO A;  3UEY A;  4UXI A;  2QQE A;  2UZ3 A;  3UGL A;  3UEJ A;  1TBN A;  4B6D A;  3UGI A;  1PTR A;  2E73 A;  2WVJ A;  3UGD A;  1RFH A;  3E2I A;  1PTQ A;  1FAQ A;  2J87 A;  2ROW A;  4UXH A;  2ENN A;  1W4R A;  1XX6 A;  2QPO A;  2QQ0 A;  2DB6 A;  4UXJ A;  1R79 A;  2FNF X;  2ORW A;  5FUW A;  1KBE A;  3KY9 A;  5FUV A;  2ELI A;  5FUY A;  2ORV A;  1KBF A;  2YUU A; 
#chains in the Genus database with same CATH topology
 4FKD A;  1TBR R;  1TGS I;  1LR8 A;  1CT4 I;  1Y8F A;  3FSX A;  2GKR I;  2L7X A;  2VRW B;  5CCM A;  2GVI A;  2V53 A;  1KMA A;  4JCV E;  1FAR A;  2F3C I;  1K7U A;  2Y0M A;  3R5D A;  1K7V A;  5J8C A;  1BMO A;  4UXI A;  2QQE A;  4OVO A;  1ULN A;  2CWG A;  2UZ3 A;  3UEJ A;  1ULM A;  2LEO A;  4B6D A;  1CHO I;  5HI7 A;  3B4V C;  3R5B A;  1MJ9 A;  1M8B A;  3UGI A;  1LR9 A;  1CE3 A;  3OXF A;  1OYV I;  2LUY A;  2N17 A;  3E2I A;  3SEK C;  2KMP A;  1SGN I;  1FAQ A;  4UXH A;  3GOX A;  1W4R A;  4UXJ A;  2RC4 A;  5EX0 A;  2DB6 A;  2ODD A;  5E3P A;  1HPT A;  2ORW A;  1LR7 A;  1SGP I;  3TOA A;  1CGJ I;  5EX3 A;  1X74 A;  5JHW C;  3E59 A;  1K7T A;  1SGD I;  2B8T A;  1WGT A;  5FUX A;  3FC3 A;  1XA6 A;  3OXG A;  1IY5 A;  1N13 A;  2A20 A;  2ENZ A;  3VDU A;  1WGC A;  1VDD A;  1H0Z A;  2JYY A;  2B0U C;  2K9H A;  4E1P A;  1TBO A;  2WGC A;  1Z7K B;  3TOB A;  2ARP F;  5HQ8 A;  1TBN A;  5E3R A;  3TJQ A;  1M8C A;  2KMO A;  2CWH A;  1OMT A;  2N52 A;  2P6A C;  2WCY A;  1PTR A;  1RFH A;  1TUS A;  1X4S A;  2GIV A;  2X52 A;  1P9Z A;  2KMQ A;  2SGD I;  1FYB A;  2ROW A;  1PCE A;  2V1C A;  3OVO A;  2M5X A;  1Q9B A;  1AN1 I;  1OMU A;  2ENN A;  4SGB I;  2NU2 I;  2FNF X;  2PQ8 A;  1NXU A;  1UVF A;  1KBE A;  2GKT I;  3KY9 A;  5DAE A;  3OL0 A;  5FUV A;  1TIH A;  3MEK A;  4E1R A;  3R5C A;  2KCX A;  1CSO I;  1HEV A;  1W3S A;  2ERW A;  1SGR I;  1Z2I A;  2W0T A;  1YTP A;  3UOE A;  1P9G A;  3SGQ I;  1TUR A;  1Y1B A;  2NU4 I;  2SGQ I;  2OVO A;  2SGE I;  2X3T A;  3CXL A;  1DS2 I;  2NU3 I;  7WGA A;  1CGI I;  2SGP I;  2GKV A;  1DS3 I;  1PJU A;  2NU0 I;  2OD1 A;  3RU0 A;  1WTJ A;  3UGL A;  5J8F A;  2NU1 I;  4DNC A;  1PPF I;  2OZU A;  1YU6 C;  3D00 A;  2YQP A;  1S20 A;  3TO9 A;  2CJS C;  3QWP A;  1PTQ A;  2J87 A;  2CWF A;  4WP4 A;  2SGF I;  1U5K A;  1XX6 A;  2JZM A;  3OXL A;  3QTL D;  3FSY A;  1R79 A;  1SGY I;  1SGQ I;  5FUW A;  5E3Q A;  2V1C C;  1V1H A;  1NUB A;  2ELI A;  5FUY A;  2BUS A;  3TO6 A;  1ULK A;  2YUU A;  1V1I A;  3BJI A;  1WKX A;  1Y1C A;  2JA1 A;  2QQC A;  4L9M A;  2DIP A;  2KMR A;  2QQD A;  1XBT A;  1R0R I;  1UUC A;  2XRC A;  4GI3 C;  1OVO A;  3QAH A;  4AML A;  2LB7 A;  2E5R A;  1IW4 A;  2J9R A;  1MT1 A;  1UVG A;  3TO7 A;  3UEY A;  2JW6 A;  2OU2 A;  2UVO A;  3UFF A;  1TBQ R;  1MJB A;  1SGE I;  3R5A A;  1CT0 I;  1UHA A;  2L8E A;  3PDN A;  1IY6 A;  1HJA I;  2E73 A;  2WVJ A;  1CT2 I;  3UGD A;  3VE5 A;  4MPI A;  3SGB I;  4A24 A;  1BUS A;  1HDL A;  1MJA A;  3VDP A;  2N71 A;  1TOT A;  2QPO A;  2QQ0 A;  5CCL A;  9WGA A;  2RIJ A;  2N1A B;  2JXD A;  4HGU A;  1FY7 A;  2DKV A;  2ORV A;  1KBF A;  3HH2 C; 
#chains in the Genus database with same CATH homology
 4FKD A;  1TBR R;  1TGS I;  1LR8 A;  1CT4 I;  1Y8F A;  5CCM A;  2GKR I;  2L7X A;  2VRW B;  1KMA A;  2GVI A;  2V53 A;  4JCV E;  1FAR A;  2F3C I;  1BMO A;  4UXI A;  2QQE A;  4OVO A;  2UZ3 A;  3UEJ A;  2LEO A;  4B6D A;  1CHO I;  5HI7 A;  3B4V C;  1M8B A;  3UGI A;  1LR9 A;  1CE3 A;  3OXF A;  1OYV I;  2LUY A;  2N17 A;  3E2I A;  3SEK C;  2KMP A;  1SGN I;  1FAQ A;  4UXH A;  3GOX A;  1W4R A;  4UXJ A;  5EX0 A;  2DB6 A;  2ODD A;  1HPT A;  2ORW A;  1LR7 A;  1SGP I;  1CGJ I;  5EX3 A;  1X74 A;  5JHW C;  3E59 A;  1SGD I;  2B8T A;  5FUX A;  3FC3 A;  1XA6 A;  3OXG A;  1IY5 A;  1N13 A;  2A20 A;  2ENZ A;  3VDU A;  1VDD A;  1H0Z A;  2JYY A;  2B0U C;  2K9H A;  4E1P A;  1TBO A;  1Z7K B;  5HQ8 A;  2ARP F;  1TBN A;  3TJQ A;  1M8C A;  2KMO A;  1OMT A;  2N52 A;  2P6A C;  2WCY A;  1PTR A;  1RFH A;  1TUS A;  1X4S A;  1FYB A;  2KMQ A;  2SGD I;  2ROW A;  1PCE A;  2V1C A;  3OVO A;  2M5X A;  2ENN A;  1AN1 I;  1OMU A;  4SGB I;  2NU2 I;  2FNF X;  1UVF A;  1KBE A;  2GKT I;  3KY9 A;  5DAE A;  3OL0 A;  5FUV A;  1TIH A;  3MEK A;  4E1R A;  2KCX A;  1CSO I;  1W3S A;  2ERW A;  1SGR I;  2W0T A;  1YTP A;  3SGQ I;  1TUR A;  1Y1B A;  2NU4 I;  2SGQ I;  2OVO A;  2SGE I;  3CXL A;  1DS2 I;  2NU3 I;  1CGI I;  2SGP I;  2GKV A;  1DS3 I;  1PJU A;  2NU0 I;  2OD1 A;  3RU0 A;  3UGL A;  2NU1 I;  1PPF I;  1YU6 C;  3D00 A;  2YQP A;  2CJS C;  3QWP A;  1PTQ A;  2J87 A;  2SGF I;  1U5K A;  1XX6 A;  2JZM A;  3OXL A;  3QTL D;  1R79 A;  1SGY I;  1SGQ I;  5FUW A;  2V1C C;  1V1H A;  1NUB A;  2ELI A;  5FUY A;  2BUS A;  2YUU A;  1V1I A;  3BJI A;  1Y1C A;  2JA1 A;  2QQC A;  4L9M A;  3UFF A;  2DIP A;  2KMR A;  2QQD A;  1XBT A;  1R0R I;  1UUC A;  2XRC A;  4GI3 C;  1OVO A;  1IW4 A;  2E5R A;  2J9R A;  1MT1 A;  1UVG A;  3UEY A;  2JW6 A;  1TBQ R;  1SGE I;  1CT0 I;  2L8E A;  3PDN A;  1IY6 A;  1HJA I;  2E73 A;  2WVJ A;  1CT2 I;  3UGD A;  3VE5 A;  3SGB I;  4A24 A;  1BUS A;  1HDL A;  3VDP A;  2N71 A;  1TOT A;  2QPO A;  2QQ0 A;  5CCL A;  2N1A B;  2JXD A;  4HGU A;  2ORV A;  1KBF A;  3HH2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...