5JHWC

Crystal structure of the gdf11:follistatin 288 complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
288
structure length
282
Chain Sequence
GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth/differentiation factor 11
publication title Structural basis for potency differences between GDF8 and GDF11.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/signaling protein
total genus 65
structure length 282
sequence length 288
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
C PF09289 FOLN Follistatin/Osteonectin-like EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 5jhwC04
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 5jhwC03
3.30.60.250 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 5jhwC02
3.90.290.10 Alpha Beta Alpha-Beta Complex Extracellular Matrix Fibrillin TGF-beta binding (TB) domain 5jhwC01
2OVOA 1OYVI 2B0UC 1Y1BA 3TJQA 2JZMA 1CHOI 4HGUA 2N17A 1OVOA 2ERWA 2NU2I 1SGEI 5DAEA 1H0ZA 1TIHA 1LR7A 1YU6C 2NU3I 2SGDI 1UZJA 1KSQA 1CT2I 1SGRI 1APJA 1M8CA 1SGNI 5JHWC 1HPTA 1UZQA 1UZKA 1UVGA 2GKRI 1IY6A 2GKTI 1SGPI 1OMTA 2W86A 2KMPA 3OVOA 2SGEI 2NU0I 1TUSA 2QQCA 2GKVA 1M8BA 2F3CI 1NUBA 2KMOA 1CGJI 2JYYA 3SGQI 1UVFA 2KMQA 2N52A 1HDLA 1BUSA 2V53A 2SGFI 1Y1CA 1UZPA 1DS3I 1TBRR 2NU4I 1SGYI 1R0RI 2BUSA 3QTLD 1PPFI 1CT0I 3SGBI 1TGSI 1SGQI 3SEKC 1KMAA 1LR8A 1OMUA 1N13A 1CSOI 2LEOA 1CT4I 4SGBI 2P6AC 2KCXA 1TURA 2ARPF 1TBQR 1SGDI 1HJAI 1PJUA 1YTPA 2NU1I 1PCEA 3HH2C 2N71A 1CGII 1AN1I 1LR9A 2QQDA 3B4VC 4OVOA 2KMRA 2SGQI 1CE3A 4GI3C 1IW4A 1MT1A 1FYBA 1IY5A 1DS2I 2WCYA 2M5XA 2SGPI 1UUCA 1Z7KB 2JXDA 1BMOA 2XRCA
chains in the Genus database with same CATH superfamily
3UEJA 9WGAA 2QQEA 4B6DA 2OVOA 1R79A 1S20A 3UGLA 3TO6A 1FAQA 4AMLA 2E73A 2OD1A 1OYVI 3TO7A 2B0UC 1Y1BA 3R5BA 3TO9A 3TJQA 4E1PA 2JZMA 1CHOI 1RFHA 3MEKA 3QAHA 1MJBA 3OXFA 4HGUA 5CCMA 2N17A 1OVOA 2ERWA 1W4RA 1SGEI 1X4SA 2NU2I 5DAEA 1KBEA 1U5KA 1WTJA 1H0ZA 1TIHA 5FUVA 4E1RA 1LR7A 1Q9BA 1YU6C 2NU3I 2SGDI 1UZJA 3R5CA 1CT2I 1KSQA 2CJSC 5E3PA 3UEYA 1HEVA 1SGRI 3OXLA 1APJA 1M8CA 3D00A 1P9ZA 1SGNI 5JHWC 1HPTA 1TOTA 2UVOA 2WVJA 5FUYA 1ULKA 1UZQA 1UZKA 1UVGA 1XBTA 2GKRI 1IY6A 2GKTI 3FSXA 1SGPI 5J8FA 1V1IA 2J9RA 2YQPA 3E2IA 1OMTA 3TOAA 5EX0A 2W86A 2KMPA 3OVOA 2SGEI 2B8TA 2DKVA 3UGIA 1Y8FA 2NU0I 2RIJA 3KY9A 1TUSA 2QQCA 2GKVA 1ULNA 1M8BA 1ULMA 2F3CI 3BJIA 3PDNA 3GOXA 1KBFA 1NUBA 2L8EA 2LUYA 4UXJA 2KMOA 2JW6A 1CGJI 2JYYA 1XX6A 3SGQI 5J8CA 3TOBA 1UVFA 2KMQA 2N52A 3FSYA 4FKDA 1HDLA 1BUSA 2CWHA 2V53A 1X74A 7WGAA 2DIPA 2SGFI 1Y1CA 1UZPA 2V1CA 3FC3A 1DS3I 1TBRR 1FY7A 2A20A 1FARA 2NU4I 2X3TA 1MJAA 2RC4A 1SGYI 2GVIA 3UOEA 5CCLA 1R0RI 2BUSA 4L9MA 3QTLD 3CXLA 3UGDA 2WGCA 1PPFI 5HI7A 1P9GA 2E5RA 1CT0I 3SGBI 3E59A 4A24A 1TGSI 1K7TA 1SGQI 1TBNA 2X52A 3SEKC 1KMAA 1LR8A 1OMUA 3R5AA 2FNFX 2ORWA 2QPOA 2ENZA 1N13A 2QQ0A 1CSOI 2LEOA 2ODDA 1CT4I 1WKXA 2CWFA 4DNCA 3OL0A 4SGBI 2ELIA 4JCVE 2P6AC 5EX3A 2KCXA 2LB7A 1TURA 2ARPF 1TBQR 2V1CC 1SGDI 2J87A 1HJAI 5E3RA 1PJUA 2Y0MA 1YTPA 2NU1I 1K7UA 1MJ9A 3R5DA 3RU0A 2L7XA 1PCEA 1V1HA 1W3SA 3HH2C 1XA6A 2DB6A 2N71A 2W0TA 1CGII 4WP4A 1AN1I 2N1AB 2OZUA 2OU2A 2UZ3A 3OXGA 1K7VA 2GIVA 1LR9A 2QQDA 3B4VC 4OVOA 1WGCA 2KMRA 2SGQI 2YUUA 1CE3A 2K9HA 3QWPA 1VDDA 2PQ8A 4GI3C 3VE5A 5FUWA 1IW4A 4UXIA 5FUXA 2JA1A 1MT1A 1FYBA 2CWGA 1IY5A 1UHAA 1DS2I 4UXHA 2WCYA 5E3QA 3VDUA 3VDPA 2ROWA 2ENNA 5HQ8A 2M5XA 2SGPI 1WGTA 1Z2IA 1PTQA 1TBOA 1UUCA 1Z7KB 1PTRA 2JXDA 2ORVA 1BMOA 3UFFA 1NXUA 2VRWB 2XRCA 4MPIA
chains in the Genus database with same CATH topology
3UEJA 2QQEA 4B6DA 2OVOA 1R79A 3UGLA 1FAQA 2E73A 2OD1A 1OYVI 2B0UC 1Y1BA 3TJQA 4E1PA 2JZMA 1CHOI 1RFHA 3MEKA 3OXFA 4HGUA 5CCMA 2N17A 1OVOA 2ERWA 1W4RA 1SGEI 1X4SA 2NU2I 5DAEA 1KBEA 1U5KA 1H0ZA 1TIHA 5FUVA 4E1RA 1LR7A 1YU6C 2NU3I 2SGDI 1UZJA 1KSQA 1CT2I 2CJSC 3UEYA 1SGRI 3OXLA 1APJA 1M8CA 3D00A 1SGNI 5JHWC 1HPTA 1TOTA 2WVJA 5FUYA 1UZQA 1UZKA 1UVGA 1XBTA 2GKRI 1IY6A 2GKTI 1SGPI 1V1IA 2J9RA 2YQPA 3E2IA 1OMTA 5EX0A 2W86A 2KMPA 3OVOA 2SGEI 2B8TA 3UGIA 1Y8FA 2NU0I 3KY9A 1TUSA 2QQCA 2GKVA 1M8BA 2F3CI 3BJIA 3PDNA 3GOXA 1KBFA 1NUBA 2L8EA 2LUYA 4UXJA 2KMOA 2JW6A 1CGJI 2JYYA 1XX6A 3SGQI 1UVFA 2KMQA 2N52A 4FKDA 1HDLA 1BUSA 2V53A 1X74A 2DIPA 2SGFI 1Y1CA 1UZPA 2V1CA 3FC3A 1DS3I 1TBRR 2A20A 2NU4I 1FARA 1SGYI 2GVIA 5CCLA 1R0RI 2BUSA 4L9MA 3QTLD 3CXLA 3UGDA 1PPFI 5HI7A 2E5RA 1CT0I 3SGBI 3E59A 4A24A 1TGSI 1SGQI 1TBNA 3SEKC 1KMAA 1LR8A 1OMUA 2FNFX 2ORWA 2QPOA 2ENZA 1N13A 2QQ0A 1CSOI 2LEOA 2ODDA 1CT4I 3OL0A 4SGBI 2ELIA 4JCVE 2P6AC 5EX3A 2KCXA 2V1CC 1TURA 2ARPF 1TBQR 1SGDI 2J87A 1HJAI 1PJUA 1YTPA 2NU1I 3RU0A 2L7XA 1PCEA 1V1HA 1W3SA 3HH2C 1XA6A 2DB6A 2N71A 2W0TA 1CGII 1AN1I 2N1AB 2UZ3A 3OXGA 1LR9A 2QQDA 3B4VC 4OVOA 2KMRA 2SGQI 2YUUA 1CE3A 2K9HA 3QWPA 1VDDA 4GI3C 3VE5A 5FUWA 1IW4A 4UXIA 5FUXA 2JA1A 1MT1A 1FYBA 1IY5A 1DS2I 4UXHA 2WCYA 3VDPA 3VDUA 2ROWA 2ENNA 5HQ8A 2M5XA 2SGPI 1PTQA 1TBOA 1UUCA 1Z7KB 1PTRA 2JXDA 2ORVA 1BMOA 3UFFA 2VRWB 2XRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OVO A;  1OYV I;  2B0U C;  1Y1B A;  3TJQ A;  2JZM A;  1CHO I;  4HGU A;  2N17 A;  1OVO A;  2ERW A;  2NU2 I;  1SGE I;  5DAE A;  1H0Z A;  1TIH A;  1LR7 A;  1YU6 C;  2NU3 I;  2SGD I;  1UZJ A;  1KSQ A;  1CT2 I;  1SGR I;  1APJ A;  1M8C A;  1SGN I;  5JHW C;  1HPT A;  1UZQ A;  1UZK A;  1UVG A;  2GKR I;  1IY6 A;  2GKT I;  1SGP I;  1OMT A;  2W86 A;  2KMP A;  3OVO A;  2SGE I;  2NU0 I;  1TUS A;  2QQC A;  2GKV A;  1M8B A;  2F3C I;  1NUB A;  2KMO A;  1CGJ I;  2JYY A;  3SGQ I;  1UVF A;  2KMQ A;  2N52 A;  1HDL A;  1BUS A;  2V53 A;  2SGF I;  1Y1C A;  1UZP A;  1DS3 I;  1TBR R;  2NU4 I;  1SGY I;  1R0R I;  2BUS A;  3QTL D;  1PPF I;  1CT0 I;  3SGB I;  1TGS I;  1SGQ I;  3SEK C;  1KMA A;  1LR8 A;  1OMU A;  1N13 A;  1CSO I;  2LEO A;  1CT4 I;  4SGB I;  2P6A C;  2KCX A;  1TUR A;  2ARP F;  1TBQ R;  1SGD I;  1HJA I;  1PJU A;  1YTP A;  2NU1 I;  1PCE A;  3HH2 C;  2N71 A;  1CGI I;  1AN1 I;  1LR9 A;  2QQD A;  3B4V C;  4OVO A;  2KMR A;  2SGQ I;  1CE3 A;  4GI3 C;  1IW4 A;  1MT1 A;  1FYB A;  1IY5 A;  1DS2 I;  2WCY A;  2M5X A;  2SGP I;  1UUC A;  1Z7K B;  2JXD A;  1BMO A;  2XRC A; 
#chains in the Genus database with same CATH topology
 3UEJ A;  9WGA A;  2QQE A;  4B6D A;  2OVO A;  1R79 A;  1S20 A;  3UGL A;  3TO6 A;  1FAQ A;  4AML A;  2E73 A;  2OD1 A;  1OYV I;  3TO7 A;  2B0U C;  1Y1B A;  3R5B A;  3TO9 A;  3TJQ A;  4E1P A;  2JZM A;  1CHO I;  1RFH A;  3MEK A;  3QAH A;  1MJB A;  3OXF A;  4HGU A;  5CCM A;  2N17 A;  1OVO A;  2ERW A;  1W4R A;  1SGE I;  1X4S A;  2NU2 I;  5DAE A;  1KBE A;  1U5K A;  1WTJ A;  1H0Z A;  1TIH A;  5FUV A;  4E1R A;  1LR7 A;  1Q9B A;  1YU6 C;  2NU3 I;  2SGD I;  1UZJ A;  3R5C A;  1CT2 I;  1KSQ A;  2CJS C;  5E3P A;  3UEY A;  1HEV A;  1SGR I;  3OXL A;  1APJ A;  1M8C A;  3D00 A;  1P9Z A;  1SGN I;  5JHW C;  1HPT A;  1TOT A;  2UVO A;  2WVJ A;  5FUY A;  1ULK A;  1UZQ A;  1UZK A;  1UVG A;  1XBT A;  2GKR I;  1IY6 A;  2GKT I;  3FSX A;  1SGP I;  5J8F A;  1V1I A;  2J9R A;  2YQP A;  3E2I A;  1OMT A;  3TOA A;  5EX0 A;  2W86 A;  2KMP A;  3OVO A;  2SGE I;  2B8T A;  2DKV A;  3UGI A;  1Y8F A;  2NU0 I;  2RIJ A;  3KY9 A;  1TUS A;  2QQC A;  2GKV A;  1ULN A;  1M8B A;  1ULM A;  2F3C I;  3BJI A;  3PDN A;  3GOX A;  1KBF A;  1NUB A;  2L8E A;  2LUY A;  4UXJ A;  2KMO A;  2JW6 A;  1CGJ I;  2JYY A;  1XX6 A;  3SGQ I;  5J8C A;  3TOB A;  1UVF A;  2KMQ A;  2N52 A;  3FSY A;  4FKD A;  1HDL A;  1BUS A;  2CWH A;  2V53 A;  1X74 A;  7WGA A;  2DIP A;  2SGF I;  1Y1C A;  1UZP A;  2V1C A;  3FC3 A;  1DS3 I;  1TBR R;  1FY7 A;  2A20 A;  1FAR A;  2NU4 I;  2X3T A;  1MJA A;  2RC4 A;  1SGY I;  2GVI A;  3UOE A;  5CCL A;  1R0R I;  2BUS A;  4L9M A;  3QTL D;  3CXL A;  3UGD A;  2WGC A;  1PPF I;  5HI7 A;  1P9G A;  2E5R A;  1CT0 I;  3SGB I;  3E59 A;  4A24 A;  1TGS I;  1K7T A;  1SGQ I;  1TBN A;  2X52 A;  3SEK C;  1KMA A;  1LR8 A;  1OMU A;  3R5A A;  2FNF X;  2ORW A;  2QPO A;  2ENZ A;  1N13 A;  2QQ0 A;  1CSO I;  2LEO A;  2ODD A;  1CT4 I;  1WKX A;  2CWF A;  4DNC A;  3OL0 A;  4SGB I;  2ELI A;  4JCV E;  2P6A C;  5EX3 A;  2KCX A;  2LB7 A;  1TUR A;  2ARP F;  1TBQ R;  2V1C C;  1SGD I;  2J87 A;  1HJA I;  5E3R A;  1PJU A;  2Y0M A;  1YTP A;  2NU1 I;  1K7U A;  1MJ9 A;  3R5D A;  3RU0 A;  2L7X A;  1PCE A;  1V1H A;  1W3S A;  3HH2 C;  1XA6 A;  2DB6 A;  2N71 A;  2W0T A;  1CGI I;  4WP4 A;  1AN1 I;  2N1A B;  2OZU A;  2OU2 A;  2UZ3 A;  3OXG A;  1K7V A;  2GIV A;  1LR9 A;  2QQD A;  3B4V C;  4OVO A;  1WGC A;  2KMR A;  2SGQ I;  2YUU A;  1CE3 A;  2K9H A;  3QWP A;  1VDD A;  2PQ8 A;  4GI3 C;  3VE5 A;  5FUW A;  1IW4 A;  4UXI A;  5FUX A;  2JA1 A;  1MT1 A;  1FYB A;  2CWG A;  1IY5 A;  1UHA A;  1DS2 I;  4UXH A;  2WCY A;  5E3Q A;  3VDU A;  3VDP A;  2ROW A;  2ENN A;  5HQ8 A;  2M5X A;  2SGP I;  1WGT A;  1Z2I A;  1PTQ A;  1TBO A;  1UUC A;  1Z7K B;  1PTR A;  2JXD A;  2ORV A;  1BMO A;  3UFF A;  1NXU A;  2VRW B;  2XRC A;  4MPI A; 
#chains in the Genus database with same CATH homology
 3UEJ A;  2QQE A;  4B6D A;  2OVO A;  1R79 A;  3UGL A;  1FAQ A;  2E73 A;  2OD1 A;  1OYV I;  2B0U C;  1Y1B A;  3TJQ A;  4E1P A;  2JZM A;  1CHO I;  1RFH A;  3MEK A;  3OXF A;  4HGU A;  5CCM A;  2N17 A;  1OVO A;  2ERW A;  1W4R A;  1SGE I;  1X4S A;  2NU2 I;  5DAE A;  1KBE A;  1U5K A;  1H0Z A;  1TIH A;  5FUV A;  4E1R A;  1LR7 A;  1YU6 C;  2NU3 I;  2SGD I;  1UZJ A;  1KSQ A;  1CT2 I;  2CJS C;  3UEY A;  1SGR I;  3OXL A;  1APJ A;  1M8C A;  3D00 A;  1SGN I;  5JHW C;  1HPT A;  1TOT A;  2WVJ A;  5FUY A;  1UZQ A;  1UZK A;  1UVG A;  1XBT A;  2GKR I;  1IY6 A;  2GKT I;  1SGP I;  1V1I A;  2J9R A;  2YQP A;  3E2I A;  1OMT A;  5EX0 A;  2W86 A;  2KMP A;  3OVO A;  2SGE I;  2B8T A;  3UGI A;  1Y8F A;  2NU0 I;  3KY9 A;  1TUS A;  2QQC A;  2GKV A;  1M8B A;  2F3C I;  3BJI A;  3PDN A;  3GOX A;  1KBF A;  1NUB A;  2L8E A;  2LUY A;  4UXJ A;  2KMO A;  2JW6 A;  1CGJ I;  2JYY A;  1XX6 A;  3SGQ I;  1UVF A;  2KMQ A;  2N52 A;  4FKD A;  1HDL A;  1BUS A;  2V53 A;  1X74 A;  2DIP A;  2SGF I;  1Y1C A;  1UZP A;  2V1C A;  3FC3 A;  1DS3 I;  1TBR R;  2A20 A;  2NU4 I;  1FAR A;  1SGY I;  2GVI A;  5CCL A;  1R0R I;  2BUS A;  4L9M A;  3QTL D;  3CXL A;  3UGD A;  1PPF I;  5HI7 A;  2E5R A;  1CT0 I;  3SGB I;  3E59 A;  4A24 A;  1TGS I;  1SGQ I;  1TBN A;  3SEK C;  1KMA A;  1LR8 A;  1OMU A;  2FNF X;  2ORW A;  2QPO A;  2ENZ A;  1N13 A;  2QQ0 A;  1CSO I;  2LEO A;  2ODD A;  1CT4 I;  3OL0 A;  4SGB I;  2ELI A;  4JCV E;  2P6A C;  5EX3 A;  2KCX A;  2V1C C;  1TUR A;  2ARP F;  1TBQ R;  1SGD I;  2J87 A;  1HJA I;  1PJU A;  1YTP A;  2NU1 I;  3RU0 A;  2L7X A;  1PCE A;  1V1H A;  1W3S A;  3HH2 C;  1XA6 A;  2DB6 A;  2N71 A;  2W0T A;  1CGI I;  1AN1 I;  2N1A B;  2UZ3 A;  3OXG A;  1LR9 A;  2QQD A;  3B4V C;  4OVO A;  2KMR A;  2SGQ I;  2YUU A;  1CE3 A;  2K9H A;  3QWP A;  1VDD A;  4GI3 C;  3VE5 A;  5FUW A;  1IW4 A;  4UXI A;  5FUX A;  2JA1 A;  1MT1 A;  1FYB A;  1IY5 A;  1DS2 I;  4UXH A;  2WCY A;  3VDP A;  3VDU A;  2ROW A;  2ENN A;  5HQ8 A;  2M5X A;  2SGP I;  1PTQ A;  1TBO A;  1UUC A;  1Z7K B;  1PTR A;  2JXD A;  2ORV A;  1BMO A;  3UFF A;  2VRW B;  2XRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...