1Y1CA

Solution structure of anemonia elastase inhibitor analogue
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
48
structure length
48
Chain Sequence
KPDAPCICTMQYDPVCGSDGITYGNACMLLCASARSDTPIELVHKGRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Study of an Anemonia Elastase Inhibitor, a "Nonclassical" Kazal-Type Inhibitor from Anemonia sulcata
pubmed doi rcsb
molecule tags Hydrolase inhibitor
molecule keywords Elastase inhibitor
total genus 6
structure length 48
sequence length 48
ec nomenclature
pdb deposition date 2004-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1y1cA00
2SGPI 1MT1A 1CHOI 1HDLA 1OVOA 2M5XA 3SGBI 2JYYA 2V53A 1Y1CA 4SGBI 5JHWC 1SGQI 1IY6A 1TURA 3SEKC 1UVFA 1TGSI 1TIHA 2ARPF 1SGNI 2KMQA 2SGQI 1OMTA 1PJUA 3OVOA 1SGDI 1PCEA 1CT0I 1M8CA 2QQCA 1HPTA 1DS2I 1BUSA 1CGII 1PPFI 4OVOA 1YTPA 2SGDI 1KMAA 2N52A 1TBQR 2OVOA 1UUCA 1SGRI 1CE3A 2LEOA 2XRCA 2B0UC 1LR9A 1OYVI 1R0RI 1AN1I 1M8BA 2P6AC 2N17A 1H0ZA 1TBRR 2SGFI 1UVGA 2SGEI 1FYBA 1CGJI 2JXDA 1SGYI 1CSOI 2BUSA 1Z7KB 2KMPA 1OMUA 1CT2I 3HH2C 3B4VC 2NU4I 2NU3I 1YU6C 2NU0I 2WCYA 2ERWA 2F3CI 1LR7A 2GKRI 2NU2I 4GI3C 1CT4I 1SGEI 2KMOA 1IW4A 1HJAI 1DS3I 1N13A 1BMOA 2QQDA 1NUBA 3QTLD 2KCXA 1SGPI 1Y1BA 2GKTI 2KMRA 2N71A 2JZMA 3TJQA 2GKVA 2NU1I 1TUSA 3SGQI 1LR8A 5DAEA 1IY5A 4HGUA
chains in the Genus database with same CATH superfamily
1X4SA 2ODDA 2SGPI 1MT1A 2JA1A 1TOTA 5E3QA 1CHOI 2GIVA 1HDLA 1RFHA 1ULMA 1OVOA 2PQ8A 5CCMA 2M5XA 3SGBI 2JYYA 1FY7A 1X74A 2L7XA 1Y1CA 2V53A 3R5AA 4SGBI 4A24A 1SGQI 5HQ8A 1TURA 5JHWC 1IY6A 1Q9BA 1TBOA 2CJSC 2CWHA 2V1CA 3OXFA 2QPOA 2LUYA 3SEKC 2YUUA 3FSXA 1K7UA 3MEKA 1UVFA 1TGSI 2FNFX 3KY9A 1TIHA 1S20A 3FC3A 3OXGA 3OL0A 4E1RA 2K9HA 2ARPF 3UGIA 1XA6A 1SGNI 2KMQA 2SGQI 1OMTA 3UGLA 1PJUA 3OVOA 4UXHA 1SGDI 1PCEA 4MPIA 1CT0I 1WGCA 4JCVE 2OD1A 1M8CA 1MJ9A 2RC4A 3R5DA 1PTQA 1Y8FA 2A20A 2QQCA 1HPTA 1DS2I 1BUSA 1CE3A 1CGII 3TO7A 2X3TA 2Y0MA 1PPFI 4OVOA 1YTPA 4UXJA 2SGDI 4WP4A 5EX3A 4B6DA 2B8TA 1XBTA 4DNCA 3QWPA 1U5KA 5FUYA 5E3PA 2WGCA 3E2IA 3TO9A 2J87A 5FUXA 1KMAA 2N52A 1TBQR 2OVOA 2DB6A 1W3SA 1UUCA 2OZUA 1SGRI 2J9RA 4AMLA 1V1HA 2L8EA 2E5RA 2LEOA 5FUWA 1V1IA 2XRCA 3VE5A 2B0UC 1LR9A 2JW6A 1OYVI 1ULKA 1R0RI 1AN1I 5HI7A 1M8BA 3UGDA 2P6AC 5EX0A 4UXIA 2N17A 1H0ZA 1VDDA 2GVIA 1TBRR 2SGFI 1UVGA 2SGEI 1FYBA 3D00A 4FKDA 1CGJI 2JXDA 1SGYI 1XX6A 1CSOI 1WTJA 1Z2IA 1Z7KB 2BUSA 3UEJA 2KMPA 1OMUA 1P9GA 1CT2I 2UZ3A 3RU0A 3HH2C 5J8CA 1HEVA 1WGTA 2ORWA 2CWFA 2W0TA 5FUVA 5J8FA 3B4VC 3UEYA 2NU4I 3TO6A 2NU3I 7WGAA 1NXUA 1YU6C 2NU0I 2LB7A 1FAQA 2ORVA 2WCYA 2ERWA 2F3CI 3PDNA 1LR7A 2GKRI 2NU2I 4GI3C 3R5CA 4L9MA 3UOEA 1CT4I 3QAHA 1SGEI 2KMOA 3VDUA 2UVOA 3E59A 2ENNA 2QQ0A 2RIJA 3CXLA 1IW4A 5CCLA 1WKXA 1HJAI 1KBFA 2ROWA 3OXLA 1DS3I 1N13A 1K7TA 1UHAA 1W4RA 3GOXA 3UFFA 2V1CC 5E3RA 1BMOA 2QQDA 1ULNA 3VDPA 1FARA 1NUBA 2KCXA 2X52A 3QTLD 2VRWB 2CWGA 1SGPI 2WVJA 4E1PA 1Y1BA 1P9ZA 2GKTI 2KMRA 2DKVA 2N71A 3TOAA 2JZMA 3TJQA 1KBEA 1TBNA 1MJBA 2GKVA 2OU2A 2NU1I 2ELIA 1TUSA 2YQPA 2DIPA 3BJIA 3SGQI 9WGAA 3R5BA 3TOBA 1R79A 2E73A 3FSYA 1MJAA 2ENZA 1K7VA 2QQEA 1LR8A 1PTRA 2N1AB 5DAEA 1IY5A 4HGUA
chains in the Genus database with same CATH topology
1X4SA 2ODDA 2SGPI 1MT1A 2JA1A 1TOTA 1CHOI 1HDLA 1RFHA 1OVOA 5CCMA 2M5XA 3SGBI 2JYYA 1X74A 2L7XA 2V53A 1Y1CA 4SGBI 5HQ8A 5JHWC 4A24A 1SGQI 1IY6A 1TURA 2CJSC 1TBOA 2V1CA 3OXFA 2QPOA 2LUYA 3SEKC 2YUUA 3MEKA 1UVFA 1TGSI 2FNFX 3KY9A 1TIHA 3FC3A 3OXGA 3OL0A 4E1RA 2K9HA 2ARPF 3UGIA 1XA6A 1SGNI 2KMQA 2SGQI 1OMTA 3UGLA 1PJUA 3OVOA 4UXHA 1SGDI 1PCEA 1CT0I 4JCVE 2OD1A 1M8CA 1PTQA 1Y8FA 2A20A 2QQCA 1HPTA 1DS2I 1BUSA 1CGII 1PPFI 4OVOA 1YTPA 4UXJA 2SGDI 5EX3A 4B6DA 2B8TA 1XBTA 3QWPA 1U5KA 5FUYA 3E2IA 2J87A 5FUXA 1KMAA 2N52A 1TBQR 2OVOA 2DB6A 1W3SA 1UUCA 1SGRI 2J9RA 1CE3A 1V1HA 2L8EA 2E5RA 2LEOA 5FUWA 1V1IA 2XRCA 3VE5A 2B0UC 1LR9A 2JW6A 1OYVI 1R0RI 5HI7A 1AN1I 1M8BA 3UGDA 2P6AC 4UXIA 2N17A 1H0ZA 1VDDA 2GVIA 1TBRR 2SGFI 1UVGA 2SGEI 1FYBA 3D00A 4FKDA 1CGJI 2JXDA 1SGYI 1XX6A 1CSOI 2BUSA 1Z7KB 3UEJA 2KMPA 1OMUA 2UZ3A 1CT2I 3RU0A 3HH2C 2ORWA 2W0TA 5FUVA 3B4VC 3UEYA 2NU4I 2NU3I 1YU6C 2NU0I 1FAQA 2ORVA 2WCYA 2ERWA 2F3CI 3PDNA 1LR7A 2GKRI 2NU2I 4GI3C 4L9MA 1CT4I 1SGEI 2KMOA 3VDUA 3E59A 2ENNA 2QQ0A 3CXLA 1IW4A 5CCLA 1KBFA 1HJAI 2ROWA 3OXLA 1DS3I 1N13A 1W4RA 3GOXA 3UFFA 2V1CC 1BMOA 2QQDA 3VDPA 1FARA 1NUBA 2KCXA 3QTLD 2VRWB 1SGPI 2WVJA 4E1PA 1Y1BA 2GKTI 2KMRA 2N71A 2JZMA 3TJQA 1KBEA 1TBNA 3BJIA 2GKVA 5EX0A 2NU1I 2ELIA 1TUSA 2YQPA 2DIPA 3SGQI 1R79A 2E73A 2ENZA 2QQEA 1LR8A 1PTRA 2N1AB 5DAEA 1IY5A 4HGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SGP I;  1MT1 A;  1CHO I;  1HDL A;  1OVO A;  2M5X A;  3SGB I;  2JYY A;  2V53 A;  1Y1C A;  4SGB I;  5JHW C;  1SGQ I;  1IY6 A;  1TUR A;  3SEK C;  1UVF A;  1TGS I;  1TIH A;  2ARP F;  1SGN I;  2KMQ A;  2SGQ I;  1OMT A;  1PJU A;  3OVO A;  1SGD I;  1PCE A;  1CT0 I;  1M8C A;  2QQC A;  1HPT A;  1DS2 I;  1BUS A;  1CGI I;  1PPF I;  4OVO A;  1YTP A;  2SGD I;  1KMA A;  2N52 A;  1TBQ R;  2OVO A;  1UUC A;  1SGR I;  1CE3 A;  2LEO A;  2XRC A;  2B0U C;  1LR9 A;  1OYV I;  1R0R I;  1AN1 I;  1M8B A;  2P6A C;  2N17 A;  1H0Z A;  1TBR R;  2SGF I;  1UVG A;  2SGE I;  1FYB A;  1CGJ I;  2JXD A;  1SGY I;  1CSO I;  2BUS A;  1Z7K B;  2KMP A;  1OMU A;  1CT2 I;  3HH2 C;  3B4V C;  2NU4 I;  2NU3 I;  1YU6 C;  2NU0 I;  2WCY A;  2ERW A;  2F3C I;  1LR7 A;  2GKR I;  2NU2 I;  4GI3 C;  1CT4 I;  1SGE I;  2KMO A;  1IW4 A;  1HJA I;  1DS3 I;  1N13 A;  1BMO A;  2QQD A;  1NUB A;  3QTL D;  2KCX A;  1SGP I;  1Y1B A;  2GKT I;  2KMR A;  2N71 A;  2JZM A;  3TJQ A;  2GKV A;  2NU1 I;  1TUS A;  3SGQ I;  1LR8 A;  5DAE A;  1IY5 A;  4HGU A; 
#chains in the Genus database with same CATH topology
 1X4S A;  2ODD A;  2SGP I;  1MT1 A;  2JA1 A;  1TOT A;  5E3Q A;  1CHO I;  2GIV A;  1HDL A;  1RFH A;  1ULM A;  1OVO A;  2PQ8 A;  5CCM A;  2M5X A;  3SGB I;  2JYY A;  1FY7 A;  1X74 A;  2L7X A;  1Y1C A;  2V53 A;  3R5A A;  4SGB I;  4A24 A;  1SGQ I;  5HQ8 A;  1TUR A;  5JHW C;  1IY6 A;  1Q9B A;  1TBO A;  2CJS C;  2CWH A;  2V1C A;  3OXF A;  2QPO A;  2LUY A;  3SEK C;  2YUU A;  3FSX A;  1K7U A;  3MEK A;  1UVF A;  1TGS I;  2FNF X;  3KY9 A;  1TIH A;  1S20 A;  3FC3 A;  3OXG A;  3OL0 A;  4E1R A;  2K9H A;  2ARP F;  3UGI A;  1XA6 A;  1SGN I;  2KMQ A;  2SGQ I;  1OMT A;  3UGL A;  1PJU A;  3OVO A;  4UXH A;  1SGD I;  1PCE A;  4MPI A;  1CT0 I;  1WGC A;  4JCV E;  2OD1 A;  1M8C A;  1MJ9 A;  2RC4 A;  3R5D A;  1PTQ A;  1Y8F A;  2A20 A;  2QQC A;  1HPT A;  1DS2 I;  1BUS A;  1CE3 A;  1CGI I;  3TO7 A;  2X3T A;  2Y0M A;  1PPF I;  4OVO A;  1YTP A;  4UXJ A;  2SGD I;  4WP4 A;  5EX3 A;  4B6D A;  2B8T A;  1XBT A;  4DNC A;  3QWP A;  1U5K A;  5FUY A;  5E3P A;  2WGC A;  3E2I A;  3TO9 A;  2J87 A;  5FUX A;  1KMA A;  2N52 A;  1TBQ R;  2OVO A;  2DB6 A;  1W3S A;  1UUC A;  2OZU A;  1SGR I;  2J9R A;  4AML A;  1V1H A;  2L8E A;  2E5R A;  2LEO A;  5FUW A;  1V1I A;  2XRC A;  3VE5 A;  2B0U C;  1LR9 A;  2JW6 A;  1OYV I;  1ULK A;  1R0R I;  1AN1 I;  5HI7 A;  1M8B A;  3UGD A;  2P6A C;  5EX0 A;  4UXI A;  2N17 A;  1H0Z A;  1VDD A;  2GVI A;  1TBR R;  2SGF I;  1UVG A;  2SGE I;  1FYB A;  3D00 A;  4FKD A;  1CGJ I;  2JXD A;  1SGY I;  1XX6 A;  1CSO I;  1WTJ A;  1Z2I A;  1Z7K B;  2BUS A;  3UEJ A;  2KMP A;  1OMU A;  1P9G A;  1CT2 I;  2UZ3 A;  3RU0 A;  3HH2 C;  5J8C A;  1HEV A;  1WGT A;  2ORW A;  2CWF A;  2W0T A;  5FUV A;  5J8F A;  3B4V C;  3UEY A;  2NU4 I;  3TO6 A;  2NU3 I;  7WGA A;  1NXU A;  1YU6 C;  2NU0 I;  2LB7 A;  1FAQ A;  2ORV A;  2WCY A;  2ERW A;  2F3C I;  3PDN A;  1LR7 A;  2GKR I;  2NU2 I;  4GI3 C;  3R5C A;  4L9M A;  3UOE A;  1CT4 I;  3QAH A;  1SGE I;  2KMO A;  3VDU A;  2UVO A;  3E59 A;  2ENN A;  2QQ0 A;  2RIJ A;  3CXL A;  1IW4 A;  5CCL A;  1WKX A;  1HJA I;  1KBF A;  2ROW A;  3OXL A;  1DS3 I;  1N13 A;  1K7T A;  1UHA A;  1W4R A;  3GOX A;  3UFF A;  2V1C C;  5E3R A;  1BMO A;  2QQD A;  1ULN A;  3VDP A;  1FAR A;  1NUB A;  2KCX A;  2X52 A;  3QTL D;  2VRW B;  2CWG A;  1SGP I;  2WVJ A;  4E1P A;  1Y1B A;  1P9Z A;  2GKT I;  2KMR A;  2DKV A;  2N71 A;  3TOA A;  2JZM A;  3TJQ A;  1KBE A;  1TBN A;  1MJB A;  2GKV A;  2OU2 A;  2NU1 I;  2ELI A;  1TUS A;  2YQP A;  2DIP A;  3BJI A;  3SGQ I;  9WGA A;  3R5B A;  3TOB A;  1R79 A;  2E73 A;  3FSY A;  1MJA A;  2ENZ A;  1K7V A;  2QQE A;  1LR8 A;  1PTR A;  2N1A B;  5DAE A;  1IY5 A;  4HGU A; 
#chains in the Genus database with same CATH homology
 1X4S A;  2ODD A;  2SGP I;  1MT1 A;  2JA1 A;  1TOT A;  1CHO I;  1HDL A;  1RFH A;  1OVO A;  5CCM A;  2M5X A;  3SGB I;  2JYY A;  1X74 A;  2L7X A;  2V53 A;  1Y1C A;  4SGB I;  5HQ8 A;  5JHW C;  4A24 A;  1SGQ I;  1IY6 A;  1TUR A;  2CJS C;  1TBO A;  2V1C A;  3OXF A;  2QPO A;  2LUY A;  3SEK C;  2YUU A;  3MEK A;  1UVF A;  1TGS I;  2FNF X;  3KY9 A;  1TIH A;  3FC3 A;  3OXG A;  3OL0 A;  4E1R A;  2K9H A;  2ARP F;  3UGI A;  1XA6 A;  1SGN I;  2KMQ A;  2SGQ I;  1OMT A;  3UGL A;  1PJU A;  3OVO A;  4UXH A;  1SGD I;  1PCE A;  1CT0 I;  4JCV E;  2OD1 A;  1M8C A;  1PTQ A;  1Y8F A;  2A20 A;  2QQC A;  1HPT A;  1DS2 I;  1BUS A;  1CGI I;  1PPF I;  4OVO A;  1YTP A;  4UXJ A;  2SGD I;  5EX3 A;  4B6D A;  2B8T A;  1XBT A;  3QWP A;  1U5K A;  5FUY A;  3E2I A;  2J87 A;  5FUX A;  1KMA A;  2N52 A;  1TBQ R;  2OVO A;  2DB6 A;  1W3S A;  1UUC A;  1SGR I;  2J9R A;  1CE3 A;  1V1H A;  2L8E A;  2E5R A;  2LEO A;  5FUW A;  1V1I A;  2XRC A;  3VE5 A;  2B0U C;  1LR9 A;  2JW6 A;  1OYV I;  1R0R I;  5HI7 A;  1AN1 I;  1M8B A;  3UGD A;  2P6A C;  4UXI A;  2N17 A;  1H0Z A;  1VDD A;  2GVI A;  1TBR R;  2SGF I;  1UVG A;  2SGE I;  1FYB A;  3D00 A;  4FKD A;  1CGJ I;  2JXD A;  1SGY I;  1XX6 A;  1CSO I;  2BUS A;  1Z7K B;  3UEJ A;  2KMP A;  1OMU A;  2UZ3 A;  1CT2 I;  3RU0 A;  3HH2 C;  2ORW A;  2W0T A;  5FUV A;  3B4V C;  3UEY A;  2NU4 I;  2NU3 I;  1YU6 C;  2NU0 I;  1FAQ A;  2ORV A;  2WCY A;  2ERW A;  2F3C I;  3PDN A;  1LR7 A;  2GKR I;  2NU2 I;  4GI3 C;  4L9M A;  1CT4 I;  1SGE I;  2KMO A;  3VDU A;  3E59 A;  2ENN A;  2QQ0 A;  3CXL A;  1IW4 A;  5CCL A;  1KBF A;  1HJA I;  2ROW A;  3OXL A;  1DS3 I;  1N13 A;  1W4R A;  3GOX A;  3UFF A;  2V1C C;  1BMO A;  2QQD A;  3VDP A;  1FAR A;  1NUB A;  2KCX A;  3QTL D;  2VRW B;  1SGP I;  2WVJ A;  4E1P A;  1Y1B A;  2GKT I;  2KMR A;  2N71 A;  2JZM A;  3TJQ A;  1KBE A;  1TBN A;  3BJI A;  2GKV A;  5EX0 A;  2NU1 I;  2ELI A;  1TUS A;  2YQP A;  2DIP A;  3SGQ I;  1R79 A;  2E73 A;  2ENZ A;  2QQE A;  1LR8 A;  1PTR A;  2N1A B;  5DAE A;  1IY5 A;  4HGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...