1Y1CA

Solution structure of anemonia elastase inhibitor analogue
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
48
structure length
48
Chain Sequence
b'KPDAPCICTMQYDPVCGSDGITYGNACMLLCASARSDTPIELVHKGRC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elastase inhibitor
publication title Structural and Functional Study of an Anemonia Elastase Inhibitor, a "Nonclassical" Kazal-Type Inhibitor from Anemonia sulcata
pubmed doi rcsb
molecule tags Hydrolase inhibitor
total genus 6
structure length 48
sequence length 48
ec nomenclature
pdb deposition date 2004-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1y1cA00
3SGQI 1PJUA 2F3CI 1LR8A 2NU4I 2SGFI 1AN1I 5DAEA 2JXDA 1BUSA 2SGPI 4SGBI 1SGQI 2GKTI 1UVFA 1Y1BA 1OVOA 3OVOA 2BUSA 2N52A 1CT4I 4OVOA 2ARPF 1R0RI 2SGEI 1FYBA 2JYYA 2WCYA 1TBQR 2LEOA 1HPTA 2ERWA 2N17A 1BMOA 2SGDI 2V53A 1UVGA 2QQDA 1CGII 1CHOI 1MT1A 1M8CA 1DS3I 2KMPA 2N71A 2NU0I 3TJQA 2M5XA 1IY5A 1IY6A 1OYVI 1CT2I 2KMQA 4GI3C 2NU1I 1SGRI 1TBRR 1OMUA 1TGSI 1PPFI 1CGJI 1PCEA 1HDLA 1YU6C 2GKRI 1TUSA 1M8BA 1KMAA 1OMTA 1UUCA 1DS2I 2SGQI 1CT0I 2QQCA 1Y1CA 1CSOI 1TURA 1HJAI 2JZMA 1SGPI 3HH2C 1NUBA 3B4VC 2XRCA 2GKVA 1Z7KB 2P6AC 1IW4A 2KMRA 1LR9A 2KMOA 1SGYI 2OVOA 1YTPA 1H0ZA 2NU2I 5JHWC 1CE3A 3QTLD 1SGNI 2KCXA 4HGUA 2NU3I 1N13A 3SEKC 1TIHA 2B0UC 3SGBI 1LR7A 1SGEI 1SGDI
chains in the Genus database with same CATH superfamily
2UZ3A 5FUYA 3SGQI 3OXFA 1K7TA 1PJUA 2YQPA 2F3CI 1RFHA 1LR8A 2NU4I 2SGFI 3UGLA 1XX6A 1AN1I 5DAEA 3TOAA 1ULKA 2GVIA 1S20A 2JXDA 3MEKA 2GIVA 1BUSA 2SGPI 4UXIA 4SGBI 2YUUA 1Q9BA 1MJAA 1SGQI 2L7XA 2GKTI 2V1CA 4JCVE 4AMLA 1UVFA 2A20A 5HQ8A 1FAQA 1UHAA 1Y1BA 1P9ZA 1OVOA 2L8EA 4E1RA 2LB7A 4L9MA 4E1PA 2QPOA 1V1HA 3OVOA 2BUSA 3KY9A 5E3QA 3VE5A 2ENNA 2N52A 3D00A 3TO6A 2ODDA 1CT4I 4OVOA 2JA1A 2CJSC 2ARPF 1R0RI 1X4SA 2SGEI 3E59A 3OL0A 1FYBA 2ELIA 2JYYA 1WKXA 1U5KA 1W4RA 2ORVA 2LUYA 2WCYA 1TBQR 1KBEA 4UXHA 2LEOA 1HPTA 2ERWA 2N17A 1BMOA 2SGDI 1X74A 2V53A 2WGCA 1UVGA 2OZUA 1K7UA 2QQDA 3OXGA 2OD1A 2X52A 3R5DA 3TOBA 3QAHA 3UGIA 1WGTA 1CGII 1CHOI 4UXJA 1TBOA 5EX0A 1MT1A 4MPIA 2K9HA 2DKVA 3UEJA 1M8CA 1FARA 3UOEA 2ENZA 2WVJA 1DS3I 2KMPA 3BJIA 1VDDA 5E3PA 9WGAA 4WP4A 1Y8FA 2N71A 1ULNA 2NU0I 2Y0MA 2E5RA 3TJQA 1Z2IA 2M5XA 1IY5A 3R5AA 2RC4A 1ULMA 2PQ8A 1IY6A 1OYVI 3FSXA 5FUVA 2FNFX 1K7VA 1CT2I 1WTJA 3VDUA 2KMQA 2VRWB 1PTQA 5J8FA 2W0TA 4GI3C 3GOXA 1V1IA 2NU1I 1SGRI 1TBRR 1TBNA 2UVOA 2V1CC 1OMUA 1TGSI 1PPFI 1CGJI 1FY7A 1PCEA 3TO7A 2ORWA 3FC3A 1NXUA 1YU6C 2J9RA 4B6DA 2GKRI 1HDLA 1TUSA 1M8BA 3R5CA 3UGDA 2CWFA 2E73A 4FKDA 1KMAA 1W3SA 1OMTA 1UUCA 1DS2I 1P9GA 2JW6A 2QQ0A 2SGQI 1CT0I 5J8CA 2QQCA 2J87A 1MJBA 7WGAA 1Y1CA 1CSOI 1TURA 5HI7A 1HJAI 2JZMA 5FUXA 1HEVA 3TO9A 2OU2A 3OXLA 1PTRA 1SGPI 3HH2C 2DIPA 1NUBA 3B4VC 2XRCA 3RU0A 5CCLA 2GKVA 5EX3A 1Z7KB 2P6AC 1IW4A 2RIJA 3CXLA 1TOTA 4A24A 2KMRA 1LR9A 1KBFA 2B8TA 2KMOA 2DB6A 3VDPA 2CWHA 3R5BA 2X3TA 1SGYI 2OVOA 3PDNA 2N1AB 3UEYA 1YTPA 1H0ZA 2NU2I 2ROWA 1XBTA 5JHWC 1CE3A 3FSYA 3QTLD 2CWGA 3E2IA 3UFFA 1SGNI 2KCXA 4HGUA 5FUWA 2NU3I 1N13A 1XA6A 1WGCA 3SEKC 4DNCA 1TIHA 2B0UC 3SGBI 3QWPA 5CCMA 1LR7A 1R79A 1MJ9A 1SGEI 5E3RA 2QQEA 1SGDI
chains in the Genus database with same CATH topology
2UZ3A 5FUYA 3SGQI 3OXFA 1PJUA 2YQPA 2F3CI 1RFHA 1LR8A 2NU4I 2SGFI 3UGLA 1XX6A 1AN1I 5DAEA 2GVIA 2JXDA 3MEKA 1BUSA 2SGPI 4UXIA 4SGBI 2YUUA 1SGQI 4JCVE 2L7XA 2GKTI 2V1CA 1UVFA 2A20A 1FAQA 1Y1BA 2L8EA 1OVOA 4E1RA 4L9MA 4E1PA 2QPOA 1V1HA 3OVOA 2BUSA 3KY9A 3VE5A 2ENNA 2N52A 3D00A 2ODDA 1CT4I 4OVOA 2JA1A 2CJSC 2ARPF 1R0RI 1X4SA 2SGEI 3E59A 3OL0A 1FYBA 2ELIA 2JYYA 2WCYA 1U5KA 1W4RA 2ORVA 2LUYA 1TBQR 1KBEA 4UXHA 2LEOA 1HPTA 2ERWA 2N17A 1BMOA 2SGDI 1X74A 2V53A 5HQ8A 1UVGA 2QQDA 3OXGA 2OD1A 3UGIA 1CGII 1CHOI 4UXJA 1TBOA 5EX0A 1MT1A 2K9HA 3UEJA 1M8CA 1FARA 2ENZA 2WVJA 1DS3I 2KMPA 3BJIA 1VDDA 1Y8FA 2N71A 2NU0I 2E5RA 3TJQA 2M5XA 1IY5A 1IY6A 1OYVI 5FUVA 2FNFX 1CT2I 3VDUA 2KMQA 2VRWB 1PTQA 2W0TA 4GI3C 3GOXA 1V1IA 2NU1I 1SGRI 1TBRR 1TBNA 2V1CC 1OMUA 1TGSI 1PPFI 1CGJI 1PCEA 1HDLA 2ORWA 3FC3A 1YU6C 4B6DA 2J9RA 2GKRI 1TUSA 1M8BA 3UGDA 2E73A 4FKDA 1KMAA 1W3SA 1OMTA 1UUCA 1DS2I 2JW6A 2QQ0A 2SGQI 1CT0I 2QQCA 2J87A 1Y1CA 1CSOI 1TURA 5HI7A 1HJAI 2JZMA 5FUXA 3OXLA 1PTRA 1SGPI 3HH2C 2DIPA 1NUBA 3B4VC 2XRCA 3RU0A 5CCLA 2GKVA 5EX3A 1Z7KB 2P6AC 1IW4A 3CXLA 1TOTA 4A24A 2KMRA 1LR9A 1KBFA 2B8TA 2KMOA 2DB6A 3VDPA 1SGYI 2OVOA 3PDNA 2N1AB 3UEYA 1YTPA 1H0ZA 2NU2I 2ROWA 1XBTA 5JHWC 1CE3A 3QTLD 3E2IA 3UFFA 1SGNI 2KCXA 4HGUA 5FUWA 2NU3I 1N13A 1XA6A 3SEKC 5CCMA 1TIHA 2B0UC 3SGBI 3QWPA 1LR7A 1R79A 1SGEI 2QQEA 1SGDI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SGQ I;  1PJU A;  2F3C I;  1LR8 A;  2NU4 I;  2SGF I;  1AN1 I;  5DAE A;  2JXD A;  1BUS A;  2SGP I;  4SGB I;  1SGQ I;  2GKT I;  1UVF A;  1Y1B A;  1OVO A;  3OVO A;  2BUS A;  2N52 A;  1CT4 I;  4OVO A;  2ARP F;  1R0R I;  2SGE I;  1FYB A;  2JYY A;  2WCY A;  1TBQ R;  2LEO A;  1HPT A;  2ERW A;  2N17 A;  1BMO A;  2SGD I;  2V53 A;  1UVG A;  2QQD A;  1CGI I;  1CHO I;  1MT1 A;  1M8C A;  1DS3 I;  2KMP A;  2N71 A;  2NU0 I;  3TJQ A;  2M5X A;  1IY5 A;  1IY6 A;  1OYV I;  1CT2 I;  2KMQ A;  4GI3 C;  2NU1 I;  1SGR I;  1TBR R;  1OMU A;  1TGS I;  1PPF I;  1CGJ I;  1PCE A;  1HDL A;  1YU6 C;  2GKR I;  1TUS A;  1M8B A;  1KMA A;  1OMT A;  1UUC A;  1DS2 I;  2SGQ I;  1CT0 I;  2QQC A;  1Y1C A;  1CSO I;  1TUR A;  1HJA I;  2JZM A;  1SGP I;  3HH2 C;  1NUB A;  3B4V C;  2XRC A;  2GKV A;  1Z7K B;  2P6A C;  1IW4 A;  2KMR A;  1LR9 A;  2KMO A;  1SGY I;  2OVO A;  1YTP A;  1H0Z A;  2NU2 I;  5JHW C;  1CE3 A;  3QTL D;  1SGN I;  2KCX A;  4HGU A;  2NU3 I;  1N13 A;  3SEK C;  1TIH A;  2B0U C;  3SGB I;  1LR7 A;  1SGE I;  1SGD I; 
#chains in the Genus database with same CATH topology
 2UZ3 A;  5FUY A;  3SGQ I;  3OXF A;  1K7T A;  1PJU A;  2YQP A;  2F3C I;  1RFH A;  1LR8 A;  2NU4 I;  2SGF I;  3UGL A;  1XX6 A;  1AN1 I;  5DAE A;  3TOA A;  1ULK A;  2GVI A;  1S20 A;  2JXD A;  3MEK A;  2GIV A;  1BUS A;  2SGP I;  4UXI A;  4SGB I;  2YUU A;  1Q9B A;  1MJA A;  1SGQ I;  2L7X A;  2GKT I;  2V1C A;  4JCV E;  4AML A;  1UVF A;  2A20 A;  5HQ8 A;  1FAQ A;  1UHA A;  1Y1B A;  1P9Z A;  1OVO A;  2L8E A;  4E1R A;  2LB7 A;  4L9M A;  4E1P A;  2QPO A;  1V1H A;  3OVO A;  2BUS A;  3KY9 A;  5E3Q A;  3VE5 A;  2ENN A;  2N52 A;  3D00 A;  3TO6 A;  2ODD A;  1CT4 I;  4OVO A;  2JA1 A;  2CJS C;  2ARP F;  1R0R I;  1X4S A;  2SGE I;  3E59 A;  3OL0 A;  1FYB A;  2ELI A;  2JYY A;  1WKX A;  1U5K A;  1W4R A;  2ORV A;  2LUY A;  2WCY A;  1TBQ R;  1KBE A;  4UXH A;  2LEO A;  1HPT A;  2ERW A;  2N17 A;  1BMO A;  2SGD I;  1X74 A;  2V53 A;  2WGC A;  1UVG A;  2OZU A;  1K7U A;  2QQD A;  3OXG A;  2OD1 A;  2X52 A;  3R5D A;  3TOB A;  3QAH A;  3UGI A;  1WGT A;  1CGI I;  1CHO I;  4UXJ A;  1TBO A;  5EX0 A;  1MT1 A;  4MPI A;  2K9H A;  2DKV A;  3UEJ A;  1M8C A;  1FAR A;  3UOE A;  2ENZ A;  2WVJ A;  1DS3 I;  2KMP A;  3BJI A;  1VDD A;  5E3P A;  9WGA A;  4WP4 A;  1Y8F A;  2N71 A;  1ULN A;  2NU0 I;  2Y0M A;  2E5R A;  3TJQ A;  1Z2I A;  2M5X A;  1IY5 A;  3R5A A;  2RC4 A;  1ULM A;  2PQ8 A;  1IY6 A;  1OYV I;  3FSX A;  5FUV A;  2FNF X;  1K7V A;  1CT2 I;  1WTJ A;  3VDU A;  2KMQ A;  2VRW B;  1PTQ A;  5J8F A;  2W0T A;  4GI3 C;  3GOX A;  1V1I A;  2NU1 I;  1SGR I;  1TBR R;  1TBN A;  2UVO A;  2V1C C;  1OMU A;  1TGS I;  1PPF I;  1CGJ I;  1FY7 A;  1PCE A;  3TO7 A;  2ORW A;  3FC3 A;  1NXU A;  1YU6 C;  2J9R A;  4B6D A;  2GKR I;  1HDL A;  1TUS A;  1M8B A;  3R5C A;  3UGD A;  2CWF A;  2E73 A;  4FKD A;  1KMA A;  1W3S A;  1OMT A;  1UUC A;  1DS2 I;  1P9G A;  2JW6 A;  2QQ0 A;  2SGQ I;  1CT0 I;  5J8C A;  2QQC A;  2J87 A;  1MJB A;  7WGA A;  1Y1C A;  1CSO I;  1TUR A;  5HI7 A;  1HJA I;  2JZM A;  5FUX A;  1HEV A;  3TO9 A;  2OU2 A;  3OXL A;  1PTR A;  1SGP I;  3HH2 C;  2DIP A;  1NUB A;  3B4V C;  2XRC A;  3RU0 A;  5CCL A;  2GKV A;  5EX3 A;  1Z7K B;  2P6A C;  1IW4 A;  2RIJ A;  3CXL A;  1TOT A;  4A24 A;  2KMR A;  1LR9 A;  1KBF A;  2B8T A;  2KMO A;  2DB6 A;  3VDP A;  2CWH A;  3R5B A;  2X3T A;  1SGY I;  2OVO A;  3PDN A;  2N1A B;  3UEY A;  1YTP A;  1H0Z A;  2NU2 I;  2ROW A;  1XBT A;  5JHW C;  1CE3 A;  3FSY A;  3QTL D;  2CWG A;  3E2I A;  3UFF A;  1SGN I;  2KCX A;  4HGU A;  5FUW A;  2NU3 I;  1N13 A;  1XA6 A;  1WGC A;  3SEK C;  4DNC A;  1TIH A;  2B0U C;  3SGB I;  3QWP A;  5CCM A;  1LR7 A;  1R79 A;  1MJ9 A;  1SGE I;  5E3R A;  2QQE A;  1SGD I; 
#chains in the Genus database with same CATH homology
 2UZ3 A;  5FUY A;  3SGQ I;  3OXF A;  1PJU A;  2YQP A;  2F3C I;  1RFH A;  1LR8 A;  2NU4 I;  2SGF I;  3UGL A;  1XX6 A;  1AN1 I;  5DAE A;  2GVI A;  2JXD A;  3MEK A;  1BUS A;  2SGP I;  4UXI A;  4SGB I;  2YUU A;  1SGQ I;  4JCV E;  2L7X A;  2GKT I;  2V1C A;  1UVF A;  2A20 A;  1FAQ A;  1Y1B A;  2L8E A;  1OVO A;  4E1R A;  4L9M A;  4E1P A;  2QPO A;  1V1H A;  3OVO A;  2BUS A;  3KY9 A;  3VE5 A;  2ENN A;  2N52 A;  3D00 A;  2ODD A;  1CT4 I;  4OVO A;  2JA1 A;  2CJS C;  2ARP F;  1R0R I;  1X4S A;  2SGE I;  3E59 A;  3OL0 A;  1FYB A;  2ELI A;  2JYY A;  2WCY A;  1U5K A;  1W4R A;  2ORV A;  2LUY A;  1TBQ R;  1KBE A;  4UXH A;  2LEO A;  1HPT A;  2ERW A;  2N17 A;  1BMO A;  2SGD I;  1X74 A;  2V53 A;  5HQ8 A;  1UVG A;  2QQD A;  3OXG A;  2OD1 A;  3UGI A;  1CGI I;  1CHO I;  4UXJ A;  1TBO A;  5EX0 A;  1MT1 A;  2K9H A;  3UEJ A;  1M8C A;  1FAR A;  2ENZ A;  2WVJ A;  1DS3 I;  2KMP A;  3BJI A;  1VDD A;  1Y8F A;  2N71 A;  2NU0 I;  2E5R A;  3TJQ A;  2M5X A;  1IY5 A;  1IY6 A;  1OYV I;  5FUV A;  2FNF X;  1CT2 I;  3VDU A;  2KMQ A;  2VRW B;  1PTQ A;  2W0T A;  4GI3 C;  3GOX A;  1V1I A;  2NU1 I;  1SGR I;  1TBR R;  1TBN A;  2V1C C;  1OMU A;  1TGS I;  1PPF I;  1CGJ I;  1PCE A;  1HDL A;  2ORW A;  3FC3 A;  1YU6 C;  4B6D A;  2J9R A;  2GKR I;  1TUS A;  1M8B A;  3UGD A;  2E73 A;  4FKD A;  1KMA A;  1W3S A;  1OMT A;  1UUC A;  1DS2 I;  2JW6 A;  2QQ0 A;  2SGQ I;  1CT0 I;  2QQC A;  2J87 A;  1Y1C A;  1CSO I;  1TUR A;  5HI7 A;  1HJA I;  2JZM A;  5FUX A;  3OXL A;  1PTR A;  1SGP I;  3HH2 C;  2DIP A;  1NUB A;  3B4V C;  2XRC A;  3RU0 A;  5CCL A;  2GKV A;  5EX3 A;  1Z7K B;  2P6A C;  1IW4 A;  3CXL A;  1TOT A;  4A24 A;  2KMR A;  1LR9 A;  1KBF A;  2B8T A;  2KMO A;  2DB6 A;  3VDP A;  1SGY I;  2OVO A;  3PDN A;  2N1A B;  3UEY A;  1YTP A;  1H0Z A;  2NU2 I;  2ROW A;  1XBT A;  5JHW C;  1CE3 A;  3QTL D;  3E2I A;  3UFF A;  1SGN I;  2KCX A;  4HGU A;  5FUW A;  2NU3 I;  1N13 A;  1XA6 A;  3SEK C;  5CCM A;  1TIH A;  2B0U C;  3SGB I;  3QWP A;  1LR7 A;  1R79 A;  1SGE I;  2QQE A;  1SGD I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...