1PTQA

Protein kinase c delta cys2 domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
50
structure length
50
Chain Sequence
HRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the cys2 activator-binding domain of protein kinase C delta in complex with phorbol ester.
pubmed doi rcsb
source organism Mus musculus
molecule tags Phosphotransferase
molecule keywords PROTEIN KINASE C DELTA TYPE
total genus 10
structure length 50
sequence length 50
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1995-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1ptqA00
1XX6A 3E2IA 1Y8FA 2UZ3A 5FUVA 1TBOA 2JA1A 2GVIA 4UXHA 3UGIA 2ROWA 3UEJA 4L9MA 1FARA 4FKDA 2ENZA 1FAQA 2ELIA 1PTQA 1KBEA 2WVJA 2FNFX 3BJIA 2J9RA 5FUXA 3UFFA 3UGLA 1XBTA 1PTRA 2ORVA 2QQEA 3CXLA 1XA6A 2DB6A 1W4RA 4UXIA 2YUUA 4B6DA 2J87A 4UXJA 2B8TA 2QQ0A 2ENNA 2VRWB 3KY9A 3UEYA 1R79A 2E73A 1RFHA 5FUYA 2QPOA 3UGDA 1TBNA 1KBFA 5FUWA 2ORWA
chains in the Genus database with same CATH superfamily
3R5CA 3E2IA 4E1PA 1WGCA 4WP4A 4OVOA 2UZ3A 5FUVA 1CT0I 1TBOA 7WGAA 2DIPA 3QAHA 2GKVA 2OZUA 2ROWA 3R5DA 1KMAA 4L9MA 2N71A 1SGDI 1UUCA 3E59A 1SGYI 1N13A 1Z2IA 3VDPA 2A20A 2SGEI 2B0UC 1HEVA 2WGCA 1PCEA 1OMUA 1XBTA 1XA6A 1MJBA 4A24A 2V53A 4B6DA 2KMPA 3OL0A 1CT4I 1K7UA 1P9GA 2B8TA 2E5RA 2VRWB 3R5BA 2NU0I 3UEYA 2E73A 2SGFI 1YU6C 5FUYA 1DS2I 1TBNA 1R0RI 2GIVA 2PQ8A 3TOBA 3PDNA 1ULMA 1DS3I 2X3TA 1Y8FA 3UOEA 3MEKA 3RU0A 1X74A 1BMOA 1P9ZA 3OXGA 1WGTA 2QQCA 2DKVA 4UXHA 3SGBI 1LR9A 3UEJA 1CGII 4AMLA 1Y1BA 1FARA 5HI7A 5DAEA 5CCLA 1IY5A 2OD1A 1UVGA 2V1CC 2W0TA 2WVJA 1BUSA 1AN1I 1UVFA 2FNFX 3UFFA 2L7XA 3B4VC 1PJUA 2LB7A 2N52A 2CJSC 1Q9BA 1SGEI 9WGAA 3QTLD 2CWHA 1CHOI 1U5KA 1OMTA 5JHWC 4E1RA 2QQ0A 1TOTA 2ENNA 5CCMA 1WTJA 1SGPI 2P6AC 4SGBI 1R79A 1SGQI 1SGNI 1YTPA 1Z7KB 2JZMA 2J87A 2ERWA 2GKRI 1KBFA 2KMRA 3VE5A 1CT2I 2BUSA 2NU1I 2NU2I 2RIJA 2SGQI 3D00A 1MJAA 3FSXA 1W3SA 4MPIA 3TO7A 5E3PA 1X4SA 2GVIA 3TOAA 1NUBA 2UVOA 4HGUA 1ULNA 2N17A 2KMQA 4FKDA 2ENZA 1FAQA 2F3CI 1CGJI 2LUYA 5J8FA 5J8CA 1PTQA 2Y0MA 2JXDA 1M8BA 1FY7A 2KMOA 1UHAA 2J9RA 2GKTI 2OVOA 5FUXA 1NXUA 2V1CA 3GOXA 1FYBA 1IY6A 2ORVA 1PTRA 2CWFA 3CXLA 3FC3A 2DB6A 1W4RA 2LEOA 2YUUA 4UXJA 1ULKA 1HPTA 1OVOA 1MT1A 1IW4A 1TUSA 3KY9A 3VDUA 1RFHA 5EX0A 1WKXA 2QPOA 1SGRI 1TURA 3OXLA 4JCVE 1LR7A 1TIHA 3TJQA 3UGDA 2M5XA 5FUWA 2ORWA 2K9HA 1XX6A 2YQPA 2ODDA 3FSYA 1H0ZA 2JA1A 3OXFA 2NU3I 2XRCA 2ARPF 3UGIA 1LR8A 1OYVI 2SGPI 5E3RA 1M8CA 5HQ8A 2ELIA 1K7TA 2NU4I 3R5AA 3HH2C 3TO9A 1KBEA 2JW6A 3BJIA 1HJAI 4DNCA 1V1HA 4GI3C 1VDDA 2SGDI 3UGLA 3QWPA 3SEKC 1TBQR 2N1AB 1V1IA 1MJ9A 2JYYA 1Y1CA 2L8EA 2QQEA 2CWGA 4UXIA 1TGSI 2WCYA 1HDLA 2QQDA 3OVOA 1TBRR 1K7VA 1CE3A 1S20A 2OU2A 2RC4A 2KCXA 5E3QA 3SGQI 1CSOI 1PPFI 5EX3A 3TO6A 2X52A
chains in the Genus database with same CATH topology
3E2IA 4E1PA 4OVOA 2UZ3A 5FUVA 1CT0I 1TBOA 2DIPA 2GKVA 2ROWA 1KMAA 4L9MA 2N71A 1SGDI 1UUCA 3E59A 1SGYI 1N13A 3VDPA 2A20A 2SGEI 2B0UC 1PCEA 1OMUA 1XBTA 1XA6A 4A24A 2V53A 4B6DA 2KMPA 3OL0A 1CT4I 2B8TA 2E5RA 2VRWB 2NU0I 3UEYA 2E73A 2SGFI 1YU6C 5FUYA 1DS2I 1TBNA 1R0RI 3PDNA 1DS3I 1Y8FA 3MEKA 3RU0A 1X74A 1BMOA 3OXGA 2QQCA 4UXHA 3SGBI 1LR9A 3UEJA 1CGII 1Y1BA 1FARA 5HI7A 5DAEA 5CCLA 1IY5A 2OD1A 1UVGA 2V1CC 2W0TA 2WVJA 1BUSA 1AN1I 1UVFA 2FNFX 3UFFA 2L7XA 3B4VC 1PJUA 2N52A 2CJSC 1SGEI 3QTLD 1CHOI 1U5KA 1OMTA 5JHWC 4E1RA 2QQ0A 1TOTA 2ENNA 5CCMA 4SGBI 1SGPI 2P6AC 1R79A 1SGQI 1YTPA 1Z7KB 1SGNI 2JZMA 2J87A 2ERWA 2GKRI 1KBFA 2KMRA 3VE5A 1CT2I 2BUSA 2NU1I 2NU2I 3D00A 2SGQI 1W3SA 1X4SA 2GVIA 1NUBA 4HGUA 2N17A 2KMQA 4FKDA 2ENZA 1FAQA 2F3CI 1CGJI 2LUYA 1PTQA 2JXDA 1M8BA 2KMOA 2J9RA 2OVOA 2GKTI 5FUXA 3GOXA 2V1CA 1FYBA 1IY6A 2ORVA 1PTRA 3CXLA 3FC3A 2DB6A 1W4RA 2LEOA 2YUUA 4UXJA 1HPTA 1OVOA 1MT1A 1IW4A 1TUSA 3KY9A 3VDUA 1RFHA 5EX0A 2QPOA 3UGDA 1SGRI 1TURA 3OXLA 4JCVE 1LR7A 1TIHA 3TJQA 2M5XA 5FUWA 2ORWA 2K9HA 1XX6A 2YQPA 2ODDA 1H0ZA 2JA1A 3OXFA 2NU3I 2XRCA 2ARPF 3UGIA 1LR8A 1OYVI 2SGPI 1M8CA 5HQ8A 2ELIA 2NU4I 3HH2C 1KBEA 2JW6A 3BJIA 1HJAI 1V1HA 4GI3C 1VDDA 2SGDI 3UGLA 3QWPA 3SEKC 1TBQR 2N1AB 1V1IA 2QQEA 2JYYA 1Y1CA 2L8EA 4UXIA 1HDLA 1TGSI 2WCYA 2QQDA 3OVOA 1TBRR 1CE3A 2KCXA 3SGQI 1CSOI 1PPFI 5EX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XX6 A;  3E2I A;  1Y8F A;  2UZ3 A;  5FUV A;  1TBO A;  2JA1 A;  2GVI A;  4UXH A;  3UGI A;  2ROW A;  3UEJ A;  4L9M A;  1FAR A;  4FKD A;  2ENZ A;  1FAQ A;  2ELI A;  1PTQ A;  1KBE A;  2WVJ A;  2FNF X;  3BJI A;  2J9R A;  5FUX A;  3UFF A;  3UGL A;  1XBT A;  1PTR A;  2ORV A;  2QQE A;  3CXL A;  1XA6 A;  2DB6 A;  1W4R A;  4UXI A;  2YUU A;  4B6D A;  2J87 A;  4UXJ A;  2B8T A;  2QQ0 A;  2ENN A;  2VRW B;  3KY9 A;  3UEY A;  1R79 A;  2E73 A;  1RFH A;  5FUY A;  2QPO A;  3UGD A;  1TBN A;  1KBF A;  5FUW A;  2ORW A; 
#chains in the Genus database with same CATH topology
 3R5C A;  3E2I A;  4E1P A;  1WGC A;  4WP4 A;  4OVO A;  2UZ3 A;  5FUV A;  1CT0 I;  1TBO A;  7WGA A;  2DIP A;  3QAH A;  2GKV A;  2OZU A;  2ROW A;  3R5D A;  1KMA A;  4L9M A;  2N71 A;  1SGD I;  1UUC A;  3E59 A;  1SGY I;  1N13 A;  1Z2I A;  3VDP A;  2A20 A;  2SGE I;  2B0U C;  1HEV A;  2WGC A;  1PCE A;  1OMU A;  1XBT A;  1XA6 A;  1MJB A;  4A24 A;  2V53 A;  4B6D A;  2KMP A;  3OL0 A;  1CT4 I;  1K7U A;  1P9G A;  2B8T A;  2E5R A;  2VRW B;  3R5B A;  2NU0 I;  3UEY A;  2E73 A;  2SGF I;  1YU6 C;  5FUY A;  1DS2 I;  1TBN A;  1R0R I;  2GIV A;  2PQ8 A;  3TOB A;  3PDN A;  1ULM A;  1DS3 I;  2X3T A;  1Y8F A;  3UOE A;  3MEK A;  3RU0 A;  1X74 A;  1BMO A;  1P9Z A;  3OXG A;  1WGT A;  2QQC A;  2DKV A;  4UXH A;  3SGB I;  1LR9 A;  3UEJ A;  1CGI I;  4AML A;  1Y1B A;  1FAR A;  5HI7 A;  5DAE A;  5CCL A;  1IY5 A;  2OD1 A;  1UVG A;  2V1C C;  2W0T A;  2WVJ A;  1BUS A;  1AN1 I;  1UVF A;  2FNF X;  3UFF A;  2L7X A;  3B4V C;  1PJU A;  2LB7 A;  2N52 A;  2CJS C;  1Q9B A;  1SGE I;  9WGA A;  3QTL D;  2CWH A;  1CHO I;  1U5K A;  1OMT A;  5JHW C;  4E1R A;  2QQ0 A;  1TOT A;  2ENN A;  5CCM A;  1WTJ A;  1SGP I;  2P6A C;  4SGB I;  1R79 A;  1SGQ I;  1SGN I;  1YTP A;  1Z7K B;  2JZM A;  2J87 A;  2ERW A;  2GKR I;  1KBF A;  2KMR A;  3VE5 A;  1CT2 I;  2BUS A;  2NU1 I;  2NU2 I;  2RIJ A;  2SGQ I;  3D00 A;  1MJA A;  3FSX A;  1W3S A;  4MPI A;  3TO7 A;  5E3P A;  1X4S A;  2GVI A;  3TOA A;  1NUB A;  2UVO A;  4HGU A;  1ULN A;  2N17 A;  2KMQ A;  4FKD A;  2ENZ A;  1FAQ A;  2F3C I;  1CGJ I;  2LUY A;  5J8F A;  5J8C A;  1PTQ A;  2Y0M A;  2JXD A;  1M8B A;  1FY7 A;  2KMO A;  1UHA A;  2J9R A;  2GKT I;  2OVO A;  5FUX A;  1NXU A;  2V1C A;  3GOX A;  1FYB A;  1IY6 A;  2ORV A;  1PTR A;  2CWF A;  3CXL A;  3FC3 A;  2DB6 A;  1W4R A;  2LEO A;  2YUU A;  4UXJ A;  1ULK A;  1HPT A;  1OVO A;  1MT1 A;  1IW4 A;  1TUS A;  3KY9 A;  3VDU A;  1RFH A;  5EX0 A;  1WKX A;  2QPO A;  1SGR I;  1TUR A;  3OXL A;  4JCV E;  1LR7 A;  1TIH A;  3TJQ A;  3UGD A;  2M5X A;  5FUW A;  2ORW A;  2K9H A;  1XX6 A;  2YQP A;  2ODD A;  3FSY A;  1H0Z A;  2JA1 A;  3OXF A;  2NU3 I;  2XRC A;  2ARP F;  3UGI A;  1LR8 A;  1OYV I;  2SGP I;  5E3R A;  1M8C A;  5HQ8 A;  2ELI A;  1K7T A;  2NU4 I;  3R5A A;  3HH2 C;  3TO9 A;  1KBE A;  2JW6 A;  3BJI A;  1HJA I;  4DNC A;  1V1H A;  4GI3 C;  1VDD A;  2SGD I;  3UGL A;  3QWP A;  3SEK C;  1TBQ R;  2N1A B;  1V1I A;  1MJ9 A;  2JYY A;  1Y1C A;  2L8E A;  2QQE A;  2CWG A;  4UXI A;  1TGS I;  2WCY A;  1HDL A;  2QQD A;  3OVO A;  1TBR R;  1K7V A;  1CE3 A;  1S20 A;  2OU2 A;  2RC4 A;  2KCX A;  5E3Q A;  3SGQ I;  1CSO I;  1PPF I;  5EX3 A;  3TO6 A;  2X52 A; 
#chains in the Genus database with same CATH homology
 3E2I A;  4E1P A;  4OVO A;  2UZ3 A;  5FUV A;  1CT0 I;  1TBO A;  2DIP A;  2GKV A;  2ROW A;  1KMA A;  4L9M A;  2N71 A;  1SGD I;  1UUC A;  3E59 A;  1SGY I;  1N13 A;  3VDP A;  2A20 A;  2SGE I;  2B0U C;  1PCE A;  1OMU A;  1XBT A;  1XA6 A;  4A24 A;  2V53 A;  4B6D A;  2KMP A;  3OL0 A;  1CT4 I;  2B8T A;  2E5R A;  2VRW B;  2NU0 I;  3UEY A;  2E73 A;  2SGF I;  1YU6 C;  5FUY A;  1DS2 I;  1TBN A;  1R0R I;  3PDN A;  1DS3 I;  1Y8F A;  3MEK A;  3RU0 A;  1X74 A;  1BMO A;  3OXG A;  2QQC A;  4UXH A;  3SGB I;  1LR9 A;  3UEJ A;  1CGI I;  1Y1B A;  1FAR A;  5HI7 A;  5DAE A;  5CCL A;  1IY5 A;  2OD1 A;  1UVG A;  2V1C C;  2W0T A;  2WVJ A;  1BUS A;  1AN1 I;  1UVF A;  2FNF X;  3UFF A;  2L7X A;  3B4V C;  1PJU A;  2N52 A;  2CJS C;  1SGE I;  3QTL D;  1CHO I;  1U5K A;  1OMT A;  5JHW C;  4E1R A;  2QQ0 A;  1TOT A;  2ENN A;  5CCM A;  4SGB I;  1SGP I;  2P6A C;  1R79 A;  1SGQ I;  1YTP A;  1Z7K B;  1SGN I;  2JZM A;  2J87 A;  2ERW A;  2GKR I;  1KBF A;  2KMR A;  3VE5 A;  1CT2 I;  2BUS A;  2NU1 I;  2NU2 I;  3D00 A;  2SGQ I;  1W3S A;  1X4S A;  2GVI A;  1NUB A;  4HGU A;  2N17 A;  2KMQ A;  4FKD A;  2ENZ A;  1FAQ A;  2F3C I;  1CGJ I;  2LUY A;  1PTQ A;  2JXD A;  1M8B A;  2KMO A;  2J9R A;  2OVO A;  2GKT I;  5FUX A;  3GOX A;  2V1C A;  1FYB A;  1IY6 A;  2ORV A;  1PTR A;  3CXL A;  3FC3 A;  2DB6 A;  1W4R A;  2LEO A;  2YUU A;  4UXJ A;  1HPT A;  1OVO A;  1MT1 A;  1IW4 A;  1TUS A;  3KY9 A;  3VDU A;  1RFH A;  5EX0 A;  2QPO A;  3UGD A;  1SGR I;  1TUR A;  3OXL A;  4JCV E;  1LR7 A;  1TIH A;  3TJQ A;  2M5X A;  5FUW A;  2ORW A;  2K9H A;  1XX6 A;  2YQP A;  2ODD A;  1H0Z A;  2JA1 A;  3OXF A;  2NU3 I;  2XRC A;  2ARP F;  3UGI A;  1LR8 A;  1OYV I;  2SGP I;  1M8C A;  5HQ8 A;  2ELI A;  2NU4 I;  3HH2 C;  1KBE A;  2JW6 A;  3BJI A;  1HJA I;  1V1H A;  4GI3 C;  1VDD A;  2SGD I;  3UGL A;  3QWP A;  3SEK C;  1TBQ R;  2N1A B;  1V1I A;  2QQE A;  2JYY A;  1Y1C A;  2L8E A;  4UXI A;  1HDL A;  1TGS I;  2WCY A;  2QQD A;  3OVO A;  1TBR R;  1CE3 A;  2KCX A;  3SGQ I;  1CSO I;  1PPF I;  5EX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...