1PTQA

Protein kinase c delta cys2 domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
50
structure length
50
Chain Sequence
HRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN KINASE C DELTA TYPE
publication title Crystal structure of the cys2 activator-binding domain of protein kinase C delta in complex with phorbol ester.
pubmed doi rcsb
source organism Mus musculus
molecule tags Phosphotransferase
total genus 10
structure length 50
sequence length 50
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1995-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1ptqA00
3UGDA 2ORWA 2QPOA 2B8TA 4FKDA 2GVIA 4L9MA 4UXHA 2J87A 2DB6A 1TBNA 4UXIA 2QQEA 5FUXA 1KBEA 2WVJA 5FUWA 1XBTA 2ELIA 1XX6A 2E73A 3UGLA 2JA1A 1KBFA 3UEJA 5FUYA 1RFHA 1XA6A 3BJIA 3UFFA 3CXLA 1TBOA 3KY9A 1Y8FA 3UGIA 2ENZA 1FARA 3E2IA 2VRWB 1FAQA 5FUVA 4UXJA 2J9RA 2ORVA 2QQ0A 1W4RA 2UZ3A 1R79A 1PTRA 2ENNA 2YUUA 2ROWA 3UEYA 1PTQA 2FNFX 4B6DA
chains in the Genus database with same CATH superfamily
1S20A 3VDUA 2WCYA 2QQCA 2Y0MA 5E3QA 2ERWA 2JW6A 2GVIA 1MJBA 2NU2I 2KMOA 1TBQR 2KMRA 2WGCA 3OL0A 2OVOA 3TO9A 2LEOA 2QQDA 1Z7KB 2L8EA 5FUWA 1HDLA 2F3CI 2CWGA 4GI3C 1DS3I 1WGCA 2DIPA 2OD1A 2JA1A 1PJUA 1FY7A 1SGEI 2DKVA 1WKXA 3SEKC 1IW4A 1FYBA 1XA6A 2KMPA 3BJIA 3PDNA 4SGBI 5EX0A 3B4VC 2M5XA 1NXUA 3R5CA 1Y1BA 2KMQA 2N71A 3TOBA 1PCEA 1R79A 1TBRR 1SGDI 2ENNA 2SGQI 4JCVE 1N13A 3FSXA 1CT0I 1R0RI 1PTQA 2A20A 1NUBA 2ODDA 2ROWA 3FSYA 4HGUA 4B6DA 4E1PA 3HH2C 3VDPA 5HI7A 1K7VA 3OXFA 3UGDA 2GKTI 2QPOA 1SGPI 1X74A 2B8TA 2PQ8A 2X3TA 1CT4I 1OMUA 1P9ZA 1U5KA 7WGAA 3D00A 2B0UC 2J87A 4OVOA 5CCLA 1VDDA 2WVJA 5J8CA 1UVFA 1CHOI 2E73A 1LR8A 9WGAA 3OXLA 5E3PA 1M8BA 3MEKA 5FUYA 2N52A 3KY9A 2OZUA 2GKRI 1FARA 5CCMA 1SGRI 2V53A 1TGSI 3SGBI 3QTLD 4UXJA 1P9GA 2V1CA 2QQ0A 3TO7A 5EX3A 3SGQI 3R5DA 2GKVA 2E5RA 5HQ8A 1TOTA 2SGFI 1V1HA 3TO6A 1MJ9A 3QAHA 1ULKA 2ORWA 3TOAA 3RU0A 3OXGA 2NU3I 1UVGA 1ULNA 2CWFA 2KCXA 2NU0I 1TBNA 1WTJA 3R5AA 2X52A 4MPIA 1YTPA 1KBEA 2RIJA 1SGYI 1XBTA 2JZMA 1SGQI 1M8CA 1MT1A 1BMOA 1UHAA 1XX6A 3R5BA 3TJQA 3UGLA 2CWHA 1CE3A 1CT2I 2V1CC 1KMAA 3GOXA 1RFHA 1ULMA 4A24A 3CXLA 1TBOA 2ENZA 5DAEA 3E2IA 4WP4A 5FUVA 3UOEA 2GIVA 2J9RA 2ORVA 1W4RA 1OVOA 2SGEI 1PTRA 2RC4A 2UZ3A 1BUSA 1LR7A 1PPFI 3UEYA 2XRCA 2JYYA 1UUCA 2CJSC 1W3SA 2FNFX 2K9HA 2QQEA 1LR9A 2NU1I 2SGDI 2ARPF 2N1AB 1OYVI 1DS2I 1TIHA 3OVOA 1MJAA 1X4SA 1CGII 4FKDA 2SGPI 4UXHA 3VE5A 5J8FA 2DB6A 3E59A 4DNCA 1HJAI 1V1IA 4UXIA 1CGJI 1TUSA 5FUXA 1OMTA 1K7UA 1WGTA 5E3RA 2ELIA 5JHWC 3QWPA 2LUYA 2LB7A 2YQPA 2N17A 2NU4I 3UEJA 1KBFA 1K7TA 3UFFA 1HEVA 2L7XA 1Y1CA 1AN1I 2UVOA 3UGIA 1Y8FA 1H0ZA 1HPTA 1SGNI 2VRWB 1IY5A 1FAQA 1CSOI 2P6AC 2YUUA 2BUSA 4AMLA 1YU6C 1Z2IA 2JXDA 1TURA 2OU2A 4E1RA 3FC3A 4L9MA 2W0TA 1IY6A 1Q9BA
chains in the Genus database with same CATH topology
3VDUA 2WCYA 2QQCA 2ERWA 2JW6A 2GVIA 2NU2I 2KMOA 1TBQR 2KMRA 3OL0A 2OVOA 2LEOA 2QQDA 1Z7KB 2L8EA 5FUWA 1HDLA 2F3CI 4GI3C 1DS3I 2DIPA 2OD1A 2JA1A 1PJUA 1SGEI 1FYBA 3SEKC 1IW4A 1XA6A 2KMPA 3BJIA 3PDNA 4SGBI 5EX0A 3B4VC 2M5XA 1Y1BA 2KMQA 2N71A 1PCEA 1R79A 1TBRR 1SGDI 2ENNA 2SGQI 4JCVE 1N13A 1CT0I 1R0RI 1PTQA 2A20A 1NUBA 2ROWA 4HGUA 4B6DA 4E1PA 3HH2C 3VDPA 5HI7A 3OXFA 3UGDA 2GKTI 2QPOA 1SGPI 1X74A 2B8TA 1CT4I 1OMUA 1U5KA 3D00A 2B0UC 2J87A 4OVOA 5CCLA 1VDDA 2WVJA 1UVFA 1CHOI 2E73A 1LR8A 3OXLA 1M8BA 3MEKA 5FUYA 2N52A 3KY9A 5CCMA 2GKRI 1FARA 1SGRI 2V53A 1TGSI 3SGBI 3QTLD 4UXJA 2V1CA 2QQ0A 5EX3A 3SGQI 2GKVA 2E5RA 5HQ8A 1TOTA 2SGFI 1V1HA 2ORWA 3RU0A 3OXGA 2NU3I 1UVGA 2KCXA 2NU0I 1TBNA 1YTPA 1KBEA 1SGYI 1XBTA 2JZMA 1SGQI 1M8CA 1MT1A 1BMOA 1XX6A 3TJQA 3UGLA 1CE3A 1KMAA 1CT2I 2V1CC 3GOXA 1RFHA 4A24A 3CXLA 1TBOA 2ENZA 5DAEA 3E2IA 5FUVA 2J9RA 2ORVA 1W4RA 1OVOA 2SGEI 1PTRA 2UZ3A 1BUSA 1LR7A 1PPFI 3UEYA 2XRCA 2JYYA 1UUCA 2CJSC 1W3SA 2FNFX 2K9HA 2QQEA 1LR9A 2NU1I 2SGDI 2ARPF 2N1AB 1OYVI 1DS2I 1TIHA 3OVOA 1X4SA 1CGII 4FKDA 2SGPI 4UXHA 3VE5A 2DB6A 3E59A 1HJAI 1V1IA 4UXIA 1CGJI 1TUSA 5FUXA 1OMTA 2ELIA 5JHWC 3QWPA 2LUYA 2YQPA 2N17A 2NU4I 3UEJA 1KBFA 3UFFA 2L7XA 1Y1CA 1AN1I 3UGIA 1H0ZA 1Y8FA 1HPTA 1SGNI 2VRWB 1IY5A 1FAQA 1CSOI 2P6AC 2YUUA 2BUSA 1YU6C 4E1RA 2JXDA 1TURA 3FC3A 1IY6A 4L9MA 2W0TA 2ODDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UGD A;  2ORW A;  2QPO A;  2B8T A;  4FKD A;  2GVI A;  4L9M A;  4UXH A;  2J87 A;  2DB6 A;  1TBN A;  4UXI A;  2QQE A;  5FUX A;  1KBE A;  2WVJ A;  5FUW A;  1XBT A;  2ELI A;  1XX6 A;  2E73 A;  3UGL A;  2JA1 A;  1KBF A;  3UEJ A;  5FUY A;  1RFH A;  1XA6 A;  3BJI A;  3UFF A;  3CXL A;  1TBO A;  3KY9 A;  1Y8F A;  3UGI A;  2ENZ A;  1FAR A;  3E2I A;  2VRW B;  1FAQ A;  5FUV A;  4UXJ A;  2J9R A;  2ORV A;  2QQ0 A;  1W4R A;  2UZ3 A;  1R79 A;  1PTR A;  2ENN A;  2YUU A;  2ROW A;  3UEY A;  1PTQ A;  2FNF X;  4B6D A; 
#chains in the Genus database with same CATH topology
 1S20 A;  3VDU A;  2WCY A;  2QQC A;  2Y0M A;  5E3Q A;  2ERW A;  2JW6 A;  2GVI A;  1MJB A;  2NU2 I;  2KMO A;  1TBQ R;  2KMR A;  2WGC A;  3OL0 A;  2OVO A;  3TO9 A;  2LEO A;  2QQD A;  1Z7K B;  2L8E A;  5FUW A;  1HDL A;  2F3C I;  2CWG A;  4GI3 C;  1DS3 I;  1WGC A;  2DIP A;  2OD1 A;  2JA1 A;  1PJU A;  1FY7 A;  1SGE I;  2DKV A;  1WKX A;  3SEK C;  1IW4 A;  1FYB A;  1XA6 A;  2KMP A;  3BJI A;  3PDN A;  4SGB I;  5EX0 A;  3B4V C;  2M5X A;  1NXU A;  3R5C A;  1Y1B A;  2KMQ A;  2N71 A;  3TOB A;  1PCE A;  1R79 A;  1TBR R;  1SGD I;  2ENN A;  2SGQ I;  4JCV E;  1N13 A;  3FSX A;  1CT0 I;  1R0R I;  1PTQ A;  2A20 A;  1NUB A;  2ODD A;  2ROW A;  3FSY A;  4HGU A;  4B6D A;  4E1P A;  3HH2 C;  3VDP A;  5HI7 A;  1K7V A;  3OXF A;  3UGD A;  2GKT I;  2QPO A;  1SGP I;  1X74 A;  2B8T A;  2PQ8 A;  2X3T A;  1CT4 I;  1OMU A;  1P9Z A;  1U5K A;  7WGA A;  3D00 A;  2B0U C;  2J87 A;  4OVO A;  5CCL A;  1VDD A;  2WVJ A;  5J8C A;  1UVF A;  1CHO I;  2E73 A;  1LR8 A;  9WGA A;  3OXL A;  5E3P A;  1M8B A;  3MEK A;  5FUY A;  2N52 A;  3KY9 A;  2OZU A;  2GKR I;  1FAR A;  5CCM A;  1SGR I;  2V53 A;  1TGS I;  3SGB I;  3QTL D;  4UXJ A;  1P9G A;  2V1C A;  2QQ0 A;  3TO7 A;  5EX3 A;  3SGQ I;  3R5D A;  2GKV A;  2E5R A;  5HQ8 A;  1TOT A;  2SGF I;  1V1H A;  3TO6 A;  1MJ9 A;  3QAH A;  1ULK A;  2ORW A;  3TOA A;  3RU0 A;  3OXG A;  2NU3 I;  1UVG A;  1ULN A;  2CWF A;  2KCX A;  2NU0 I;  1TBN A;  1WTJ A;  3R5A A;  2X52 A;  4MPI A;  1YTP A;  1KBE A;  2RIJ A;  1SGY I;  1XBT A;  2JZM A;  1SGQ I;  1M8C A;  1MT1 A;  1BMO A;  1UHA A;  1XX6 A;  3R5B A;  3TJQ A;  3UGL A;  2CWH A;  1CE3 A;  1CT2 I;  2V1C C;  1KMA A;  3GOX A;  1RFH A;  1ULM A;  4A24 A;  3CXL A;  1TBO A;  2ENZ A;  5DAE A;  3E2I A;  4WP4 A;  5FUV A;  3UOE A;  2GIV A;  2J9R A;  2ORV A;  1W4R A;  1OVO A;  2SGE I;  1PTR A;  2RC4 A;  2UZ3 A;  1BUS A;  1LR7 A;  1PPF I;  3UEY A;  2XRC A;  2JYY A;  1UUC A;  2CJS C;  1W3S A;  2FNF X;  2K9H A;  2QQE A;  1LR9 A;  2NU1 I;  2SGD I;  2ARP F;  2N1A B;  1OYV I;  1DS2 I;  1TIH A;  3OVO A;  1MJA A;  1X4S A;  1CGI I;  4FKD A;  2SGP I;  4UXH A;  3VE5 A;  5J8F A;  2DB6 A;  3E59 A;  4DNC A;  1HJA I;  1V1I A;  4UXI A;  1CGJ I;  1TUS A;  5FUX A;  1OMT A;  1K7U A;  1WGT A;  5E3R A;  2ELI A;  5JHW C;  3QWP A;  2LUY A;  2LB7 A;  2YQP A;  2N17 A;  2NU4 I;  3UEJ A;  1KBF A;  1K7T A;  3UFF A;  1HEV A;  2L7X A;  1Y1C A;  1AN1 I;  2UVO A;  3UGI A;  1Y8F A;  1H0Z A;  1HPT A;  1SGN I;  2VRW B;  1IY5 A;  1FAQ A;  1CSO I;  2P6A C;  2YUU A;  2BUS A;  4AML A;  1YU6 C;  1Z2I A;  2JXD A;  1TUR A;  2OU2 A;  4E1R A;  3FC3 A;  4L9M A;  2W0T A;  1IY6 A;  1Q9B A; 
#chains in the Genus database with same CATH homology
 3VDU A;  2WCY A;  2QQC A;  2ERW A;  2JW6 A;  2GVI A;  2NU2 I;  2KMO A;  1TBQ R;  2KMR A;  3OL0 A;  2OVO A;  2LEO A;  2QQD A;  1Z7K B;  2L8E A;  5FUW A;  1HDL A;  2F3C I;  4GI3 C;  1DS3 I;  2DIP A;  2OD1 A;  2JA1 A;  1PJU A;  1SGE I;  1FYB A;  3SEK C;  1IW4 A;  1XA6 A;  2KMP A;  3BJI A;  3PDN A;  4SGB I;  5EX0 A;  3B4V C;  2M5X A;  1Y1B A;  2KMQ A;  2N71 A;  1PCE A;  1R79 A;  1TBR R;  1SGD I;  2ENN A;  2SGQ I;  4JCV E;  1N13 A;  1CT0 I;  1R0R I;  1PTQ A;  2A20 A;  1NUB A;  2ROW A;  4HGU A;  4B6D A;  4E1P A;  3HH2 C;  3VDP A;  5HI7 A;  3OXF A;  3UGD A;  2GKT I;  2QPO A;  1SGP I;  1X74 A;  2B8T A;  1CT4 I;  1OMU A;  1U5K A;  3D00 A;  2B0U C;  2J87 A;  4OVO A;  5CCL A;  1VDD A;  2WVJ A;  1UVF A;  1CHO I;  2E73 A;  1LR8 A;  3OXL A;  1M8B A;  3MEK A;  5FUY A;  2N52 A;  3KY9 A;  5CCM A;  2GKR I;  1FAR A;  1SGR I;  2V53 A;  1TGS I;  3SGB I;  3QTL D;  4UXJ A;  2V1C A;  2QQ0 A;  5EX3 A;  3SGQ I;  2GKV A;  2E5R A;  5HQ8 A;  1TOT A;  2SGF I;  1V1H A;  2ORW A;  3RU0 A;  3OXG A;  2NU3 I;  1UVG A;  2KCX A;  2NU0 I;  1TBN A;  1YTP A;  1KBE A;  1SGY I;  1XBT A;  2JZM A;  1SGQ I;  1M8C A;  1MT1 A;  1BMO A;  1XX6 A;  3TJQ A;  3UGL A;  1CE3 A;  1KMA A;  1CT2 I;  2V1C C;  3GOX A;  1RFH A;  4A24 A;  3CXL A;  1TBO A;  2ENZ A;  5DAE A;  3E2I A;  5FUV A;  2J9R A;  2ORV A;  1W4R A;  1OVO A;  2SGE I;  1PTR A;  2UZ3 A;  1BUS A;  1LR7 A;  1PPF I;  3UEY A;  2XRC A;  2JYY A;  1UUC A;  2CJS C;  1W3S A;  2FNF X;  2K9H A;  2QQE A;  1LR9 A;  2NU1 I;  2SGD I;  2ARP F;  2N1A B;  1OYV I;  1DS2 I;  1TIH A;  3OVO A;  1X4S A;  1CGI I;  4FKD A;  2SGP I;  4UXH A;  3VE5 A;  2DB6 A;  3E59 A;  1HJA I;  1V1I A;  4UXI A;  1CGJ I;  1TUS A;  5FUX A;  1OMT A;  2ELI A;  5JHW C;  3QWP A;  2LUY A;  2YQP A;  2N17 A;  2NU4 I;  3UEJ A;  1KBF A;  3UFF A;  2L7X A;  1Y1C A;  1AN1 I;  3UGI A;  1H0Z A;  1Y8F A;  1HPT A;  1SGN I;  2VRW B;  1IY5 A;  1FAQ A;  1CSO I;  2P6A C;  2YUU A;  2BUS A;  1YU6 C;  4E1R A;  2JXD A;  1TUR A;  3FC3 A;  1IY6 A;  4L9M A;  2W0T A;  2ODD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...