1PTQA

Protein kinase c delta cys2 domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
50
structure length
50
Chain Sequence
HRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Phosphotransferase
molecule keywords PROTEIN KINASE C DELTA TYPE
publication title Crystal structure of the cys2 activator-binding domain of protein kinase C delta in complex with phorbol ester.
pubmed doi rcsb
source organism Mus musculus
total genus 10
structure length 50
sequence length 50
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1995-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1ptqA00
1KBEA 2QQ0A 1PTRA 4UXHA 3UGLA 1FARA 3KY9A 2ENNA 4UXIA 4B6DA 2ROWA 5FUXA 3UGIA 3UEJA 1KBFA 1R79A 1XBTA 2ELIA 3E2IA 4UXJA 1TBNA 2J9RA 2WVJA 3UGDA 2J87A 5FUVA 2ENZA 5FUYA 2YUUA 2E73A 2B8TA 1W4RA 3UEYA 2FNFX 2VRWB 2JA1A 2ORVA 3CXLA 3UFFA 1TBOA 2GVIA 2ORWA 2QPOA 1XA6A 4L9MA 4FKDA 1XX6A 2UZ3A 5FUWA 1PTQA 1RFHA 2QQEA 3BJIA 1Y8FA 2DB6A 1FAQA
chains in the Genus database with same CATH superfamily
3R5AA 1SGRI 4SGBI 3TO7A 9WGAA 2KCXA 2B0UC 3KY9A 4GI3C 1VDDA 1PPFI 4E1RA 2KMPA 1OMTA 1YTPA 3UEJA 1TGSI 1P9ZA 2ELIA 1CE3A 1TBNA 3HH2C 2NU0I 1SGEI 2J87A 1UHAA 1V1IA 2NU3I 5FUVA 1LR7A 1TURA 3UEYA 2F3CI 2NU2I 1WGCA 1K7TA 2OVOA 2GKTI 2OD1A 1SGQI 1MT1A 1SGPI 4L9MA 2N52A 1M8CA 5CCLA 4WP4A 5JHWC 2LEOA 1CSOI 3OXLA 2P6AC 1OYVI 2CWHA 2BUSA 2QQDA 1M8BA 2ERWA 2QQ0A 5EX3A 1PTRA 4AMLA 4OVOA 1FARA 2X52A 3OL0A 1BUSA 3OVOA 1DS3I 1SGYI 2L7XA 2NU1I 3TOAA 1KBFA 1R79A 1TBRR 2OU2A 3OXFA 5HQ8A 1IW4A 1N13A 2J9RA 3QTLD 1CT2I 2E5RA 2LB7A 2YUUA 1TUSA 5FUYA 3SGQI 2N1AB 2JYYA 2GKVA 1BMOA 1HPTA 2ORVA 3CXLA 2GVIA 1CT0I 2RC4A 2SGFI 3TOBA 3FC3A 5EX0A 1KMAA 2SGEI 1X4SA 2Y0MA 3FSYA 1IY5A 1PTQA 5E3RA 1LR9A 1RFHA 1TIHA 1OVOA 3RU0A 1OMUA 1ULMA 1NXUA 3UOEA 1FYBA 1K7UA 1YU6C 1HDLA 1CT4I 2YQPA 2CJSC 1KBEA 5CCMA 2KMOA 2GIVA 3OXGA 3R5CA 1WTJA 3UGLA 1NUBA 3D00A 2ENNA 4UXIA 1ULKA 1MJBA 1Z7KB 4DNCA 2ROWA 2V53A 5FUXA 3GOXA 3UGIA 2KMRA 1ULNA 2WCYA 1CGJI 2XRCA 5E3PA 2CWGA 1PCEA 1Z2IA 2E73A 1MJAA 2JZMA 3SEKC 1SGDI 2FNFX 2OZUA 1IY6A 2NU4I 2JA1A 2V1CA 4HGUA 2DKVA 2LUYA 2QPOA 3QWPA 1XA6A 2CWFA 4FKDA 1XX6A 4A24A 1UVGA 2UZ3A 1V1HA 1K7VA 3R5BA 3SGBI 1FY7A 7WGAA 1CGII 2DB6A 3R5DA 2QQCA 1PJUA 1P9GA 3TO9A 1FAQA 1H0ZA 1Q9BA 1WGTA 2PQ8A 2JXDA 1HJAI 2M5XA 4UXHA 2K9HA 2N17A 3FSXA 5DAEA 1Y1BA 5J8FA 1UUCA 1U5KA 1W3SA 1SGNI 2SGPI 2WGCA 1TOTA 3TJQA 4B6DA 3PDNA 2KMQA 2A20A 1S20A 1XBTA 2UVOA 3E2IA 5E3QA 4UXJA 3E59A 2WVJA 2SGDI 2ARPF 2ODDA 2W0TA 2V1CC 1X74A 2ENZA 5HI7A 3UGDA 1LR8A 4E1PA 1DS2I 3TO6A 1Y1CA 1W4RA 2B8TA 2SGQI 3VDUA 1CHOI 3VDPA 2VRWB 3UFFA 3B4VC 1UVFA 2DIPA 1TBOA 2N71A 1MJ9A 2JW6A 2ORWA 2RIJA 2X3TA 3QAHA 4JCVE 4MPIA 2L8EA 1AN1I 1R0RI 5FUWA 2QQEA 3BJIA 5J8CA 1TBQR 1Y8FA 3MEKA 2GKRI 1WKXA 3VE5A 1HEVA
chains in the Genus database with same CATH topology
1SGRI 4SGBI 2KCXA 2B0UC 3KY9A 4GI3C 1VDDA 1PPFI 4E1RA 2KMPA 1OMTA 1YTPA 3UEJA 1TGSI 2ELIA 1CE3A 1TBNA 3HH2C 2NU0I 1SGEI 2J87A 1V1IA 2NU3I 5FUVA 1LR7A 1TURA 3UEYA 2F3CI 2NU2I 2OVOA 2GKTI 2OD1A 1SGQI 1MT1A 1SGPI 4L9MA 2N52A 1M8CA 5CCLA 5JHWC 2LEOA 1CSOI 3OXLA 2P6AC 1OYVI 2BUSA 2QQDA 1M8BA 2ERWA 2QQ0A 5EX3A 1PTRA 4OVOA 1FARA 3OL0A 1BUSA 3OVOA 1DS3I 1SGYI 2L7XA 2NU1I 1KBFA 1R79A 1TBRR 3OXFA 5HQ8A 1IW4A 1N13A 2J9RA 3QTLD 1CT2I 2E5RA 5FUYA 2YUUA 1TUSA 3SGQI 2N1AB 2JYYA 2GKVA 1BMOA 1HPTA 2ORVA 3CXLA 2GVIA 1CT0I 2SGFI 3FC3A 5EX0A 1KMAA 2SGEI 1X4SA 1IY5A 1PTQA 1LR9A 1RFHA 1TIHA 1OVOA 3RU0A 1OMUA 1FYBA 1YU6C 1HDLA 1CT4I 2YQPA 2CJSC 1KBEA 5CCMA 2KMOA 3UGLA 3OXGA 1NUBA 3D00A 2ENNA 4UXIA 1Z7KB 2ROWA 2V53A 5FUXA 3GOXA 3UGIA 2KMRA 2WCYA 1CGJI 2XRCA 1PCEA 2E73A 2JZMA 3SEKC 1SGDI 2FNFX 1IY6A 2NU4I 2JA1A 2V1CA 4HGUA 2LUYA 2QPOA 3QWPA 1XA6A 4FKDA 1XX6A 4A24A 1UVGA 2UZ3A 1V1HA 3SGBI 1CGII 2DB6A 2QQCA 1PJUA 1FAQA 1H0ZA 2JXDA 1HJAI 2M5XA 4UXHA 2K9HA 2N17A 5DAEA 1Y1BA 1UUCA 1U5KA 1W3SA 1SGNI 2SGPI 3TJQA 1TOTA 4B6DA 3PDNA 2KMQA 2A20A 1XBTA 3E2IA 4UXJA 3E59A 2WVJA 2SGDI 2ARPF 2ODDA 2W0TA 2V1CC 1X74A 2ENZA 5HI7A 3UGDA 1LR8A 4E1PA 1DS2I 1Y1CA 1W4RA 2B8TA 2SGQI 3VDUA 1CHOI 3VDPA 2VRWB 3UFFA 3B4VC 1UVFA 2DIPA 1TBOA 2N71A 2JW6A 2ORWA 4JCVE 2L8EA 1AN1I 1R0RI 5FUWA 2QQEA 3BJIA 1TBQR 1Y8FA 3MEKA 2GKRI 3VE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KBE A;  2QQ0 A;  1PTR A;  4UXH A;  3UGL A;  1FAR A;  3KY9 A;  2ENN A;  4UXI A;  4B6D A;  2ROW A;  5FUX A;  3UGI A;  3UEJ A;  1KBF A;  1R79 A;  1XBT A;  2ELI A;  3E2I A;  4UXJ A;  1TBN A;  2J9R A;  2WVJ A;  3UGD A;  2J87 A;  5FUV A;  2ENZ A;  5FUY A;  2YUU A;  2E73 A;  2B8T A;  1W4R A;  3UEY A;  2FNF X;  2VRW B;  2JA1 A;  2ORV A;  3CXL A;  3UFF A;  1TBO A;  2GVI A;  2ORW A;  2QPO A;  1XA6 A;  4L9M A;  4FKD A;  1XX6 A;  2UZ3 A;  5FUW A;  1PTQ A;  1RFH A;  2QQE A;  3BJI A;  1Y8F A;  2DB6 A;  1FAQ A; 
#chains in the Genus database with same CATH topology
 3R5A A;  1SGR I;  4SGB I;  3TO7 A;  9WGA A;  2KCX A;  2B0U C;  3KY9 A;  4GI3 C;  1VDD A;  1PPF I;  4E1R A;  2KMP A;  1OMT A;  1YTP A;  3UEJ A;  1TGS I;  1P9Z A;  2ELI A;  1CE3 A;  1TBN A;  3HH2 C;  2NU0 I;  1SGE I;  2J87 A;  1UHA A;  1V1I A;  2NU3 I;  5FUV A;  1LR7 A;  1TUR A;  3UEY A;  2F3C I;  2NU2 I;  1WGC A;  1K7T A;  2OVO A;  2GKT I;  2OD1 A;  1SGQ I;  1MT1 A;  1SGP I;  4L9M A;  2N52 A;  1M8C A;  5CCL A;  4WP4 A;  5JHW C;  2LEO A;  1CSO I;  3OXL A;  2P6A C;  1OYV I;  2CWH A;  2BUS A;  2QQD A;  1M8B A;  2ERW A;  2QQ0 A;  5EX3 A;  1PTR A;  4AML A;  4OVO A;  1FAR A;  2X52 A;  3OL0 A;  1BUS A;  3OVO A;  1DS3 I;  1SGY I;  2L7X A;  2NU1 I;  3TOA A;  1KBF A;  1R79 A;  1TBR R;  2OU2 A;  3OXF A;  5HQ8 A;  1IW4 A;  1N13 A;  2J9R A;  3QTL D;  1CT2 I;  2E5R A;  2LB7 A;  2YUU A;  1TUS A;  5FUY A;  3SGQ I;  2N1A B;  2JYY A;  2GKV A;  1BMO A;  1HPT A;  2ORV A;  3CXL A;  2GVI A;  1CT0 I;  2RC4 A;  2SGF I;  3TOB A;  3FC3 A;  5EX0 A;  1KMA A;  2SGE I;  1X4S A;  2Y0M A;  3FSY A;  1IY5 A;  1PTQ A;  5E3R A;  1LR9 A;  1RFH A;  1TIH A;  1OVO A;  3RU0 A;  1OMU A;  1ULM A;  1NXU A;  3UOE A;  1FYB A;  1K7U A;  1YU6 C;  1HDL A;  1CT4 I;  2YQP A;  2CJS C;  1KBE A;  5CCM A;  2KMO A;  2GIV A;  3OXG A;  3R5C A;  1WTJ A;  3UGL A;  1NUB A;  3D00 A;  2ENN A;  4UXI A;  1ULK A;  1MJB A;  1Z7K B;  4DNC A;  2ROW A;  2V53 A;  5FUX A;  3GOX A;  3UGI A;  2KMR A;  1ULN A;  2WCY A;  1CGJ I;  2XRC A;  5E3P A;  2CWG A;  1PCE A;  1Z2I A;  2E73 A;  1MJA A;  2JZM A;  3SEK C;  1SGD I;  2FNF X;  2OZU A;  1IY6 A;  2NU4 I;  2JA1 A;  2V1C A;  4HGU A;  2DKV A;  2LUY A;  2QPO A;  3QWP A;  1XA6 A;  2CWF A;  4FKD A;  1XX6 A;  4A24 A;  1UVG A;  2UZ3 A;  1V1H A;  1K7V A;  3R5B A;  3SGB I;  1FY7 A;  7WGA A;  1CGI I;  2DB6 A;  3R5D A;  2QQC A;  1PJU A;  1P9G A;  3TO9 A;  1FAQ A;  1H0Z A;  1Q9B A;  1WGT A;  2PQ8 A;  2JXD A;  1HJA I;  2M5X A;  4UXH A;  2K9H A;  2N17 A;  3FSX A;  5DAE A;  1Y1B A;  5J8F A;  1UUC A;  1U5K A;  1W3S A;  1SGN I;  2SGP I;  2WGC A;  1TOT A;  3TJQ A;  4B6D A;  3PDN A;  2KMQ A;  2A20 A;  1S20 A;  1XBT A;  2UVO A;  3E2I A;  5E3Q A;  4UXJ A;  3E59 A;  2WVJ A;  2SGD I;  2ARP F;  2ODD A;  2W0T A;  2V1C C;  1X74 A;  2ENZ A;  5HI7 A;  3UGD A;  1LR8 A;  4E1P A;  1DS2 I;  3TO6 A;  1Y1C A;  1W4R A;  2B8T A;  2SGQ I;  3VDU A;  1CHO I;  3VDP A;  2VRW B;  3UFF A;  3B4V C;  1UVF A;  2DIP A;  1TBO A;  2N71 A;  1MJ9 A;  2JW6 A;  2ORW A;  2RIJ A;  2X3T A;  3QAH A;  4JCV E;  4MPI A;  2L8E A;  1AN1 I;  1R0R I;  5FUW A;  2QQE A;  3BJI A;  5J8C A;  1TBQ R;  1Y8F A;  3MEK A;  2GKR I;  1WKX A;  3VE5 A;  1HEV A; 
#chains in the Genus database with same CATH homology
 1SGR I;  4SGB I;  2KCX A;  2B0U C;  3KY9 A;  4GI3 C;  1VDD A;  1PPF I;  4E1R A;  2KMP A;  1OMT A;  1YTP A;  3UEJ A;  1TGS I;  2ELI A;  1CE3 A;  1TBN A;  3HH2 C;  2NU0 I;  1SGE I;  2J87 A;  1V1I A;  2NU3 I;  5FUV A;  1LR7 A;  1TUR A;  3UEY A;  2F3C I;  2NU2 I;  2OVO A;  2GKT I;  2OD1 A;  1SGQ I;  1MT1 A;  1SGP I;  4L9M A;  2N52 A;  1M8C A;  5CCL A;  5JHW C;  2LEO A;  1CSO I;  3OXL A;  2P6A C;  1OYV I;  2BUS A;  2QQD A;  1M8B A;  2ERW A;  2QQ0 A;  5EX3 A;  1PTR A;  4OVO A;  1FAR A;  3OL0 A;  1BUS A;  3OVO A;  1DS3 I;  1SGY I;  2L7X A;  2NU1 I;  1KBF A;  1R79 A;  1TBR R;  3OXF A;  5HQ8 A;  1IW4 A;  1N13 A;  2J9R A;  3QTL D;  1CT2 I;  2E5R A;  5FUY A;  2YUU A;  1TUS A;  3SGQ I;  2N1A B;  2JYY A;  2GKV A;  1BMO A;  1HPT A;  2ORV A;  3CXL A;  2GVI A;  1CT0 I;  2SGF I;  3FC3 A;  5EX0 A;  1KMA A;  2SGE I;  1X4S A;  1IY5 A;  1PTQ A;  1LR9 A;  1RFH A;  1TIH A;  1OVO A;  3RU0 A;  1OMU A;  1FYB A;  1YU6 C;  1HDL A;  1CT4 I;  2YQP A;  2CJS C;  1KBE A;  5CCM A;  2KMO A;  3UGL A;  3OXG A;  1NUB A;  3D00 A;  2ENN A;  4UXI A;  1Z7K B;  2ROW A;  2V53 A;  5FUX A;  3GOX A;  3UGI A;  2KMR A;  2WCY A;  1CGJ I;  2XRC A;  1PCE A;  2E73 A;  2JZM A;  3SEK C;  1SGD I;  2FNF X;  1IY6 A;  2NU4 I;  2JA1 A;  2V1C A;  4HGU A;  2LUY A;  2QPO A;  3QWP A;  1XA6 A;  4FKD A;  1XX6 A;  4A24 A;  1UVG A;  2UZ3 A;  1V1H A;  3SGB I;  1CGI I;  2DB6 A;  2QQC A;  1PJU A;  1FAQ A;  1H0Z A;  2JXD A;  1HJA I;  2M5X A;  4UXH A;  2K9H A;  2N17 A;  5DAE A;  1Y1B A;  1UUC A;  1U5K A;  1W3S A;  1SGN I;  2SGP I;  3TJQ A;  1TOT A;  4B6D A;  3PDN A;  2KMQ A;  2A20 A;  1XBT A;  3E2I A;  4UXJ A;  3E59 A;  2WVJ A;  2SGD I;  2ARP F;  2ODD A;  2W0T A;  2V1C C;  1X74 A;  2ENZ A;  5HI7 A;  3UGD A;  1LR8 A;  4E1P A;  1DS2 I;  1Y1C A;  1W4R A;  2B8T A;  2SGQ I;  3VDU A;  1CHO I;  3VDP A;  2VRW B;  3UFF A;  3B4V C;  1UVF A;  2DIP A;  1TBO A;  2N71 A;  2JW6 A;  2ORW A;  4JCV E;  2L8E A;  1AN1 I;  1R0R I;  5FUW A;  2QQE A;  3BJI A;  1TBQ R;  1Y8F A;  3MEK A;  2GKR I;  3VE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...