1PTQA

Protein kinase c delta cys2 domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
50
structure length
50
Chain Sequence
HRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN KINASE C DELTA TYPE
publication title Crystal structure of the cys2 activator-binding domain of protein kinase C delta in complex with phorbol ester.
pubmed doi rcsb
source organism Mus musculus
molecule tags Phosphotransferase
total genus 10
structure length 50
sequence length 50
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1995-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1ptqA00
1KBEA 2ROWA 2DB6A 2WVJA 1FAQA 1KBFA 2QQ0A 1XBTA 3E2IA 3UEYA 3UGLA 2ORVA 3BJIA 3UEJA 5FUWA 1Y8FA 1XA6A 3KY9A 3UFFA 2QQEA 2J87A 2GVIA 1RFHA 1TBOA 2E73A 4FKDA 5FUVA 2B8TA 3UGIA 3UGDA 5FUYA 2JA1A 2ORWA 1TBNA 2YUUA 1W4RA 4B6DA 2QPOA 4L9MA 2ENNA 1XX6A 3CXLA 2ENZA 4UXJA 4UXIA 2ELIA 4UXHA 2J9RA 2FNFX 5FUXA 1PTRA 2VRWB 1R79A 2UZ3A 1PTQA 1FARA
chains in the Genus database with same CATH superfamily
1KBEA 4A24A 2SGQI 1ULKA 2WVJA 1X74A 1IY6A 1K7TA 1UVFA 2WCYA 1W3SA 3OXLA 3OXGA 1WGTA 2QQDA 2RC4A 3R5DA 2L7XA 1BUSA 2N1AB 3UEYA 2JZMA 1CSOI 2JW6A 1K7VA 5FUWA 3TOAA 1SGQI 2GKRI 4JCVE 3TO7A 1TBRR 1UVGA 1MT1A 1TBOA 1LR8A 4FKDA 4OVOA 1MJBA 4SGBI 1VDDA 2F3CI 4GI3C 1TBNA 4B6DA 2X3TA 3FSYA 1Y1BA 2L8EA 1XX6A 2ENNA 2YQPA 3CXLA 3HH2C 4UXJA 5JHWC 4UXHA 2W0TA 1CT0I 5E3QA 3VDUA 5FUXA 1OVOA 2KMPA 3R5CA 1X4SA 2VRWB 3E59A 1OMTA 1CHOI 1FARA 2NU3I 2NU0I 1DS2I 2KMRA 2XRCA 3SGQI 1ULMA 1KBFA 1N13A 1FYBA 2A20A 2SGDI 3QAHA 1IW4A 1HJAI 2NU4I 2NU2I 3BJIA 3UEJA 1TURA 3KY9A 1XA6A 3MEKA 3UFFA 2LEOA 2ODDA 2QQEA 7WGAA 1SGDI 2J87A 2UVOA 2X52A 3QTLD 3OVOA 2E73A 3R5AA 5FUVA 1OYVI 2B8TA 3TOBA 3UGDA 2GIVA 2JA1A 1NXUA 1WGCA 2ORWA 2YUUA 1H0ZA 1TUSA 1MJ9A 4L9MA 1U5KA 1M8CA 5CCMA 2FNFX 2WGCA 1LR7A 1PCEA 2LB7A 1CE3A 2GKVA 2V1CA 1R79A 3R5BA 1V1IA 1V1HA 2SGFI 4AMLA 3OXFA 5E3PA 2V1CC 4HGUA 2M5XA 3UOEA 2NU1I 1S20A 2CJSC 1R0RI 2QQCA 1KMAA 4WP4A 5CCLA 5J8FA 3FSXA 2N17A 1SGPI 1TIHA 1UHAA 1Y8FA 5EX3A 1LR9A 2B0UC 1WKXA 5EX0A 2JYYA 4E1PA 1Y1CA 2KMOA 1YU6C 5J8CA 3PDNA 1HPTA 3VDPA 1RFHA 2OU2A 3QWPA 3UGIA 4E1RA 1Q9BA 3FC3A 1UUCA 1W4RA 2SGEI 1HEVA 1CGII 2ELIA 1HDLA 3TO6A 5E3RA 2ARPF 2JXDA 2OD1A 2SGPI 3TO9A 5HQ8A 3SGBI 1P9GA 1CT2I 2UZ3A 1CGJI 2ROWA 1ULNA 2DB6A 1YTPA 1FAQA 2N71A 2LUYA 1K7UA 4MPIA 2OZUA 2QQ0A 1SGRI 1XBTA 2KCXA 3E2IA 3UGLA 2P6AC 2ORVA 3RU0A 2CWFA 2N52A 1Z7KB 2Y0MA 3TJQA 1TOTA 4DNCA 5DAEA 1IY5A 1M8BA 1DS3I 2GVIA 2RIJA 2BUSA 5FUYA 1Z2IA 1FY7A 1BMOA 1PPFI 1SGEI 2DIPA 2K9HA 2ERWA 2PQ8A 2V53A 1PJUA 2QPOA 1P9ZA 5HI7A 3VE5A 3GOXA 2ENZA 1SGYI 4UXIA 2KMQA 3SEKC 1OMUA 2GKTI 1CT4I 1TGSI 2J9RA 3B4VC 3OL0A 1WTJA 2CWGA 1SGNI 1AN1I 1NUBA 2DKVA 2CWHA 1PTRA 2E5RA 2OVOA 1TBQR 3D00A 9WGAA 1MJAA 1PTQA
chains in the Genus database with same CATH topology
1KBEA 4A24A 2SGQI 2WVJA 1X74A 1IY6A 1UVFA 2WCYA 1W3SA 3OXLA 3OXGA 2QQDA 1BUSA 2L7XA 2N1AB 3UEYA 2JZMA 1CSOI 2JW6A 5FUWA 1SGQI 2GKRI 4JCVE 1TBRR 1UVGA 1MT1A 1TBOA 1LR8A 4FKDA 4OVOA 4SGBI 1VDDA 2F3CI 4GI3C 1TBNA 4B6DA 1Y1BA 2L8EA 1XX6A 2ENNA 2YQPA 3CXLA 3HH2C 4UXJA 5JHWC 4UXHA 2W0TA 1CT0I 3VDUA 5FUXA 1OVOA 2KMPA 1X4SA 2VRWB 3E59A 1OMTA 1CHOI 1FARA 2NU3I 2NU0I 1DS2I 2KMRA 2XRCA 3SGQI 1KBFA 1N13A 1FYBA 2A20A 2SGDI 1IW4A 1HJAI 2NU4I 2NU2I 3BJIA 3UEJA 1TURA 3KY9A 1XA6A 3MEKA 3UFFA 2LEOA 2ODDA 2QQEA 1SGDI 2J87A 3QTLD 3OVOA 2E73A 5FUVA 1OYVI 2B8TA 3UGDA 2JA1A 2ORWA 2YUUA 1H0ZA 1TUSA 4L9MA 1U5KA 1M8CA 5CCMA 2FNFX 1LR7A 1PCEA 1CE3A 2GKVA 2V1CA 1R79A 1V1IA 1V1HA 2SGFI 3OXFA 2V1CC 4HGUA 2M5XA 2NU1I 2CJSC 1R0RI 2QQCA 1KMAA 5CCLA 2N17A 1SGPI 1TIHA 1Y8FA 5EX3A 1LR9A 2B0UC 5EX0A 4E1PA 2JYYA 1Y1CA 2KMOA 3PDNA 1HPTA 3VDPA 1RFHA 3QWPA 3UGIA 4E1RA 3FC3A 1UUCA 1W4RA 2SGEI 1CGII 2ELIA 1HDLA 2ARPF 2JXDA 2OD1A 2SGPI 5HQ8A 3SGBI 1CT2I 2UZ3A 1CGJI 2ROWA 2DB6A 1YTPA 1FAQA 2N71A 2LUYA 2QQ0A 1SGRI 1XBTA 2KCXA 3E2IA 3UGLA 2P6AC 2ORVA 3RU0A 2N52A 3TJQA 1Z7KB 1TOTA 5DAEA 1IY5A 1M8BA 1DS3I 2GVIA 2BUSA 5FUYA 1BMOA 1PPFI 1SGEI 2DIPA 2K9HA 2ERWA 3VE5A 2V53A 1PJUA 2QPOA 5HI7A 3GOXA 2ENZA 1SGYI 4UXIA 2KMQA 3SEKC 1OMUA 2GKTI 1CT4I 1TGSI 2J9RA 3B4VC 3OL0A 2E5RA 2OVOA 1SGNI 1AN1I 1NUBA 3D00A 1PTRA 1TBQR 1YU6C 1PTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KBE A;  2ROW A;  2DB6 A;  2WVJ A;  1FAQ A;  1KBF A;  2QQ0 A;  1XBT A;  3E2I A;  3UEY A;  3UGL A;  2ORV A;  3BJI A;  3UEJ A;  5FUW A;  1Y8F A;  1XA6 A;  3KY9 A;  3UFF A;  2QQE A;  2J87 A;  2GVI A;  1RFH A;  1TBO A;  2E73 A;  4FKD A;  5FUV A;  2B8T A;  3UGI A;  3UGD A;  5FUY A;  2JA1 A;  2ORW A;  1TBN A;  2YUU A;  1W4R A;  4B6D A;  2QPO A;  4L9M A;  2ENN A;  1XX6 A;  3CXL A;  2ENZ A;  4UXJ A;  4UXI A;  2ELI A;  4UXH A;  2J9R A;  2FNF X;  5FUX A;  1PTR A;  2VRW B;  1R79 A;  2UZ3 A;  1PTQ A;  1FAR A; 
#chains in the Genus database with same CATH topology
 1KBE A;  4A24 A;  2SGQ I;  1ULK A;  2WVJ A;  1X74 A;  1IY6 A;  1K7T A;  1UVF A;  2WCY A;  1W3S A;  3OXL A;  3OXG A;  1WGT A;  2QQD A;  2RC4 A;  3R5D A;  2L7X A;  1BUS A;  2N1A B;  3UEY A;  2JZM A;  1CSO I;  2JW6 A;  1K7V A;  5FUW A;  3TOA A;  1SGQ I;  2GKR I;  4JCV E;  3TO7 A;  1TBR R;  1UVG A;  1MT1 A;  1TBO A;  1LR8 A;  4FKD A;  4OVO A;  1MJB A;  4SGB I;  1VDD A;  2F3C I;  4GI3 C;  1TBN A;  4B6D A;  2X3T A;  3FSY A;  1Y1B A;  2L8E A;  1XX6 A;  2ENN A;  2YQP A;  3CXL A;  3HH2 C;  4UXJ A;  5JHW C;  4UXH A;  2W0T A;  1CT0 I;  5E3Q A;  3VDU A;  5FUX A;  1OVO A;  2KMP A;  3R5C A;  1X4S A;  2VRW B;  3E59 A;  1OMT A;  1CHO I;  1FAR A;  2NU3 I;  2NU0 I;  1DS2 I;  2KMR A;  2XRC A;  3SGQ I;  1ULM A;  1KBF A;  1N13 A;  1FYB A;  2A20 A;  2SGD I;  3QAH A;  1IW4 A;  1HJA I;  2NU4 I;  2NU2 I;  3BJI A;  3UEJ A;  1TUR A;  3KY9 A;  1XA6 A;  3MEK A;  3UFF A;  2LEO A;  2ODD A;  2QQE A;  7WGA A;  1SGD I;  2J87 A;  2UVO A;  2X52 A;  3QTL D;  3OVO A;  2E73 A;  3R5A A;  5FUV A;  1OYV I;  2B8T A;  3TOB A;  3UGD A;  2GIV A;  2JA1 A;  1NXU A;  1WGC A;  2ORW A;  2YUU A;  1H0Z A;  1TUS A;  1MJ9 A;  4L9M A;  1U5K A;  1M8C A;  5CCM A;  2FNF X;  2WGC A;  1LR7 A;  1PCE A;  2LB7 A;  1CE3 A;  2GKV A;  2V1C A;  1R79 A;  3R5B A;  1V1I A;  1V1H A;  2SGF I;  4AML A;  3OXF A;  5E3P A;  2V1C C;  4HGU A;  2M5X A;  3UOE A;  2NU1 I;  1S20 A;  2CJS C;  1R0R I;  2QQC A;  1KMA A;  4WP4 A;  5CCL A;  5J8F A;  3FSX A;  2N17 A;  1SGP I;  1TIH A;  1UHA A;  1Y8F A;  5EX3 A;  1LR9 A;  2B0U C;  1WKX A;  5EX0 A;  2JYY A;  4E1P A;  1Y1C A;  2KMO A;  1YU6 C;  5J8C A;  3PDN A;  1HPT A;  3VDP A;  1RFH A;  2OU2 A;  3QWP A;  3UGI A;  4E1R A;  1Q9B A;  3FC3 A;  1UUC A;  1W4R A;  2SGE I;  1HEV A;  1CGI I;  2ELI A;  1HDL A;  3TO6 A;  5E3R A;  2ARP F;  2JXD A;  2OD1 A;  2SGP I;  3TO9 A;  5HQ8 A;  3SGB I;  1P9G A;  1CT2 I;  2UZ3 A;  1CGJ I;  2ROW A;  1ULN A;  2DB6 A;  1YTP A;  1FAQ A;  2N71 A;  2LUY A;  1K7U A;  4MPI A;  2OZU A;  2QQ0 A;  1SGR I;  1XBT A;  2KCX A;  3E2I A;  3UGL A;  2P6A C;  2ORV A;  3RU0 A;  2CWF A;  2N52 A;  1Z7K B;  2Y0M A;  3TJQ A;  1TOT A;  4DNC A;  5DAE A;  1IY5 A;  1M8B A;  1DS3 I;  2GVI A;  2RIJ A;  2BUS A;  5FUY A;  1Z2I A;  1FY7 A;  1BMO A;  1PPF I;  1SGE I;  2DIP A;  2K9H A;  2ERW A;  2PQ8 A;  2V53 A;  1PJU A;  2QPO A;  1P9Z A;  5HI7 A;  3VE5 A;  3GOX A;  2ENZ A;  1SGY I;  4UXI A;  2KMQ A;  3SEK C;  1OMU A;  2GKT I;  1CT4 I;  1TGS I;  2J9R A;  3B4V C;  3OL0 A;  1WTJ A;  2CWG A;  1SGN I;  1AN1 I;  1NUB A;  2DKV A;  2CWH A;  1PTR A;  2E5R A;  2OVO A;  1TBQ R;  3D00 A;  9WGA A;  1MJA A;  1PTQ A; 
#chains in the Genus database with same CATH homology
 1KBE A;  4A24 A;  2SGQ I;  2WVJ A;  1X74 A;  1IY6 A;  1UVF A;  2WCY A;  1W3S A;  3OXL A;  3OXG A;  2QQD A;  1BUS A;  2L7X A;  2N1A B;  3UEY A;  2JZM A;  1CSO I;  2JW6 A;  5FUW A;  1SGQ I;  2GKR I;  4JCV E;  1TBR R;  1UVG A;  1MT1 A;  1TBO A;  1LR8 A;  4FKD A;  4OVO A;  4SGB I;  1VDD A;  2F3C I;  4GI3 C;  1TBN A;  4B6D A;  1Y1B A;  2L8E A;  1XX6 A;  2ENN A;  2YQP A;  3CXL A;  3HH2 C;  4UXJ A;  5JHW C;  4UXH A;  2W0T A;  1CT0 I;  3VDU A;  5FUX A;  1OVO A;  2KMP A;  1X4S A;  2VRW B;  3E59 A;  1OMT A;  1CHO I;  1FAR A;  2NU3 I;  2NU0 I;  1DS2 I;  2KMR A;  2XRC A;  3SGQ I;  1KBF A;  1N13 A;  1FYB A;  2A20 A;  2SGD I;  1IW4 A;  1HJA I;  2NU4 I;  2NU2 I;  3BJI A;  3UEJ A;  1TUR A;  3KY9 A;  1XA6 A;  3MEK A;  3UFF A;  2LEO A;  2ODD A;  2QQE A;  1SGD I;  2J87 A;  3QTL D;  3OVO A;  2E73 A;  5FUV A;  1OYV I;  2B8T A;  3UGD A;  2JA1 A;  2ORW A;  2YUU A;  1H0Z A;  1TUS A;  4L9M A;  1U5K A;  1M8C A;  5CCM A;  2FNF X;  1LR7 A;  1PCE A;  1CE3 A;  2GKV A;  2V1C A;  1R79 A;  1V1I A;  1V1H A;  2SGF I;  3OXF A;  2V1C C;  4HGU A;  2M5X A;  2NU1 I;  2CJS C;  1R0R I;  2QQC A;  1KMA A;  5CCL A;  2N17 A;  1SGP I;  1TIH A;  1Y8F A;  5EX3 A;  1LR9 A;  2B0U C;  5EX0 A;  4E1P A;  2JYY A;  1Y1C A;  2KMO A;  3PDN A;  1HPT A;  3VDP A;  1RFH A;  3QWP A;  3UGI A;  4E1R A;  3FC3 A;  1UUC A;  1W4R A;  2SGE I;  1CGI I;  2ELI A;  1HDL A;  2ARP F;  2JXD A;  2OD1 A;  2SGP I;  5HQ8 A;  3SGB I;  1CT2 I;  2UZ3 A;  1CGJ I;  2ROW A;  2DB6 A;  1YTP A;  1FAQ A;  2N71 A;  2LUY A;  2QQ0 A;  1SGR I;  1XBT A;  2KCX A;  3E2I A;  3UGL A;  2P6A C;  2ORV A;  3RU0 A;  2N52 A;  3TJQ A;  1Z7K B;  1TOT A;  5DAE A;  1IY5 A;  1M8B A;  1DS3 I;  2GVI A;  2BUS A;  5FUY A;  1BMO A;  1PPF I;  1SGE I;  2DIP A;  2K9H A;  2ERW A;  3VE5 A;  2V53 A;  1PJU A;  2QPO A;  5HI7 A;  3GOX A;  2ENZ A;  1SGY I;  4UXI A;  2KMQ A;  3SEK C;  1OMU A;  2GKT I;  1CT4 I;  1TGS I;  2J9R A;  3B4V C;  3OL0 A;  2E5R A;  2OVO A;  1SGN I;  1AN1 I;  1NUB A;  3D00 A;  1PTR A;  1TBQ R;  1YU6 C;  1PTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...