2QPOA

Thermotoga maritima thymidine kinase in the apo form
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
180
structure length
153
Chain Sequence
SGKLTVITGPMYSGKTTELLSFVEIYKLGKKKVAVFKPAHVIERPEEMRKYIEEDTRGVFIDEVQFFNPSLFEVVKDLLDRGIDVFCAGLDLTHKQNPFETTALLLSLADTVIKKKAVCHRCGEYNATLTLKVAGGEEEKYIAVCRDCYNTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quaternary structure change as a mechanism for the regulation of thymidine kinase 1-like enzymes.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Thymidine kinase
total genus 45
structure length 153
sequence length 180
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2007-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2qpoA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qpoA01
5FTMA 1CRPA 4EAQA 1OPXA 4Y0AA 4RCZA 5KNBA 4B76A 4XOIA 5CJ2A 4BRUA 1G3IA 4TLBA 1M8PA 2RGNA 2OXCA 2I4IA 3KY9A 3NDPA 3SDZA 4B32A 3U4QB 3VR1A 4Q1CA 3PEWA 1KZGB 2V1XA 2WWHA 1TF5A 4FIDA 3MLEA 3VU9B 2XOKA 1PUIA 4MUBA 1KO8A 1T5LA 1Y3AA 4RFVA 2IYSA 2R62A 3KXIA 1LW7A 8OHMA 2FE4A 2IS4A 2YZ2A 2QTVB 4CVNA 1KDRA 1OFHA 5AR1A 1B23P 1P73A 1XU4A 2GZAA 1II0A 1Q57A 2HV8A 2VH5R 4UNQA 4BLPA 4EQ6B 4V0MA 4FCTA 5C1BA 1DPFA 4QRHA 4GRAA 4TQAA 3UFFA 1O3YA 4TMXA 2AK3A 5LDDC 2YKGA 2LKDA 2F1RA 1IQPA 1E94E 1E9AA 1KNXA 5C4MA 4DDVA 1G17A 2C77A 1OLOA 3BGWA 3CPJB 3RS7A 2RGEA 1IN8A 1R5OA 1G9XA 4L9WA 2BWJA 3LVQE 4HDOB 4I1OA 1HV8A 1RJ9B 1P9WA 4LC1A 5KNDA 4PHGA 2CXXA 3U60B 2NGRA 2Q3MA 2XEXA 1W36B 1OFIA 1GM5A 1P2SA 3BERA 5JMTA 5DN6A 1L7VC 4JKYA 3KKMA 5CJPA 4CF7A 1BMFD 4JSTA 1NRJB 4QJ5A 3A4NA 3VMFA 3GJ4A 3GLIE 1QHNA 2ZJOA 3TIFA 4L9MA 1D2NA 5CITA 3NG1A 4XH9B 1NVWQ 2A3RA 2VYFA 4NMMA 1CRQA 2WOJA 2N46A 3R7WA 3L0OA 1VCOA 2JASA 3LBIA 5FUWA 3DEFA 4PZLA 2QE7D 2BV3A 3T1OA 4M0LA 1UEIA 2GK7A 4LY6A 1X8LA 4US0R 2JLXA 1OB5A 4Q7JB 1XTRA 3DMDA 4ESVA 5H68A 2HXSA 4IDPA 1E1QA 4LZZA 2ZRHA 2GA8A 4E5UA 2AKYA 3FYHA 2OFXA 1Q22A 4ARZA 2HUPA 4AYWA 4EPVA 1NLYA 5FPTA 4ZIRA 2YWGA 3QY0A 2IYWA 3K9GA 1FQJA 5JBQA 3ZDQA 4OK6A 3O8RA 2V9PA 2CCKA 5FTJA 4DLVA 5D3MA 3ICEA 3OIVA 4QOSA 2QMHA 2XXAB 4TT3A 4A36A 4BUJA 4US2R 3UPUA 2B7BA 2ZI5A 3RSOA 2ORVA 3MUFA 5KSPA 5E7JA 4ZCMA 4QKQA 3B9PA 4HI0E 4DWJA 2IEYA 3KQHA 4FMDF 4GBMA 2IS1A 2CK3D 1I4LD 4KHZA 3K0EA 2QEQA 1KO7A 3R9WA 4TLDA 3R8CA 4UJ3A 2G1JA 4GFDA 5L3SA 5FBWB 3THWB 3L0PA 1XXHE 1RYFA 1G6OA 1XBTA 3ZIAA 4CW7A 3QQ5A 4LYHA 4URYR 1RZ3A 3BH0A 1D2MA 2J9RA 2QPTA 3C14C 4PQYA 3CR8A 3RWMB 3UIEA 1O87A 3U4QA 3ASYA 1XZQA 1P72A 3NBFA 4KLNA 4LDJA 3FGNA 3WYFA 4A6XA 3T06B 2AHOA 2IYXA 3H84A 4IDNA 1D5CA 2ODNA 2ZJAA 3D7MA 3FHCB 4AYTA 2ZI4A 1OXTA 1Q3TA 5DLQC 5EZ5A 4Q9KA 5H8WA 4KJZA 5KOYA 2KSQA 1KDPA 1OFUX 2BM0A 4Q01A 2Y8EA 4JVNA 4W5HA 5HE8A 3CH4B 2QGNA 3BFXA 2GXUA 5DYIA 1FP6A 2OAQ1 2DB3A 1CBUA 2ZSFA 1ZU4A 3GFPA 5CDFA 3IILA 4UXIA 2WPDA 4IW3B 2ZR0A 3CF2A 2ZR7A 4KITB 2F3TA 4D26A 1J99A 2GKSA 4M8NE 4WXPA 2ZU6A 3E5HA 1G3MA 3BFVA 2AN9A 2A9KA 3TQFA 3GJ0A 3ADKA 3CRMA 4YONB 3GLHE 4LYAA 2GNOA 2FGJA 4ACAA 4ASUA 2R6FA 1GL7A 1QHHB 4DLXA 2IL1A 3X1XA 2RGNC 2ZU0C 3GLGA 2AD5A 4D4JA 3DPUA 1T0HB 3AGPA 3CUEF 3OIWA 5L3RA 2VP6A 3PR1A 4PC6A 1MRSA 1ZIPA 3I8XA 4DLRA 3BRWD 4YMUA 4QBIA 1A7JA 2BDTA 2CJWB 3CRW1 4CEJA 1E9BA 1GWNA 5FPYA 1KI8A 3PUWA 4OKSA 3O8DA 4NYMR 4OHYA 2YINC 1TUIA 2FA9A 3CNLA 4R98A 3AVYA 3T35A 4RD2A 5FUXA 1KI2A 3BD9A 3KFVA 1DAMA 3VFDA 4CT5A 1U8ZA 3HPQA 2F1IA 1DAKA 2VSXA 3U3MA 4KFRA 3EIQA 4DCUA 1US8B 4G1UC 3T61A 1Q0UA 4D4LA 3DOEA 3LH5A 3A6PC 2YVUA 3GFOA 1OIWA 2QTFA 4BZQA 1TBOA 4QHTA 3A37A 2C9OA 2W0SA 4A0FA 1P2UA 1FL9A 5TY0A 4MH0R 4QG7A 3RRYA 2CMKA 2WOOA 1OXXK 3W9YA 4DLWA 1CP2A 2QT0A 5KPDA 4U7DA 3FMFA 1AM4D 5EUMA 2Z43A 4CEJB 1EFRD 4K46A 1AKEA 4AWXA 1E4VA 4BLTA 4D2IA 4NBSA 2WTUA 5GJCA 5F9FA 1R0XA 4P4TA 2Z0MA 4RD3A 1NMZA 4WXRA 4JYCA 2FZ4A 3UKDA 3A1SA 4DEXA 2F3RA 1FUUA 3GJ7A 2ROWA 4PAMA 4MDFA 3ZZ0A 2G77B 1SVOA 1AZSC 1RRPA 1QHHA 4LJ5A 4UNPA 4CDGA 3UG7A 4URXR 2ZS9A 3HDTA 5FTNA 1AN0A 1R0YA 2QTHA 4F4CA 1NBMD 3L0SA 3O8BA 1KKMA 1OYYA 4M53A 2QM8A 2AL7A 5FL7D 1Z07A 4KV9A 2FPMA 1HT2E 3QKUA 5GJWC 1RFHA 4JLKA 4LV6A 3THXB 1UDXA 2CJWA 1P60A 1AQUA 4FKDA 1T3SA 3TW4A 5JJLA 4BZPA 2G83A 4RCYA 2BHRA 2GCNA 1A5TA 2W6IA 1E2FA 3K0FA 4V0LA 4UNSA 3OAAD 1WF3A 4Q47A 3CXLA 2O0HA 4DSUA 3GLGB 1U0JA 5FL3A 2HLDD 4UNNA 1D2EA 1MO6A 1C9KA 1E1RA 3BS4A 5IK2D 1IAQA 2J5XA 4JBXA 4HLQB 1A1VA 3BXZA 4X8LA 2BM1A 5IF9A 5J4VA 2QG6A 3LY5A 4LSGA 1NY5A 1DAIA 4DDTA 2HCJB 2FSHA 1W44A 3QXXA 4HLDA 4WZAE 4LPSA 1W2HA 2GESA 2WVJA 2GVZC 6Q21A 1CJKC 5EXPA 2OUKA 1E2QA 2ZANA 2H5EA 3AF0A 2IS2A 5TVKA 2QPOA 1U0HC 1TQ4A 1XRJA 1AQYA 2ZRAA 3E70C 4L4UA 2YNMA 3KDSE 2BKEA 2OG2A 3L2OB 4C0JA 1GZSA 1KAOA 1QRAA 1VYTA 3KQLA 3LV8A 1ZU5A 4EDHA 4LUCA 1EFRA 2AWNA 1WXQA 3HR8A 5DGXA 3RRMA 3TVTA 2WSSA 3HP1A 5K8IA 1XF9A 4YDSA 1D8TA 2EFCB 1CR0A 1GSIA 3AKEA 5AUPB 4TMZA 3AVQA 2P0EA 4IJMA 5DSZA 1RRCA 2ODWA 5EP1A 5TV2A 1KK0A 1PZNA 1WP9A 3LBNA 3TUZC 1IOZA 2Z83A 1SVWA 3EZ2A 2FDCA 2QUZA 3B2EA 5JWHA 1OXSC 1ZBDA 3KKPA 4BQSA 2LKCA 1RE0A 2OAP1 1BYIA 1EFUA 2IHYA 1ZM9A 1E98A 2WWFA 1FNMA 1I4TD 3W34A 5EJEA 2IUUA 5HZHA 1PV4A 5GJBA 3A4LA 2VHCA 3I62A 3SQXA 2VBCA 4W5JA 2B92A 3NC0C 3CF0A 4ON9A 2BIFA 2DB6A 1OV4A 2RGAA 4C0AC 1EG7A 5KSYA 1R8QA 1OH8A 2J7PA 3F8TA 1ZC3A 2QN6A 1ELOA 3SEAA 4BFXA 5EE9A 2V8OA 5L3QA 4KYIB 3B1YA 4JL6A 4DJTA 2ONKA 4KVGA 3OZXA 2CHQA 1YZKA 4KFTA 4ZPXA 721PA 2AX4A 2K5UA 4Q4HB 3TQCA 3AVPA 1JPNA 1DARA 1U2RA 1CJVC 2CE2X 4HYYA 3RWOA 2O8CB 4NCIA 1NLFA 1KK3A 2GBLA 5BXQC 1GNPA 1LVGA 2P67A 4KLZA 2X1VA 1OKKD 3BB4A 1KO4A 1HE8B 2PLRA 2Q0HA 1UBCA 1P4SA 3GJ6A 4S2EA 2BBTA 1RJ9A 2FX3A 3I4LA 1FX0B 3FTQA 3VR3A 4Q21A 4BLRA 4DIEA 3EASA 5HKKA 5JHGB 2ZSAA 3PITA 4XVRA 2GXAA 2WAYA 2QL6A 2IYVA 4M21A 3PEYA 5FBVB 3R20A 1Z0JA 1OHHD 2FEOA 3G0HA 2PX3A 1XEXA 2WMOB 2ELIA 1NSTA 2NOAA 1TEVA 5LB2A 2O8BB 4M1OA 1IXRC 2JLVA 2E73A 1CLUA 2MMCA 1FOEB 3VKWA 1FFHA 1P62B 1VIAA 2H17A 4IFEA 1YZGA 4MA4A 4A82A 3CO5A 1Z29A 1NVVQ 5JRZA 4HZIA 4TL8A 4IOMA 2FU5C 1II8B 1KMHB 5K8LA 2P2LA 3UWOA 4B43A 4DCSA 1TQDA 4B2PA 5CYOA 5EP2A 4DCTA 2C99A 2ECKA 5JS7A 2EU8A 1R5BA 2Q9AA 4DUGD 3MG9A 4WBSA 1ETUA 1MABB 1SVSA 2G6BA 3MWYW 2GETA 5KDLA 3AM1A 1SHKA 3FKQA 4KI0A 1F3OA 1X3SA 3RC3A 3X1ZA 3BOSA 4DLSA 2ZAMA 5JRJA 1OH7A 2CEAA 2QZ4A 3FMIA 3PIRA 4HB3A 4I99A 4TMVA 1YZQA 5B58C 3B1XA 1MR3F 3IEVA 4D25A 2NO7A 2ZE5A 4RFSB 2C5LA 1W4AA 3KUDA 3THYA 1DBSA 1XPUA 5FPSA 4C9BA 3SBDA 2ZRBA 3KJGA 1YJ5A 3BAFA 4B3FX 2O8EA 2NQ2C 3GPLA 4PC1A 4PSAA 3IGFA 2JGNA 4PPFA 1SZPA 5CB8A 1R5NA 4QGFA 3MWJA 2QQEA 1IN5A 3WBJA 2QP4A 2CL0X 4DDWA 1DADA 4CIDA 4M9ZA 3KKNA 5FI1B 4LBWA 1Q3HA 2ZM5A 5H1YA 4PC3A 2O8DA 3F0TA 1F48A 1RFLA 2VF8A 5DI9A 4QM6A 2RHMA 1SGWA 1KAGA 1HTWA 5DISB 3FFAA 5D3QA 2PEYA 1XMJA 1XZPA 1RPZA 5IT5A 5KPJA 3U7FB 3ETLA 5BYKA 2FMXA 4MRNA 1YZTA 4MYHA 1Z0DA 1Z6XA 4URZR 3K53A 3QPVA 1P9RA 2LCFA 4NP6A 1XMIA 1NMYA 4LJ9A 1Z6GA 1F6BA 3UWKA 4IVQA 1NN5A 4OQFA 2BEJA 3ZZTA 3QG1A 4DB4A 2IS6A 2XTNA 3QPUA 3QF7A 3I61A 1EX7A 3GLHB 5F9HA 4QBHA 3X1YA 2X8AA 1BMFA 1E3MA 3OFNA 1KK2A 3I73A 1VECA 1E9DA 3ZZUA 4M1KA 3UG6A 4D80A 1JPJA 2ANBA 4BFVA 1G7CA 1GNRA 2HT6A 2D62A 5EXSA 3R9XA 4I81A 2V55B 1QHSA 1TQ6A 4TSFD 4B34A 3RYTC 1VIYA 3A8TA 2R65A 3UEJA 4LK2A 1E6CA 3RAPR 5IRCD 4LHXA 1LFDB 5FPHA 4GOJA 3CX6A 4OHZA 2GF9A 2OZEA 3OF5A 3AV0B 4AD8A 1W46A 2FSFA 4KODA 2KBFA 3UMRA 1JNYA 3NHAA 3ADBA 4O2LA 4WZBE 5BN5A 5H70A 3PXGA 5TMPA 1DTSA 2ZI3A 2BMFA 3NBXX 1VCIA 2HDNB 2R6AA 5EZ6B 5FOUA 2PLFA 4PZZA 2ZS7A 3DO6A 3L8YA 3CX8A 3PUZA 4JLOA 1GVNB 4MRPA 4B74A 3B7GA 1TL7C 4LJ8A 3N2EA 4NZYA 3L82B 1RC8A 2MMGA 2B21A 5JWRA 1ESNA 4Q1BA 4QC2A 1DAHA 1NF3A 1KHTA 3DVLA 1T91A 3VR2A 3CX7A 4GZLA 2JIZA 2CLSA 4GPTA 2JLWA 3BJIC 4F4JA 3QKTA 4TMWA 3R8FA 2ATXA 4IEIA 1GKIA 3GEIA 3PCRB 2C9YA 4A8JB 4OI1A 5GVSA 2IA5A 3CB4A 1JBKA 3QXJA 3ZS9A 2G9NA 3RHFA 3REFA 3T12A 2ZRIA 2D3WA 1E1RD 2A78A 4WA7A 4JT2A 1P61B 2W2VA 4XD7A 1LF0A 2FG5A 3ZQ6A 3PEUA 2VL7A 2I1VB 4P31A 4KO8A 3EIHA 4RD1A 2JLQA 1JEEA 1T8UA 3T1TA 4OQXA 4MUAA 4CRWB 3LQQA 1AA9A 4TYPA 3X2SA 2PMDA 2QAGC 3OEEA 1SXJA 3WNCA 1IY0A 2GXSA 2RMKA 1W36C 5J4YA 1E2NA 1EX6A 1GKYA 4W9MC 4X8MA 1FX0A 4TL6A 3C16C 2G0TA 5TDHA 3A58B 1NKSA 1ZYUA 3A1WA 5A0FA 1M7HA 1WCV1 4YXWD 4M1YA 4TZ6A 1FMJA 2TMKA 4PXAA 1ZM7A 4DRZA 1W49A 2DBYA 5DH9A 4BZXA 4B3XA 2OFWA 3RLFA 4DEYA 1T4GA 2QU8A 5CIQA 2O8BA 1Q21A 1DE0A 2GAAA 3EX7C 1W0JD 3ZIAD 4E03A 4B75A 5LD2B 2VPPA 1KBEA 3IIJA 1UDWA 1N6OA 1J70A 1G8PA 4DLYA 1G6HA 4GT1A 2YWHA 3CRRA 2HYDA 5FOTA 3RANA 2PT7A 5JCPA 1W4RA 1U8AA 4HDQB 5L3QB 1U99A 5F98A 3QOFA 5EXTA 2EQBA 5EE5B 5KUTA 3NDBB 3A1UA 3V4RA 3KJEA 1EK0A 1XD2B 4JS0A 5FPKA 2OLJA 3OHMA 4B2IA 3D3QA 2JEOA 3AP3A 1OT3A 3B13B 2ASEA 3MWKA 4TQUS 3VAAA 2NTYC 4G5QA 1G7RA 1KI6B 1OXVA 2C04A 5FFMA 2VP2A 1IM2A 1GRQA 3VR4A 3I8SA 1FQKA 1R7RA 3EZ6A 1ZINA 2C2HA 1KY2A 4FXPA 4Q7LA 4FWTA 2JLYA 2IK8A 4Q7MB 3WP0A 2IXGA 1CJUC 4BFSA 2QY9A 2ZJ2A 2AK2A 2HYIC 1A82A 1RYHA 3U44B 2EW1A 2Z5FA 1C4OA 1LF5A 1KDOA 3IPYA 1H8HA 1G5TA 3UGLA 1XMVA 5FUVA 3TSZA 4HLUC 1SXJE 4FD2A 3NEJA 1VCNA 2R6GA 3NVAA 2ZUBA 3AF2A 3K0CA 2YC4C 4MGIR 2D7DA 1C1YA 1AS3A 2IF2A 2QENA 1S3GA 5AJWA 5CK4A 4M1MA 1ZVQA 2WBLC 3IHLA 4XTRA 1F60A 1ESMA 4N0DA 2ZSBA 1JI0A 2ZUCA 1EWRA 3A4MA 4MYUA 1E2GA 4DHEA 3ADCA 3QG5A 4A8JA 2OV2A 3QSYA 2W00A 2CVFA 3B60A 3S1AB 1W0KA 2A30A 4GP6A 4JKIA 1N5LA 5KYKA 4HAYA 4PZYA 2PL3A 4QJ4A 4QNMA 2ZXUA 2WPDD 2Z4SA 4Q1EA 3SBEA 3GJ3A 4MKIA 1KK1A 4W5WA 4RD4A 5G40A 5J47A 3WNBA 4NYMQ 2RGXA 1DG1G 4PC2A 3BJIA 3K0FB 4RY2A 1EFHA 3V9PA 1JJVA 1XCMA 4D0GA 4CEIB 3VR5A 3THOA 2YJTD 2XSZA 1MO5A 4EFMA 1KSHA 2ZI7A 2B8WA 2GF0A 3UXMA 2Z6VA 4GOKA 5HKKD 5J4KA 2AKAB 1X8KA 4JL8A 3AB3A 3P27A 1GILA 3SFZA 4A0RA 2W0MA 1U0LA 2ZROA 1NI3A 2D7CA 1F2UA 2C8VA 2OT3B 3EW9A 2D4HA 3KKOA 2WKPA 4AYXA 3ECCA 1NJFA 4TZ0A 3CLVA 4RSGA 1NN1A 3IO3A 2ZRGA 4IVPA 5J4LA 3H2YA 2R6DA 2ZIAA 3DM9B 2V54A 4Q1AA 3RS2A 4PHHA 1M7GA 2JIZD 2CK3A 1NN3A 1XXHA 2GCOA 1Z63A 4P32A 4Q66C 4IOLA 2PZGA 3LDAA 2ZE6A 2JA1A 2OILA 3I5XA 2XGJA 4TLEA 3VX3A 4L15A 2DWOA 2QA5A 3DKPA 3LAWA 2JDIA 2E1RA 1QZXA 3KKQA 2ZRMA 4HUTA 1JALA 1S96A 3B8HA 4B47A 2X2EA 1TADA 4TT3D 2NG1A 5M04A 2W2TA 2QSZA 2VP4A 3EA5A 1G4AE 1XXHB 3TNFA 5E7MA 4MITA 2OFOA 2DFKB 2QT1A 4F93B 3LW7A 1NNEA 2HCBA 4BLQA 4W7SA 3IQXA 1IXZA 3F5FA 1T9HA 3TVDA 1E9SA 4D82A 3KXKA 1M34E 4LJYA 1XFAA 2BVNA 3E2IA 1KGDA 1CKEA 4IDQA 1N6HA 4OQNA 1UBFA 5HE9A 2VHJA 3K70B 3DHWC 5LB4A 3ZYCA 1XEFA 4A2QA 2RGBA 1IN7A 2VSOA 3CPEA 2A5GA 4OHXA 3I1FA 3HU1A 3AKYA 2VSFA 1U9IA 3TGPA 1KOFA 2JJ1A 4KXFB 3AF1A 2R9VA 4IFBA 1YVDA 3SU8A 2JCSA 3FDIA 1HA3A 4TLAA 2O8FB 3DM5A 1Z22A 1XEWX 2ZJYA 1EXMA 5AUOB 1E99A 1GFIA 1S4QA 1P2VA 2YOFA 3CRVA 4H9GA 1RKBA 4EIWA 4RZ3A 4RD6A 1TF7A 4JLNA 4LOAA 2RB4A 1YZLA 1F2UB 2ZJ8A 3CPHA 4L8GA 4O25A 4LHWA 4MGYR 1EFCA 4MGZR 5IK2A 1N0WA 3AKDA 4M9QA 1NIPA 3OEED 3UMSA 2AFIE 2REBA 2X19A 2IT1A 2WZQA 5LBIA 1E2JA 4Y0VA 4EPYA 4JT4A 2GCPA 4DXAA 3OEHA 3ZJYA 1KJYA 2CNWA 5BN4A 4B35A 4G5RA 3F3YA 4PSVA 1R10A 4ACBA 1UADA 3ND9A 2QBYA 2PZFA 4AURA 1DO2A 3CZQA 3QENA 1SKYB 5J5CA 2XNDD 4XWAA 5JECA 1W4BA 2OSBA 4NDZA 5JSZA 1JQJC 1LS6A 5TXGA 4BASA 3W90A 2WIBA 2FSIA 1MRNA 4TTQA 2HT1A 4EFLA 3CKLA 2WHXA 1XTJA 3SYLA 1E9RA 3U7HB 4Z51A 1IY1A 1Y8FA 3B85A 3LRPA 4K8OA 4U00A 3GQBA 3P32A 1TPZA 3K70C 1CR2A 3CW2A 2VIIA 4E22A 1RW4A 1H8EA 4IDOA 1Y63A 4HATA 5FOWA 2CHVA 4YLGA 1CS4C 1II9A 5J4HA 5LPNA 2DWQA 3HJNA 2V1UA 4Q18A 1TX4B 4GDFA 3ZVRA 3QBTA 1FPMA 4FI3C 3I5YA 4C7OA 2IYRA 2EWVA 2XXAA 4NCHA 1JR6A 3DDCA 1D6JA 1ZNXA 4US1R 4D4KA 4YDHB 2C03A 5DYGA 1G8YA 3H1TA 2ZI6A 3Q8XB 1AZTA 4JLAA 4OHWA 1VG0B 1AS0A 4RJLA 4ZO4A 1HY3A 1ZIOA 4JVLA 1DS6A 3BK7A 3CF6R 1GG2A 2H7VA 2QAGA 3RRNA 1SXJC 2CBZA 2CL6X 1VMAA 1OH6A 5C18A 2GTPA 2C98A 1E2EA 2YOGA 4LBZA 2UZIR 3U3RA 1QHGA 2FH5B 3GLIB 1XD2A 1F2TA 3RNLA 3GP8A 2P5TB 2QMOA 1RIFA 2GJAA 2ZSDA 5IHPA 3TAHA 1Z3IX 2NZJA 1JR3D 1HQYE 3JVVA 3BH7A 4C3ZA 4D4MA 3U44A 1S2MA 1Q44A 1KZ7B 5BN3A 4LPKA 4HSEA 3WHKA 2OE2A 1H65A 1XJQA 3A1TA 2GAOA 4Q19A 3A36A 1ZNZA 4C4PA 1D9ZA 4KU4A 4NKRA 2C9CA 4B48A 1SVKA 4HZUB 2ZJ5A 3EC1A 3HU3A 3CNOA 3DZDA 3UK6A 4TL7A 1ZM2A 2QP9X 4H1UA 2XTZA 621PA 3Q5DA 3QIAA 1KI6A 1M74A 1NP6A 2DFTA 2DFNA 4MGKR 5JI3E 1ZCBA 3C15C 4IXMA 1Z08A 5BYJA 3NXSA 2FFAA 1U9IC 4KFSA 2DHRA 3EC2A 1G4UR 2DCUA 5CB6A 2FNFX 1E32A 1HUQA 3CWQA 5BW8A 3OAAA 2RGGA 3DOFA 1CR1A 1P5ZB 5KDDA 4X8OA 3OEHD 2J87A 4X8HA 1KO5A 4DCNA 3EARA 4NHOA 4OI4A 2GEDA 3W8NA 1AGPA 1TMKA 2GHIA 2V6IA 4P3YA 2G0NA 3LD9A 4NONA 4R2HA 3QEOA 1CEEA 4JJZA 4C30A 3OIUA 1G64A 4V0ME 4PFSA 3EZFA 4M9SA 4AY2A 4HB0A 2FFBA 2HXYA 1UKVY 2N1BA 3AVXA 5DI3B 2GXQA 3TAUA 3AVVA 3K0CC 3EAQA 1NY6A 5ELXA 4G0NA 4LJ7A 4DT1A 1SXJB 1W36D 1QG2A 3Q7PA 2QNRA 4AKGA 2A5FA 2N42A 2W6JA 4DLZA 2QSYA 2PCLA 3N70A 2NO9A 4BECA 1S9HA 1VHLA 5KHOC 1YE8A 3PJRA 4I1UA 2A5YB 3RS5A 2OCPA 2PT5A 2ZI9A 4RZ2A 3WRXC 4EJSA 3P20A 5FTKA 4DZZA 3LFUA 4FN5A 2ZQ5A 3TBKA 1V43A 3GLHA 4DB2A 5JLJA 1ZD1A 2XB2A 4XVQA 3KB2A 3TR5A 2FPKA 3KZ1E 1KY3A 2JAQA 3VU9A 4A4DA 2IC5A 2GILA 2IUSA 4V03A 1GAJA 1UPTA 3B1WA 4EPXA 3AVWA 1G3RA 1GP2A 4A0GA 1VPLA 3AH8A 1I2DA 3KQUA 521PA 4OQMA 4O2RA 3BORA 1OSNA 4B33A 1K8RA 3HU2A 2ZR9A 2QAJA 1I2MA 3M1IA 1FMLA 3JZAA 1COWD 2YYZA 2ERYA 5AWFC 1XCPA 4UXHA 4Z1MA 2KB0A 3SHWA 1KYIA 1K5GA 3BB1A 4P0TA 3LBHA 1XPRA 2WKRA 4PO8A 4Q7KA 2CDNA 1KDTA 2F43B 2QMUA 4C2UA 3ZH9B 4TYQA 5CYPA 2UVQA 1W1WA 2WJVA 3IO5A 3X1DA 1E9CA 2AWOA 3SQWA 5JZVA 2XZLA 4TN1A 2IYUA 1AGRA 3KTAA 3U6KA 4C2TA 5C46F 5FOXA 4AKEA 3K9HA 1UAAA 1BYUA 1UFQA 2FFHA 4KAXA 2ZYVX 3GLFB 1XDBA 421PA 3CONA 4H1VA 4HAZA 3MGCA 3WNDA 1FTSA 4QGGA 2WJJA 5KDOA 4AC9A 4GSYA 4NYIR 1FTNA 1NSFA 1XP8A 3ZVLA 2QROA 2MSCB 3LLMA 2JJ2A 3LQRA 1J8MF 1E4YA 3GD7A 3QE0A 1NG9A 1TEXA 3EZ9A 2WKQA 1CU1A 4M2LA 5LD2C 5B64A 3ZLJA 3K0AA 4JZKA 3FHTA 2RKOA 3RDPA 3SHFA 1N0VC 1JR3E 2O0JA 2LWIA 3KXLA 4HAXA 3AF3A 2J0QA 4A92A 1N0UA 1VKJA 2HF9A 4POAA 2ORIA 2WSSD 4G5GA 1E2PA 4LV5B 4TWZA 5J40A 3QNUA 5L3VA 5EE3A 1U94A 2OEPA 3THYB 4TTRA 4A8JC 1G291 2OXRA 1J90A 4DKXA 1IN6A 3LW8A 2VTKA 1LTQA 4GMXA 5KTYA 4OK5A 1E9FA 2HF8A 4IXNA 1KI7A 2PX0A 4M4SA 4B44A 3FPAA 3LXRA 2ENZA 2Q3FA 4JJKA 2OBLA 4NYJR 2KE5A 2GJ9A 1GTVA 1YR6A 1N5IA 4DT1B 1YQTA 4EPRA 2QM7A 3AVTA 1R0ZA 5EP4A 2ZUDA 4B3BA 3LA6A 1TTTA 2XNDA 1GDDA 4I1SA 4ASUD 1G7SA 4DLUA 2YC2C 2ZTSA 3T15A 1LS1A 5HCIA 3QXHA 3Q5EA 4CEIA 4L5BA 2A5JA 1Z6TA 3UEYA 2BJWA 1H8HD 2X2FA 4OI0A 1XA6A 1RRGA 2FEMA 2O8CA 3I3SR 1UF9A 1X86B 3OIYA 5HCNA 1Z8FA 2W6ID 3OE7A 4Q4HA 2Z4RA 3SNHA 1NIJA 3TLXA 3FMOB 1GL6A 1ODFA 4Q4JB 2JLZA 1ZMXA 4D81A 4YMVA 2OM2A 2WWXA 1V5WA 5G41A 2VLIA 4LX0A 1EESA 2WICA 3RRZA 2QQ0A 1RVDA 2HEIA 2O52A 3WP1B 1XB2A 4Q03A 3U6BA 3L43A 1F2TB 3T1VA 2F55A 4URVR 3VKHA 4S35A 1II8A 1KMHA 4AG6A 1OJLA 3MRSA 4LYJA 4TSFA 821PA 4TTPA 1ZUNB 4LBYA 4XVUA 3EZ7A 1DEKA 4EFNA 2A2ZA 1W47A 2F1HA 2QAGB 2VO1A 4OBEA 2VP0A 3D31A 3PVSA 3Q7QA 1SVMA 3NHBA 1XJ0A 1AS2A 5K8UA 1CULC 3MFYA 1FP7A 4DSTA 5DO9A 1KJZA 1YR7A 3QI2A 4FWIB 1E2HA 3WYAA 1SKYE 4IEEA 1Z0AA 4G5SA 1A2KC 4HDCA 4JLBA 4LWZA 4WW0A 3GLFE 2WAXA 2F9LA 3ICQB 2V7QD 2AXNA 1KMQA 3KB1A 3GLIA 4NCKA 2EVWX 3OESA 4PR0A 1G8GA 1KI9A 2QMEA 2ZJBA 3KJHA 3G5UA 2YHSA 3D6TB 4Q00A 5EE0A 1N6KA 3UMFA 3SE0A 3UGIA 1U98A 2ZSEA 4ARZB 4A6PA 4N3NA 4JLMA 2J59A 4BLOA 4D6PA 2P6RA 4QBFA 1SXJD 3L8ZA 2H92A 2YWFA 4PSKA 1A4RA 3RABA 4G5OA 1MO4A 5JSZB 1VG9B 1QHIA 3DZ8A 2BCGY 5EUQB 1R2QA 1EFTA 4Z8XA 4YC7A 1E0JA 3CNNA 3FMPB 2NPIA 2C95A 3TH5A 3P4XA 2CLDX 2REXB 3IIKA 4C0LA 1Q1BA 1E2MA 4OYHA 4XD7D 1AK2A 1GL9B 2QBYB 1PTQA 3VX4A 3GJXC 3REGA 2ZRJA 1Z28A 2D2EA 4TYWA 5AJYA 3B82A 5L8VA 4R71A 2EFGA 4M1SA 2AD1A 4LBVA 5CLQA 2ZVPX 1LV7A 1KI4A 2R6CA 1IBRA 4I4LA 4DBLC 4A1FA 3GFTA 2W6JD 3FFBA 4F91B 2GJSA 4ESHA 1N25A 2OCBA 5JEDA 4NPHA 3THXA 1IHUA 1UKZA 3DKVA 4HUQA 4NU0A 4EPTA 4K81B 4NYJQ 1E2LA 3ZVMA 4WAUA 3TUJC 4A15A 4MYCA 4WZ6A 4PHFA 5FBLB 2ZRDA 2GZDA 2JJ1D 4BLSA 2PJRA 2YOHA 4Q02A 5JS8A 1SHZA 2VF7A 2ZE7A 4O0MA 4IKEA 4TYNA 3EWAA 3TUIC 1HH4A 2FV8A 1CR4A 2YUUA 4MKFA 2XSZD 1YZUA 4WIAA 1R6BX 1S8FA 3TSOA 2RAPA 1X8JA 2WWWA 4PHTA 4FCVA 4UQOA 3W6OA 4R2IA 1G21E 3ONWA 5JCZA 4EKDA 1FW6A 1N5JA 2G3YA 1EWQA 3QKSB 4PX9A 1PLJA 2VQSA 1NBME 1XTQA 121PA 4Q9JA 2NO6A 1S3SA 4TMTA 4C0QC 4KSBA 3SS8A 1TNDA 1W0KD 2ERXA 3TW8B 3O8CA 2A5DA 1Q1EA 3GEEA 2B7CA 3OFND 2WM9B 5E3HA 3N5CA 3DMNA 4ZKDA 1LY1A 5JEEA 1R79A 2Q9BA 2VHUA 2ZE8A 2KBEA 2ZRKA 3L0IB 3WMGA 4B3DA 5AJZA 3KQKA 4V02A 3W5JA 4BEJA 4JLJA 3T34A 1M6NA 4PPGA 4ZDKA 3BB3A 3X1WA 4RZXA 1N6NA 1SQ5A 2ZYUX 1NG1A 3NH9A 5JJKA 2FZLA 4A0HA 2WWYA 2C78A 4OJKA 1OFTA 2H18A 3ND8A 1GKUB 1S1CA 1B0UA 4IOJA 1KKLA 4Q48A 1XD9A 1Z83A 5KNCA 2CL7X 2QP3A 1JR3A 4Q9IA 1W48A 2L0XA 4CZ2A 4LGMA 5CIWA 3AF4A 2JLRA 3AVOA 4A9AA 4F7WA 4UXJA 4FMBB 2Q21A 1XMSA 4JLVA 2DFLA 2EFEB 2BCJQ 2ZRFA 1XNJA 3P26A 4IRUB 2YWEA 3GJ5A 3LNCA 1GNQA 2FSGA 2RGCA 5FBRB 2IUTA 1BS1A 3SOPA 1KIMA 3AP1A 1US8A 2BMJA 2GJKA 4II7A 5GVRA 1OH5A 2FJUA 1G5RA 4AKIA 2ZYWX 2F9MA 1Q20A 2ZRNA 4NTZA 5DIFA 2CCGA 1JQLB 5DHFA 3U2QA 1CJMA 1E0SA 4GL2A 3QUSA 3M6AA 3D8BA 4BFTA 2O8EB 3Q3JB 1ZJ6A 3VHLB 3FOZA 1PLLA 1L8QA 2PH1A 4PQFA 3W6PA 4L9SA 4OJQA 3RS3A 1BH2A 3BWDD 2GZHA 1Z0KA 1H8ED 1NL3A 3CZPA 4RFSA 4XTCS 3VTKA 4JL5A 1KNQA 4ZCLA 4EJSB 1UKEA 2ZS8A 1T6NA 2UKDA 2EYUA 4D0LB 1G5PA 1TBNA 2KWIA 4BE7B 1UJ2A 2ZETA 4LJ4A 4DSNA 4LC0A 1Z47A 3HYRA 1IXSB 5CLLA 1WBBA 4LJ6A 1QF9A 5HTKA 3VHXA 2QRZA 4JMPA 4YMTA 2CE7A 2H8KA 4YXWA 3Q85A 2GEUA 3EG5A 2Q3HA 4ZV4A 2GDJA 3NBZC 1OXUA 1YU9A 5G3YA 2J7KA 2O0KA 4F4IA 1KI3A 4QFMA 4QJ3A 1S0UA 2WMNB 4C0HA 2J1LA 3B9QA 5SZJA 2FN4A 2DR3A 4IDHA 1L4YA 2BC9A 1KJWA 3LXXA 3NIBA 2ZJZA 2PCJA 4KCGA 2IF0A 4Q5IA 1W5SA 3PUXA 4XIGS 5FBQB 1G16A 2ANCA 4PANA 2FPLA 3LLUA 4OL0A 2ODEA 1X1RA 2VA8A 2R8RA 1HYQA 2ZEJA 3K9LA 4DC9A 3O47A 2I3BA 3RC8A 4TYYA 1NJGA 1Q12A 2AXPA 4FMCF 4TQ9A 3C41J 1N6LA 1N2CE 4NL4H 1CIPA 2CHGA 4QNRA 2B6HA 4XWOA 4EJSC 3S1AA 4OQLA 3GMTA 4MRVA 1G8FA 4E07A 5EP3A 2D06A 5JI2E 4M22A 3THWA 4JBWA 5DI3A 1OB2A 2O8FA 4ZIRB 4HLCA 4IVRA 1MKYA 4HB2A 5CK5A 4M1TA 2WWGA 5AUQA 4LV8B 3SYKA 1OW3B 2OHFA 4LRWA 1FUKA 2BJVA 5ANRB 1JB1A 4RZUA 4P4SB 1HE1C 1RRFA 1XEXB 4GI7A 2J7PD 2R44A 3U7EB 1TUEA 3U3JA 5A5GA 1E79A 4JVSB 3K70D 1AJEA 2BBWA 2GBLC 1MV5A 1HEIA 4EUNA 3J81k 1CF4A 4R7ZA 1KTVA 1GITA 3PG5A 1DAFA 3BH6A 3FWYA 3M4YA 1OYWA 5JJIA 3BC1A 5TARA 2OCAA 1WE2A 3K09A 1PVOA 2P5SA 5L3SB 1BOFA 1DOAA 2H57A 3QPWA 2IHBA 3RVBA 3TR0A 2GVDC 2ZITA 4FW9A 4YMSA 4LJAA 4TMKA 4QXAA 3FB4A 5C4GB 2P6NA 1SVLA 3N2IA 1A2BA 1D9XA 5JFGA 1ANKA 1E69A 2V3CC 3QXSA 1FAQA 3A1VA 4M9XA 3FVQA 3SJBA 4QL3A 3MWLA 1KSGA 3BFKA 1T0JB 5B30A 2JDID 4C7OB 1R8SA 3M0EA 5HR5A 2IYTA 2F1JA 3U7GA 1E2KA 1T3LA 2AR7A 2V7QA 1T3HA 4F38A 1XCGB 3ZS8A 2G1KA 2XJ9A 1E0AA 4MRRA 1DO0A 4TLCA 4OHVA 3PEVA 2ENNA 1NVUQ 4HAUA 3H86A 2WWIA 1JAIA 1T5IA 2NIPA 3WY9A 5K8TA 4DIDA 5FOVA 4FINA 4ZCIA 3TE6A 2DWPA 3KX2A 4WVFA 2I1QA 2F6RA 4QHSA 4Q9LA 1XPOA 2JLSA 1IJFA 1G19A 1MH1A 1XWIA 2F7SA 2OBMA 2IWRA 2GVIA 1YHNA 3WXMA 2HLDA 3W6NA 3C7KA 3K8YA 5AJVB 1ZM3A 1P3JA 3NTUA 1GOTA 1DG3A 5FUYA 3EPJA 2C96A 1Z2CA 3KL4A 4RD0A 4V0OA 1UKYA 3JZMA 2WJHA 4FMCB 5E95A 1UEJA 2GK6A 1G7TA 2GEVA 1M2OB 3I32A 2H16A 2J0VA 3KJIA 1G8HA 3CH5A 4P4SA 5B2ZA 4EQ6A 3R9IA 4CYMA 4OI2A 2NO0A 4BEBA 4FCWA 3WMEA 3H0KA 2JJ2D 4B71A 3KFXA 4C0BA 2IXEA 1NBMA 3BBPA 1TU3A 3OE7D 3ADDA 2QI9C 3VQTA 4HLUA 4CEHB 2FOLA 3AKCA 3K0AB 1ZNYA 1U8YA 4MDEA 3MD0A 5AJXA 1X6VA 5AK0A 2OCYC 3Q9LA 2DY1A 3EA0A 5A4JA 3PUVA 2PJZA 1GRNA 4HAWA 4KBFA 1TAGA 3HR7A 2J46A 2IBMA 3RSLA 3FKSA 3JVUA 3MMPA 2JLUA 2UZ3A 2VEDA 2VHQA 3EXAA 3TKLA 3KTAB 2XTMA 2D74A 3SJCA 5CM9C 2KI5A 5KO2A 5G3ZA 1YKSA 3W5IA 1Z2AA 1PJRA 4JBYA 3EIEA 5F2EA 3B5JA 4PAOA 5AUNB 3WHLA 4C0KA 4DCVA 1E2DA 3SYNA 4AK9A 2E9SA 2QGZA 1JXOA 1S9DA 4UKDA 1QHXA 2IYYA 2OESA 4ILEA 2G88A 4LI0A 1OIVA 4PQRA 4B3GA 3HPRA 1FNNA 1GRRA 2WJGA 3SJAA 4XSHA 5JWOA 1N6RA 1OIXA 3FE2A 4QBGB 5FTLA 1ZRHA 2DPXA 4B2LA 2OO7A 3IEUA 3SJZA 3GLFA 4Q9HA 4DDUA 2ONJA 2O8DB 1FARA 4PAQA 3E1SA 1XTIA 3ZGXA 5GADl 4B6FA 3TJZA 4JLPA 1VHTA 3UGDA 1WQ1R 4U5XA 4BFZA 5FI0B 3I72A 1ZD9A 1ZP6A 2ZRPA 1QVAA 2RHDA 2IEZA 3IQWA 2IYQA 1XJCA 4ZI2A 1Z0FA 5DNYB 2NO1A 3QKSA 2BMEA 2F43A 3FKSD 4GP7A 1NMXA 1ZNWA 1E79D 4XJXA 1E2IA 2EYQA 4CT4B 4NCNA 3LO5A 4A2PA 2O5VA 1XTSA 3MAAC 4BWYA 3ZVNA 5DN6D 4PPQA 1J8YF 2E87A 1N3BA 3QJYA 2IXFA 2RH5A 2NZ8A 3CM0A 3MCAA 1T8TA 1GIAA 1Z0IA 4QM7A 1IY2A 1QHYA 1YR9A 4GMDA 5SZKB 1WA5A 3EPHA 2YV5A 4PC7A 2HJVA 3EPLA 2RGDA 4RVCA 3W3AA 1WDTA 1BO6A 2CVHA 1COWA 1HQCA 4HB4A 1W5TA 3K09C 5HZKA 2IX3A 1JEDA 1M7BA 2MSEB 2ZVQX 4HUQB 5F3WB 5FR1A 4D0NA 1ZW6A 3LWNA 3PV0A 4FMDB 4ITRC 2CLCX 3T1QA 4R9UC 4M1WA 2XZOA 3P1JA 1R0WA 221PA 3VR6A 4NE2A 1HT1E 3PFIA 1SVIA 2SHKA 2V6JA 3QKRA 4Z54A 3CBQA 3WRYC 3VKGA 2FNAA 1Z5ZA 4Q4LA 4Z8YA 3SN6A 1MABA 2XOKD 4O3MA 1UBEA 1VYUA 1ZC4A 2BEKA 3MSXA 3QXCA 4G01B 2ZRCA 3QEJA 4J0QA 3GEHA 4KSCA 5B57C 2BBSA 1G41A 3NBYC 3QVUA 3IUYA 1J2JA 2BBOA 5SZIA 1J7KA 4CEHA 4L16A 4MKGA 1PTRA 1NVXQ 1FZQA 3TRFA 4QHYA 1ZCAA 4MYTA 5CDFE 2V4ZA 3WYGA 3UANA 3SC3A 1NVVR 3PQCA 1GUAA 1F5NA 4WOPA 3U3KA 2W83A 1NN0A 3LX5A 5KSOA 1XD8A 4MQBA 4AI6A 2R2AA 4JLDA 4MRSA 1G20E 3C5CA 1YZNA 2XNSA 2P6UA 1L2TA 2W2XA 5BWMA 2GRJA 4BFWA 3GCGA 3IKJA 3G82C 2IYZA 2W58A 1TU4A 3AUXA 3PUYA 4LHYA 4PTLA 2ATVA 2XITA 5FR2A 4DVGA 2J41A 3ZD6A 2B8TA 4Q1DA 1ONBA 1W4CA 4V0KA 4ZDIA 1VG1A 5D3MB 3P4YA 3BIFA 1G18A 1JJ7A 2HJGA 4YMWA 2J0UA 1OE0A 4U02A 3IIMA 3MJRA 2NMVA 1N5KA 2RCNA 1X1SA 5FH9A 1W2GA 1JECA 1DAEA 3SZRA 4ABYA 3UATA 4IOKA 4ZI3A 1XX6A 4HZUA 4JVMA 4ZDWA 3K0SA 2IW3A 1PUJA 1VTKA 3CR7A 1R4AA 1KSJA 4AKHA 2ORWA 1NKTA 3GJ8A 4P33A 2XB4A 2GJ8A 2QPAA 1WBDA 4LHVA 5GJVC 5SZHB 2FFQA 3EPKA 2ZAOA 5G53C 1WRBA 4G3XA 3IDQA 3KUCA 4RKFA 2BMDA 1M1YE 4Q4JA 4IHQA 4NH0A 3R7WB 2XZPA 4PO9A 4B3CA 4B6EA 4QGHA 3TMKA 4EPWA 2EWWA 4Q1FA 3IPXA 1OF1A 1G3UA 4Z1MD 1DAGA 3C8UA 1SULA 3B78A 2D2FA 3BE4A 4ZDJA 2ZPTX 2REOA 4JSYA 2VP5A 3IHWA 3SI7A 4KVAA 2OLKA 4NYIQ 1DVRA 1G3QA 1CXZA 1LB1B 2EFHB 2J0UB 3AP2A 3C4JA 4NCJA 4N1AA 3DL0A 1YRAA 5P21A 1ZD8A 5FOSA 3SR0A 3NC1C 2CNWD 2P3SA 4PPNA 1UBGA 4KFUA 2IYLD 1P9NA 2IWHA 4AG5A 1JAHA 2AFHE 1ZM4A 4UJ5A 2PMKA 3H4MA 1E96A 1ZUHA 1NLZA 2XAUA 2JATA 1DELA 1XTKA 3MJHA 4GZMA 4RKEA 1P7CA 3T5GA 5EQTA 1Q1QA 3NWJA 2VP9A 3QVVA 4JIMA 1MT0A 1P2TA 1XEWY 3AEZA 3AGQA 5FL7A 4C0SA 4LYFA 4YQFA 1U81A 2QRNA 5KSZA 2WJIA 4N0EA 3TSWA 5IDVA 4GOXA 5E7IA 2GWHA 2ODBA 1E0KA 3HWSA 4DUGA 2P65A 3I92A 1P75A 2KJQA 3W8RA 4AIIA 5TB5A 4B73A 3T5DA 2FF7A 1TQ2A 1S1MA 3C5HA 1L4UA 1QVRA 2PZEA 4TL9A 1CTQA 1AIPA 3NEYA 2PEZA 2J45A 1MOZA 3AUYA 1E9EA 2A7QA 3AVUA 3B6EA 1HURA 5CM8B 3QKRB 4ZKEA 3WMFA 1QG4A 3RS4A 4UNRA 3VNVA 3U61B 2H1LA 1K5DA 3CRQA 1KBFA 1Z06A 1OHHA 1G1MA 2J3EA 1Z6YA 3CWZA 4URWR 3EWSA 5DHAA 3VNUA 4OK3A 2ZRLA 5EE1A 2EFDB 5C2JB 1KO1A 1IONA 3B1ZA 3FHOA 3QBVA 1LNZA 2MSDB 4F92B 1VYVA 1VDZA 1JXMA 1Z6AA 3Q72A 1N6IA 1BKDR 4KBGA 4PO1A 2FWRA 1P6XA 2FGKA 3U5ZB 2VHTA 3WBKA 2XX3A 3IBYA 3LX8A 2WIAA 4JYBA 5E4FA 4DLTA 1EGAA 3ASZA 4DSOA 2WSMA 4CGZA 2Q9CA 1OKKA 2VRWA 2QORA 4KYUA 1QDEA 5EXXA 5UKDA 4BFYA 3K9NA 2BOVA 2XJ4A 1CJTC 2DYKA 3V4FA 5KU1A 2JJ8A 2ZREA 5DE3A 2Q6TA 1K6MA 4GNKA 3QF4B 3RS0A 1VCMA 2NPFA 4Q4AB 1YRBA 3PENA 4URUR 1PLKA 4MKHA 1BIFA 4XSGA 4BFUA 3K1JA 3ZD7A 1N6PA 4HEJA 4XWKA 5BQ5A 1W0JA 2CCJA 1KSFX 3IBGA 1IN4A 2X77A 2WV9A 1SKQA 1I4DD 4A2WA 2OBNA 4E09A 3CIOA 3NH6A 3GLGE 3V00A 4I1VA 4ERNA 3U3OA 1YR8A 1E1QD 1MO3A 2BKUA 4QGAA 1UM8A 1WB9A 2WJYA 3W3ZB 2ZYTX 3NKVA 4LCBA 4Q4AA 5JHHB 1VG8A 5HPYB 4LHZA 3QF4A 1AKYA 2QE7A 1QBKC 3AQ4A 1Q1ZA 4V0NA 3HYTA 1WMSA 3B1VA 1ZUIA 4P4UA 3TK1A 1W7AA 2PBRA 3ZQJA 2GCOB 1KI1A 4HAVA 1TF2A 1IJEA 3SFVA 3LVRE 2J0SA 4BRWA 4BPBA 2VRWB 1ZAKA 4B6DA 1U90A 4BGDA 3KQNA
chains in the Genus database with same CATH superfamily
4DM3A 3ISVA 2EKPA 2MU1A 2QX4A 3L01A 3ER8A 4R2KA 4I3HA 4LDPA 1N9ZA 3TLYA 4IDFA 1CRPA 1OYVI 1ECPA 4Y0AA 3IBFA 4B76A 1CUSA 5CJ2A 2Z9DA 5KNBA 1N77A 2LE0A 3JWIA 4HYTA 1C4XA 1MEEA 1K3TA 4HXYA 3KY9A 1ABFA 3K9BA 3NDPA 4W5OA 3MJTA 2CUKA 3I1YA 3O8QB 3AJ8A 3QUTA 3VR1A 1XTUA 4G0YA 4DLBA 4EG3A 2G8NA 2UYQA 2W8BB 2WWHA 1TF5A 3SP1A 2G17A 5GQSA 4MS4A 2RBKA 2FEXA 5DGDA 4O5OA 1KO8A 4RFVA 1O96B 1TYAE 2TRSB 2ZPUA 3BEOA 2VQFB 1K7FB 2FE4A 2YZ2A 3PX2A 4KR0A 3ST7A 1IZYA 1OFHA 4YH1A 1CY2A 1XVAA 3QLUA 5AR1A 2W70A 1Q57A 4HN4B 3LF2A 4JYMA 4BLPA 2QT9A 2WT9A 3RROA 4V0MA 4FCTA 4JQCA 1XRRA 4MQFA 4ZAWA 1J20A 1RWMA 4GRAA 4JEIA 1BMQA 2JARA 4H59A 3KZVA 4TMXA 5CH8A 5G02A 3TIIA 3T8YA 2QKYA 3B3AA 1GPLA 3M4ZA 2LKDA 1MOPA 3GMDA 2F1RA 3EQZA 4CQLB 1IQPA 1ULKA 4JR0A 5C4MA 2JBHA 3PUIA 3ZKWA 2KLHA 2H1FA 3K1YA 3TNJA 3RS7A 1DC4A 4PVCA 1IN8A 3REOA 1VA5A 1IVYA 1DTEA 3LVQE 4I1OA 5LMZA 1XQYA 1CDDA 2DBZA 2OWDA 4LC1A 4PE5B 5CVDA 4IS2A 4PHGA 4HNHA 3OX2A 4B46A 4LXTA 1L7MA 3OZAA 2IFTA 2NGRA 1YULA 2I8LA 3VNBA 2OXEA 4FFVA 4QATA 1GM5A 2L7XA 2JI6A 1PYDA 2RHRA 3WQQA 1MVNA 4JKYA 4MLZA 2H4XA 4NOJA 1U2SA 4CM8B 3TOZA 1ZD2P 2D1FA 2JS7A 5E8RA 4U7FA 3B12A 3NT4A 3VOSA 3GLIE 4OXRA 4PXSA 3TIFA 4L9MA 4ZYUA 1PG0A 1M6VA 2SKDA 2XDQB 1RXIA 1NVWQ 4U6QA 1Q9BA 3ZWPA 1X1BA 3R7WA 3I9V6 1T15A 3N2GA 4P1ZA 1P9LA 4MQ5A 1QC5A 2C1XA 1MB3A 2JASA 1ZS9A 3VOBA 2W90A 4E51A 1RHJA 2JFXA 2ID8A 1KQNA 2FSUA 5BMOA 1CNMA 4M0LA 4F3YA 4MPRA 1GNTA 3ZHXA 1VM6A 4LY6A 1X8LA 3F46A 4US0R 3WWCA 4ZMBA 3QEMA 5LJIA 3H9CA 4WESB 4ESVA 4JHXA 2P75A 2BDEA 1N34B 4YJFB 1E1QA 3GQBB 4HEQA 4LZZA 3R5AA 2XNHA 3KOWA 3PJDA 1A8PA 2OFXA 1Q22A 4FUQA 1NPTO 1E8DA 4FVTA 1OTXA 2P40A 1PG5A 4JEUA 2FN9A 3FMVA 4G9GA 4KO2S 2XCTB 5J8CA 1YGYA 2RI6A 4WESA 3UXMA 5TRTA 5JBQA 3O8RA 4H31A 5ELLA 3A3PA 4PEVA 4P08A 5F64A 4ZCTA 1NZJA 1ZVJA 1QQTA 4DBLE 4KNYA 2AJTA 2QPLA 2ZG6A 1UJBA 4FYMA 2PDAA 3C7TA 4J3FA 4NS4A 4TMFA 2QUAA 5ENDA 4BUJA 1CHOI 4N5HX 2ZI5A 4EO7A 3PEFA 5LVAA 2EP8A 2QSUA 3MUFA 1BJTA 1YI0A 4NNPA 3U9SA 5KS2A 1Z7WA 3R74A 5E7JA 3WFIA 3UT5A 2C42A 3N7UA 4EYQA 5I8ZA 3B9PA 4ER0A 1EUZA 2JJYA 2ZTHA 3DZJA 2IEYA 3SNKA 5B7GA 4FMDF 1ODJA 4C6TA 1UFRA 3WL3A 1I4LD 3ANLA 3RI3A 2QEQA 1Q0PA 3KVRA 3WTBA 1JDBB 1V7QA 4HYEA 1I1OA 3DE4X 1Y7PA 3DCJA 2G1JA 3W5CA 1AUQA 2VJOA 4L5YA 1GGNA 2Z08A 5DNVA 1TCUA 2IXDA 2JHGA 4KRGA 1GZ7A 3ZIAA 2YHAA 3LQ4A 5ALPA 3KCNA 1OZHA 3QQ5A 4ZQIA 4LYHA 1NV8A 4D3XA 3C14C 1ZA1A 4HS9A 3RWMB 1MBZA 3CR8A 1W59A 3PS9A 4E0BA 1XZQA 2TYSB 4MUXA 1P72A 2X7HA 3NBFA 4DNPA 1OMTA 2FW0A 4JU8A 4WBXC 3NHFA 3RUAA 1NQWA 3H1EA 2IIQA 1JFFA 1NJSA 2IYXA 1KEEB 3LPDA 3OZWA 5JQGF 3B89A 1NOIA 5H8WA 2DAPA 5EIWA 5FORA 1Z62A 3GVHA 3BD6A 3GV0A 5AKGA 5C31A 3ZBTA 3PX3A 5ERXA 2O3UA 2JEZA 2KSQA 1OFUX 1DWUA 1PZGA 4AJ2A 3RVDA 3T99A 1UBJS 3HCBA 4NFYA 2Y8EA 3LF1A 4I8IA 4JVNA 5HE8A 3BFXA 1KYWA 3TJRA 3UYKA 2DB3A 4K6KA 3ZY4A 4QQKA 3UMCA 1ZU4A 1U8XX 3IILA 4M60A 4P8RA 3CF2A 4KITB 5DCLA 1CD5A 2BGRA 4I7EA 3OIFA 4MHTA 2GKSA 5KWEA 3IMKA 1V26A 2GAIA 2AEJA 4M8NE 1KP9A 3T95A 4XDGA 3RJZA 2A94A 1A27A 5C8ZA 1GJRA 3L84A 4IJ5A 3ADKA 3TQFA 3WICA 5B4UA 2DWCA 3HDQA 4LYAA 4YONB 4B4DA 2OHGA 3QLVA 4P3OA 5CG1A 2R6ZA 2YHUA 3K30A 1U6JA 3H1PA 3TLBA 5K8CA 1QHHB 3CLRD 2IL1A 1EB8A 4DS3A 1B8PA 3K5HA 3GLGA 3FPJA 3DPUA 4DMUB 3O03A 5B37A 2GJ4A 2VP6A 5BVHB 1U5KA 1YJCA 3LSTA 4X71A 3T7KA 4XUGB 2QX9A 3M9WA 1ZIPA 3HXQA 5AM1A 3I8XA 2XMPA 4ZYYA 2XKBA 1A7JA 1XZGA 4KHPB 1L4MA 2CJWB 3CRW1 5L3ZA 3GGJA 3IA2A 5F78A 1JF8A 1S02A 3KEFA 4G4SO 2DKNA 1C3OA 3DV0A 3HCEA 4B6JA 4PLFA 4OHYA 3AUSA 3L4KA 5CX1B 4CF6A 4F5YA 2FN3A 2PLNA 4KAAA 1T9KA 4RD2A 4XFJA 2Z9BA 3VFDA 5FNVB 5CTAA 4WACA 1U8ZA 3HPQA 4ZI5A 4G8DA 4IYRA 1V1RB 3COVA 3L8CA 1FNDA 1MOSA 4JCCA 4KFRA 3QVXA 4MEBA 3EIQA 5EJAA 2NSHA 4CIAA 4DCUA 1US8B 4IXWA 1O6CA 3D8UA 1Z5WA 4I1YA 4I4IA 2FEAA 3OZUA 1FYBA 2QRQA 3E15A 2NSJA 3K6KA 5HIJA 1J2YA 1ESZA 4ZAFA 1DJLA 4QHTA 2B20A 3R3ZA 4EARA 2XZDA 2CNBA 2HU8A 1P2UA 1FL9A 2R7LA 4Y8VA 3L7KA 4HGNA 5TY0A 3CCBA 1VLQA 3V9AA 4AJKA 1WXGA 1ADGA 3G0DA 1GU7A 5FLKA 3SJ7A 4S04A 2O5RA 3O83A 3MRTA 4RWEA 1CRZA 1QH1A 4D98A 5KPDA 1EH5A 5B7PA 4QOIA 4IV8A 5BV0A 1WVMA 3FMFA 3P8ZA 5K20A 4U7DA 4R8RA 4O8CA 1L7AA 5IARA 1UH5A 4D3YA 1EFRD 4K46A 4D2IA 3HCDA 4FMPA 4MCJA 4CEJB 4NBSA 2G9QA 1DQZA 5DDIP 3G0CA 1WOYA 5F9FA 1P1JA 1YL5A 2XUKA 4IVNA 1BXRA 4WZBA 3ZJ4A 2F3RA 2YV4A 3A11A 3DMRA 3I0NA 3IQIX 3GJ7A 2ROWA 1V25A 2GD1O 3ZWYA 2UUCB 1P5HA 3EVGA 4QO8A 2YWDA 4MK4A 1SVOA 4IJQA 3FCOA 1X7WA 2Q99A 1RRPA 1FP4A 1SCDA 4LJ5A 1KP2A 4OLFA 3WKDA 4DABA 4UVGA 3UG7A 1T5BA 4D92A 2QGFA 1R0YA 4N0QA 2QTHA 2G1UA 2VJYA 4HEA1 1KVQA 5F9MA 1NBMD 2OBXA 3L0SA 3MT9A 3N0RA 4L5AA 5IKXA 4OBXA 2JKZA 1EDBA 3MM4A 2AL7A 2ZJ0A 1Z07A 4AZSA 4EA8A 2ZBQA 1X39A 4CQMB 2DOKA 5H7XA 5BSEA 4PGMA 1R74A 1KWGA 2F8SA 4NZOA 1QAQA 4LV6A 1UBSB 4WXYB 1X7YB 1UDXA 3GZJA 2Y05A 3DV9A 4J75A 4B82A 1TZCA 2RIJA 2PYDA 4ICIA 4XIYA 3MTQA 4J4TA 4YYZA 5JS1A 2GCNA 1PHRA 4KVZA 2ZQYA 4QBTA 3KPVA 3K0FA 3FBTA 2I1WA 4V0LA 5G0UA 5AYVA 3QEBZ 3OAAD 4DLXA 2GGSA 4FFRA 1KFKB 4DSUA 1KKUA 3A25A 3AOEA 4GQIA 1U0JA 1IHOA 1KAQA 4IGIA 5IXSA 3AEQB 2DUUA 4DC1A 5IK2D 1IAQA 3UFXA 4IGKA 2XIJA 3RJMA 4I9GA 1U04A 4MULA 4X8LA 3TQHA 4UE3S 5IF9A 1H5UA 3OLQA 1YA8A 2CB9A 4LSGA 1QKIA 1CUBA 1DAIA 3TXXA 2FSHA 3HFGA 1EWTA 2I7TA 1OWLA 1QTIA 3N2LA 5IBQA 1V9LA 1V2GA 4DSZA 3PLRA 1WSWA 1U8FO 3PTAA 2HJRA 3EVDA 4WTOA 2GVZC 1DIOB 6Q21A 4TKUB 1N32B 1ISJA 3CKYA 4FYWA 2P77A 2OUKA 2P9QA 2ZANA 3EEQA 2H5EA 4RV4A 5EXPA 5KHAA 3VBEA 3U09A 1FNSA 2QRMA 1MFZA 1C7IA 1HE2A 3MPOA 2ZRAA 3NV7A 3PRHA 2CBGA 4FOLA 3AM4A 2DQYA 3R0XA 3C97A 5JH7F 1BD3A 1ZEMA 1P80A 3GZTB 5FULA 4SGBI 3IELA 3BTUA 2NUPB 3TDNA 4P98A 1QRAA 5TSDA 3KQLA 1VYTA 4D8YA 1FRZA 1ZU5A 4KGXA 1EFRA 3TVTA 4MLDA 4Q3LA 4ZO8A 2GO7A 3VR0A 3HY6A 2EGHA 3TEFA 3DCNA 3EPRA 2C4NA 3HP1A 4RS3A 5A7FA 5K8IA 1XF9A 4YDSA 3AKEA 3G7NA 2GZRA 5AUPB 1TB4A 4TMZA 3TLMA 3CLSD 3QVGB 3NDJA 2P0EA 4ARUA 4IJMA 2G80A 5DSZA 1U1DA 1EXWA 2XWSA 4HDSA 1RRCA 4EABA 3AQIA 1P0MA 2FWNA 4OQDA 4ZO6A 2EGUA 3P5BA 4YN3A 3TUZC 2EGGA 3H04A 1VLHA 3LT2A 1G55A 2NU6B 3DPIA 3FNBA 3WSVA 3GEDA 2AOTA 5ITZB 1ZBDA 4E5DA 1VC2A 2LKCA 2ZKIA 4RLFA 2OAP1 3EVTA 2BFOA 4GD3Q 4D3SA 1C7FA 1ZK0A 4EW2A 1FNMA 4Q24A 3RTBA 2C2KA 1DU4A 2LRHA 1ZICA 1BXZA 3DPSA 4BX9A 5HZHA 1GTSA 1E60A 3INYA 4JT9A 1XQXA 2VHCA 2F3CI 1LSJA 5FKJA 2B8JA 3CF0A 3O5AA 4OUDB 2BIFA 2PUWA 4UEWA 4ZYVA 2R85A 4QULA 1OV4A 2GPJA 2J3QA 3KZKA 4ZO7A 1OH8A 4RYDA 5U4QA 4BNZA 4OA5A 1TVKB 4YECA 1NJ1A 3E48A 2ZT6A 3DBRB 2V8OA 3KTDA 5JQGB 4ISCA 1MLDA 2BUBA 2OYRA 1KQOA 2V7XA 3HACA 3KE8A 5JQGA 1FJHA 1V7CA 3DWGA 3DV2A 4B6PA 3GYBA 5JPCA 3BMQB 3JQ9A 2RFLA 3AVPA 4P81A 1DARA 3RWOA 3EG9B 1D04A 1NUPA 1CB7A 2CLHB 2HCFA 5M3BA 5BXQC 1AKWA 5AIBA 3FOWA 1EEXB 1SZJG 5GZ1A 3DYBA 1W93A 2GUWA 1D6NA 4PGGA 3GF4A 3RM3A 5JATA 4DR5B 3TNYA 3NPMA 3NOXA 4WADA 1JLLB 3TIVA 2G25A 3E9CA 4AO7A 2JVJA 1IH8A 2GNPA 3LQFA 2JEYA 1OJ7A 4KZKA 4WHMA 4J1TC 2ON6A 4LMPA 3C98A 4DIEA 1F17A 2R4QA 3A1DA 2N52A 3A14A 3WJ2A 2NLOA 5IH7A 2FSVC 1HNNA 3PITA 3FX2A 2QL6A 3INGA 1NMEA 1J07A 4NJEB 1EUCA 3WQSB 3H2KA 1Y8QB 3NHMA 1X3LA 3R20A 2FEOA 2PX3A 1DC3A 3FFWA 5AKLA 2DQ4A 1XHFA 2NOAA 3VSBA 1TEVA 3NHPA 4B4WA 2RC5A 1I4OA 4OGKA 3ZWDA 2JLVA 1UBHS 3THSA 1RKUA 3VKWA 4YX9A 3Q7RA 1P62B 1VIAA 1DIRA 4PRLA 1AGXA 4AJ1A 1EWKA 3CRNA 4Z9XA 4TUYB 1DBWA 3OO0A 1SQGA 2P2LA 4G1BA 2YYYA 1JT2A 5DW0A 3SEZA 4B43A 4CFSA 2CLOB 4RVUA 3FZNA 1EA7A 3AINA 2C0QA 2C99A 2BP7A 1VGVA 2ZJ7A 1DT3A 3FPGA 3I6YA 3QVJA 1FLNA 4HG2A 4C4ZA 4YGYA 1CIVA 3OQJA 1ETUA 4WLFA 3Q0IA 5GAJA 4CHTA 1SVSA 4OX9B 3A9WA 5GMOA 5KDLA 3RC3A 1GZ5A 5K0LA 3AG5A 3GVIA 3OSZA 3OPMA 4H4CA 4MUMA 4I99A 2EKZA 5B58C 3EZYA 1YZQA 4OQZA 4WOCA 1MR3F 2REQA 3PGVA 2WIGA 1P8AA 2WF5A 4RFSB 4WJKB 3ICVA 2B4QA 1W4AA 2C5LA 1DBSA 3G8DA 3HGQA 2ZRBA 4V3BA 4FX5A 1FFYA 1B16A 1GA1A 2O8EA 1X7YA 2I80A 3BIXA 2JYYA 4OVOA 4ZQFA 4NNOA 1VL1A 2DQSA 2R1VA 4PPFA 1T10A 1R5NA 2ZFUA 3MWJA 4QGFA 4NMHA 3O8NA 2CL0X 1P0CA 3QKWA 3AFNA 3S8EA 2HK8A 3FZYA 5AK4A 2WJ6A 2V3VA 2BH2A 4M9ZA 1ND5A 2GQ0A 4U5QA 4KRXA 3THRA 2ZM5A 1J33A 4PC3A 1G42A 3SHOA 1F48A 2VFAA 2DHCA 1WDWB 2TECE 1JU3A 1RYNA 4O4IA 1CE8B 3KBBA 1KAGA 3R7FA 3FFAA 2GASA 3M5WA 1RPZA 1HMYA 2PZ8A 2WSLA 5BSRA 5EHZA 5KPJA 1KPHA 3R0ZA 3ETLA 5FWAA 5BYKA 2FMXA 2WF7A 3GU3A 4KE6A 4MRNA 1HL3A 1Z0DA 1Z6XA 1QMPA 1YQQA 4M54A 3L0CA 3V1UA 4CG3A 1E3LA 2WG1A 3KOOA 5IWAB 1QTRA 1L0BA 3KQOA 4BC1A 1Z6GA 3JASA 5JYBA 5JSQA 3UWKA 1NN5A 4GAEA 4DB4A 2IS6A 3G2LA 2XTNA 3P9PA 2OECA 3RVMA 2PUCA 2Y77A 4QBHA 3UK0A 3EGCA 3NX4A 4OHFA 2D1QA 1ZONA 2VLBA 1BE6A 2PSDA 1ISMA 1Z17A 2PKEA 4KXXA 3KWFA 3OMWA 4M1KA 1CUUA 3UG6A 1SD5A 1HQDA 1JPJA 2ANBA 2WC1A 3CVJA 5AMXA 5LCXA 4HNGA 2D62A 2PFSA 2Q1WA 2XRFA 3S27A 4I81A 1E59A 1QSGA 3A8TA 1K7SN 3UEJA 3X2EA 3TL6A 1R8XA 4NJMA 4U4AA 3OWHA 4OHZA 1L8OA 2OZEA 3AWIA 1KYYA 4GRIA 5E2AA 3ORYA 1W46A 5THXA 4AD8A 4EGFA 3K6RA 1JNYA 2YJ6A 1Z75A 5BN5A 3IALA 1NNI1 2CLMB 1FDOA 4WECA 3EK2A 3K20A 4MJLA 4NF2A 1CUVA 2ZI3A 3G6WA 3SY8A 1U63A 4FD3A 4TOIA 2OU2A 3NBXX 5EZ6B 1HT0A 5IP5A 1EMDA 3GPBA 2GCGA 3WOHA 3DO6A 2C9MA 1SHLA 4JLOA 2J6CA 4MRPA 3H11B 3LUKA 3B7GA 3ELDA 4Q15A 4B74A 4EUKA 5JCJA 1KTIA 3SZOA 5IUJC 1E7QA 1TJ5A 2WNSA 1L5RA 5KHLB 4ZOLF 1FUIA 1EU1A 1U1CA 1N2CB 2PLAA 4QC2A 3ZDAA 1VI2A 1QYRA 2QZSA 2ZBVA 3PKIA 4TN5A 3F78A 4NG4A 5KTKA 1J9ZA 1IHDA 4KPEC 4I55F 3BHMA 4RORA 4MJ7A 4EVSA 3DVAA 2O3TA 3BJIC 4K6GA 4TRNA 4F4JA 1UBRS 2D5LA 5JAMA 1GKIA 1YJBA 3E3MA 2XA2A 5GVSA 5C35A 2IA5A 1XDUA 1G5FA 3GIDA 3IEPA 2B61A 1ZRMA 3RE1A 3P94A 5KNBD 4W5NA 2G9NA 1GV1A 3OWOA 4F46A 2D8AA 3IURA 4W5QA 1E1RD 1Y9JA 4GKJB 1R0LA 2H1HA 2I33A 4XD7A 3ZQ6A 1LF0A 5I4IA 5JRDS 2JFQA 3M34A 3AM5A 1WX1A 4Y0NA 2H59A 5CW1A 1SPBS 1BQEA 1K88A 3L9WA 1XZCA 1MQSA 3NMUF 2IKQA 4CODB 5AVUA 1N2EA 4PAGA 1L5WA 2DKFA 3SR4A 3HL0A 1ORHA 2AG6A 1CZUA 3OEEA 3PFBA 4YAWA 5D85A 3VR5H 1CWUA 1W36C 2HWKA 3RUDA 1E2NA 2ORYA 2QRGA 1ONPA 3PXXA 5E1OA 5ICFA 1TC1A 3FTFA 1WHSA 4TL6A 3C16C 2G0TA 4P3PA 1XQ1A 4EG7A 3SVLA 4HDKB 3A1WA 3HKBA 5KVSA 4B0OA 5DFAA 4MICA 1EGVB 2ZBFA 5LOVF 1QV7A 1V35A 3EF0A 1KZHA 5FA8A 5BW4A 4R54A 5AHWA 3I6QA 4ZN6A 2L17A 5DP1A 4R1MA 1SUWA 1G60A 3VVMA 2DH5A 3D9QX 2GAAA 3HNPA 4WXMA 3EX7C 3LUJA 4LOIA 2DBRA 4Z0HO 1V16B 1IHYA 2PH7A 4MVJA 4LKRA 1KBEA 1JRLA 1UDWA 1N6OA 1TJ4A 1UFKA 4Y3UA 1SCJA 1U28A 3SF8B 5C5DA 2D5AA 2YWHA 4DEVA 2HYDA 1ISHA 4B4UA 3EUAA 2O1EA 1RLMA 4NCBA 1U8AA 1EJ2A 1K1EA 1ZH8A 5L3QB 1QANA 4WUVA 2OLEA 4KDEA 2DHQA 2O2IA 4ZRDA 4RGQA 2BN4A 5IU6A 3FETA 1GDTA 4EL5A 3MJFA 1XD2B 4ZI7B 2EP5A 4B2IA 5DBIA 2C07A 3AP3A 1OT3A 1V4NA 1XF1A 2FUEA 3B13B 4UTXA 3W5AA 4ARAA 1R1DA 3ETNA 4EA7A 1SIWA 1IM2A 3OOJA 2UVDA 2PKYX 3ETGA 3I8SA 1U2ZA 2II6A 5EJEA 1R7RA 2V9CA 5L7TA 1RM5A 1ZINA 3ESBA 5HKOA 2AR0A 3QFTA 2WU4A 4NESA 4Q7MB 4S1VA 3S44A 1Y1QA 4OOEA 1K66A 2C61A 5TPZA 2R1TA 4KG7A 4MGEA 1TUSA 1P33A 2Z6QA 1E58A 2AK2A 2ZJ2A 4FHFA 4R1SA 5JJCA 3DCYA 5CA1B 1C4OA 2QJOA 4ALKA 3UGLA 3ORFA 3JVIA 3PHBE 2VT6A 4TWIA 3QM1A 2XB8A 3QKIA 3VJLA 2ZUBA 3N2KB 5IVIA 1C1YA 1OA1A 1M6VB 1S3GA 5SYMA 5E8JA 4G1VA 3TOBA 1YQWA 1DDIA 4IIDA 3TX6A 3IAHA 4RF5A 5J1SB 4N0DA 2PYZA 4TVBA 1YA6A 1S7CA 2OHVA 5JVDB 2CFIA 2ZSBA 1P1FA 3KHTA 3GRUA 4KE9A 4IR7A 4MVJH 4MYUA 1E2GA 1ZA2A 1EX9A 5I9LA 1XYVA 4DWWA 1VJDA 2WVGA 5A5DA 1LRKA 1HEUA 1WUTA 2UDPA 2OV2A 4ZOQI 1Z6PA 4JUAA 2W00A 3RR2A 2Y1CA 4INZA 4INJA 3S1AB 4DZTA 2ID9A 4WNCA 2H5IA 4X45A 1I2CA 5EQFA 2DEUA 2OQVA 3I76A 4Q1EA 1YA4A 4QU9A 4A7PA 4AT1A 2OO5C 4YRSA 5KQMA 3FTEA 4PLYA 4W5WA 3ZE7A 2O1SA 2MR6A 4D96A 1Z7YA 4O4HA 3Q0TA 3WYEA 4BO6A 2GN8A 2RGXA 3FUXA 4GOLD 4LRTB 3GCWA 1EFHA 3A3OA 2F59A 2WY2D 5HIMA 1A9SA 2XQIA 2WK1A 2PNJA 1FBNA 3OM8A 1F51E 2PXHA 4YRZA 4Y2HA 1DOZA 1MO5A 4H4EA 1QONA 4RA6A 3N8HA 2Z6AA 3LL7A 3SIWA 2HJ9A 4RHTA 4KIWA 2G76A 4FJ2A 5K6AC 2V5AA 3SIPA 2COKA 3P27A 1GILA 3DE0X 4OX9Y 4N3GA 2W0MA 1U0LA 2YRWA 4YGXB 2IOQA 1NI3A 2ZROA 2OYCA 4A0RA 2OT3B 1LLCA 2D4HA 2XVYA 2WKPA 2P3LA 3KNZA 4MVYA 3BGSA 1O97C 1P4RA 3ECCA 4P7GA 4P82A 5LZ7A 5C81A 5KJ6A 4TZ0A 1GGKA 3WVNA 1SA0B 1NN1A 2R84A 4E5MA 1W1UA 3OUUA 2QN8A 4E4RA 2I87A 3EVCA 4YASA 5J4LA 1SD2A 1ENZA 1ZGCA 4K9OA 4TRJA 2JGDA 4C89A 2JGJA 2PZBA 4Q1AA 4FYPA 4MB2A 2Z2XA 1J8FA 3U17A 1M7GA 1SUDA 4MW4A 4JP8A 1JLKA 3DOOA 4U2FA 1NN3A 4EVQA 2QTCA 4F5EA 1Z63A 1A8SA 3PXAA 1CRWG 1UVFA 2OCLA 2DY0A 4TLEA 4P80A 3ABOB 4PY2A 4RQAA 1DDGA 3O4HA 4L15A 2DWOA 3DKPA 3WKBA 4HTFA 1NBAA 2ESRA 2MSLA 2CN1A 1JHUA 3H3XA 4PW0A 3RC1A 4HUTA 4ZQCB 3PQ6A 4R8KA 2QUKA 2IP2A 4AB1A 4EK9A 4TT3D 1LDMA 2NP6A 2WGCA 3MWEB 3OKAA 5EYPB 5GTDA 5I3CA 2BEUA 1X42A 3RK0A 5GIOE 4KN8A 1I8TA 1NVEA 2ENWA 1TC2A 4LS3A 4MITA 5E7MA 2QT1A 3F6CA 3M9XA 1P7WA 1PVDA 2P9ZA 2WHRA 5TMEA 1U1FA 2YIVX 3IQXA 3M5DA 4W7SA 3IEXA 4XGQA 1WMAA 5B3AA 1K2VN 1T9GS 2PT9A 3GIWA 3UCEA 2PFKA 3L6BA 4RJJA 4LJYA 2BGLA 3N7AA 1PD1A 4MUFA 2V0GA 4U7JA 2J67A 1KGDA 3PL1A 1NATA 5HE9A 4P7FA 4X1KB 2NTNA 4X1OA 2VHJA 2OA0A 4KR3A 3O75A 4ZVPA 4BO4A 1D0VA 2WFLA 2CVQA 3IB6A 3UUWA 3UXEA 3NVDA 5IF3A 4FNOA 1UKCA 4QXMA 4RH0A 2EZ8A 3CTPA 3FAKA 2OGWA 5FA5A 2QVYX 2VSFA 2N1AB 4G5HA 5IJ9A 1DWPA 3AF1A 4ARSA 2MSKA 1PWYE 2WF8A 4FOTA 3CRZA 2O8FB 1V8DA 1KRWA 2QRHA 3N8IA 1Z22A 4BV9A 1XEWX 2ZJYA 1EXMA 3E7DA 5FUBA 3KB8A 4LNHA 1P2VA 3K05A 1C1XB 4X6YA 4Z9AA 1Z5PA 1RKBA 3OF2A 4RZ3A 1CX9B 3RJ5A 1T6ZA 4EIWA 2UXDB 1E7SA 1TF7A 1CUGA 3EVAA 4JLNA 5CHEA 4YT5A 5K4AA 2O19A 2RB4A 1YZLA 4QUIA 2ZJ8A 5EHQA 3CPHA 1SNYA 1S2GA 2PGIA 4KXWA 5GONA 4RF3A 2O5CA 1H94A 1ST2A 2XUZA 3KOXA 2R8ZA 4MGYR 4QEZA 4YCAA 1EFCA 4NY1A 4XA8A 4F6RB 3UK7A 2VHZA 5DGHA 5IK2A 1CZRA 4PYQA 1JJAA 4HWPA 3WB1A 2WQZA 3WIDA 2YBEA 4ER5A 1H66A 1QP8A 2YH2A 4Y0VA 1LPPA 3MN1A 3RQSA 3B6JA 4UBMA 3CVUA 4L85A 4WOBA 1EFDN 4UULA 3T7AA 2H0AA 1B6SA 1NYQA 1TQ8A 4G5RA 4Y2RA 3VR3D 3F3YA 3COYA 4PSVA 5EFOA 2R0QC 1YR3A 5GOTA 3K5IA 1E92A 1T2EA 4QX6A 4AURA 4LQ4A 4UM9B 1F9EA 2HHJA 1OWNA 1M1ZA 2EL9A 2QD2A 1DX9A 4BVJA 2H08A 4DA4A 3W3AD 2W37A 1CQWA 5WRFA 4CM9D 3TOVA 4HX2A 1XSEA 5JSZA 1A2OA 1CUXA 4RIIA 4CT0A 1IDN1 2CLFB 3HVKA 5KNLA 1PWZA 3HR4A 3QYFA 2FSIA 4QTUB 3TS1A 2UZ1B 2IBTA 4ETWA 1JU4A 1BN7A 2XCIA 1W6RA 3DBVO 1NUQA 8AT1A 5TEWA 2BFEB 4MMXB 4KMSA 1NF9A 2FUG6 4MROA 1Y8FA 3LRPA 5G1OA 4E22A 1GPKA 1W9HA 3LCMA 1X7ZA 3QU9A 2DWQA 3LHDA 3HJNA 1ADJA 5EUBA 7AT1A 1OZGA 4KC0A 3ZVRA 1O95A 3QBTA 2FLKA 1WXDA 3P97A 2GH1A 3TXYA 5K99A 5AW0A 4P83A 1OLXB 2WLTA 1M1YB 2EWVA 3JQAA 1OX4A 4XJTA 4HX5A 3RFFA 2DTDA 4NCHA 1YHYA 1UBMS 1Q15A 1R0KA 2BDUA 2I2WA 3I8OA 4YDHB 3ZC3A 3EF3A 4BIMA 3Q8XB 3H1TA 2ZI6A 4HH0A 3ZDYB 4BKRA 1YAHA 4HV4A 1MG0A 3NU1A 4O6VA 4YJGB 2JLCA 2HFJA 1HY3A 1UZMA 1ZIOA 4JVLA 3H9GA 3BK7A 3CF6R 1ISFA 3DP7A 5HGJA 2H7VA 2QAGA 4GR4A 3WLLA 4LX8A 3RHSA 3GDWA 3O31A 1ISPA 4J0JA 3MBIA 2HX1A 5C18A 2YOGA 1E2EA 3BICA 5FEUA 1X14A 4YP6A 1QHGA 3U3RA 4YT4A 1NVKA 2YYAA 3CN7A 2J3HA 3BFJA 3KQYA 3A4VA 4P3XA 3GP8A 2H06A 3AXSA 4JB0A 4LGCA 2GJAA 2ZYDA 4NH4A 4R0VA 3SWWA 2OQRA 4GYWA 4DBVO 1Q50A 2NZJA 4E6EA 2VPTA 4Q3CA 5AJUA 2UUBB 2PXCA 4HQ6A 1C3XA 1P77A 4NCAA 1V7ZA 3GQVA 1KZ7B 4H3VA 5BN3A 5C51B 1X1EA 3WL4A 2NQ8A 3RCBA 4Y1FA 1EZ1A 3N0TA 1ZZEA 1JXQA 2VDVE 4U1RA 5DEIA 5EERA 1BVHA 3E18A 1A95A 1OTYA 1PCXA 2WSYB 2Z2JA 1NZFA 3RTAA 3BVPA 4B48A 5KOHB 1N3LA 1RYMA 3WK9A 3CNOA 4YJDA 3G13A 1OVGA 3UK6A 2BUAA 1NQAO 5T7BA 4J9VA 4QJIA 3QIAA 1E3WA 3WBFA 1KI6A 1M74A 3BL8A 2DFNA 2AOXA 3TRKA 4IXMA 3W7BA 3LWZA 4M76B 1P91A 1YRLA 1U9IC 3RC2A 1CGJI 2DHRA 4B9EA 5IHXA 1HUQA 3RAGA 2JANA 2ZSKA 3DOFA 4IO1A 5KDDA 4X8OA 3ZCRA 3OTOB 3KLPX 2J87A 5DBGA 5JY1A 5LP6B 3DL7A 3PHGA 1CUEA 2POQX 4HVAA 4QQFA 3ZDXB 3F8WA 3PWKA 1FLVA 1K7XB 4YP9A 1X7ZB 2YXDA 4HNSA 3F2IA 1KXJA 1A3CA 4XCQA 3VH3A 3ZGVA 3T3OA 1CEEA 1DIAA 2F1KA 4C30A 2NUPA 4KRFA 2XEDA 1NM5C 3RNOA 1OAKA 4V0ME 3UNXA 1ZY2A 4M7WA 1T8PA 2BF7A 5CDSA 3JD2A 3EZFA 4L95C 1ZL2A 4HB0A 4QEDA 4OO3A 1GVHA 1PBTA 3RBZA 1PEYA 2KX7A 4XQEA 5DI3B 2IELA 2ZXEA 1RZRA 3P2EA 2W4QA 2GOYA 1SBNE 4KXMA 2BMWA 3CVXA 3K2BA 3Q7SA 4YMIA 4GF5A 3ZUPA 1F0PA 1BX1A 4XDZA 4H6VA 4BHTA 2F3QA 5DM4A 2GKVA 3UCXA 4JXXA 4N49A 2JGRA 4K9QA 1Z5UA 5EQDA 3V8VA 4TM8A 2ISCA 2V0NA 3D7LA 4AF6A 2VK1A 1SRRA 1YCHA 2O0MA 2VNSA 3UO8B 1YKGA 3SHVA 5A2GA 2PCLA 4ONEA 2X3YA 4LG1A 3LUBA 4NMXB 4ZANA 1UP6A 5LXTA 3IX7A 3PJFA 4I1UA 5L7YA 1BDBA 4UDYX 1OUMA 2PT5A 2ZI9A 4EJSA 2E21A 4DZZA 4F96A 1WY7A 1VMKA 2YY6A 2P6PA 2YZNA 5AESA 1PZEA 4YNBA 5EAIA 3E03A 1BH6A 5LIPA 2HAEA 3PC3A 3MMXA 5J58A 2D4AA 5THKA 2DHEA 3O4GA 4IQ4A 2HSZA 4NFHA 3VU9A 1BMOA 2AVDA 3ESDA 2GILA 3G8AA 3SC2A 1GPMA 2CXTA 1UPTA 2WQ6A 1T8YA 2M6LA 1YT5A 3WO1A 1THMA 4QIHA 1J0AA 1QRSA 2KMLA 3OOSA 2YICA 4F3TA 1G3RA 1U4NA 3F6RA 2D54A 1JAXA 1SG6A 1M2FA 2BEWA 5KWIA 3VH2A 2QLFA 4CKEB 521PA 3T7JA 3BORA 1OSNA 2HBRA 4AKTA 3VH4A 3GJSA 2M5XA 1T8WA 3HU2A 5LYYA 1TOAA 2QAJA 3IAM1 5AM2A 1FRNA 1QAMA 3JZAA 3CF4G 3L8DA 4QUGA 3AL0C 3WNVA 1TA0A 2ERYA 1OPRA 3GJZA 1X7DA 4BMNA 4Z1MA 1IOLA 3ORHA 4CLOB 4RDXA 4K88A 3LBHA 4O4HF 1YL7A 4PO8A 1H23A 2YXEA 1MXFA 1HYGA 2MINA 2J48A 4C2UA 1C9EA 5JO0A 3G2MA 1DQYA 3KXDA 4A8PA 2DLCX 1W1WA 3OPQA 5AM0A 4AY3A 2XRMA 1IZ9A 2AWOA 5P8WA 1LKZA 2XNKA 1X7XB 2PH3A 3ZE9A 5BXYA 4OJMX 1GKKA 4QRDA 3DEKA 5FEMA 4D44A 2IYUA 5CFZA 1HORA 4X9XA 3O3OB 4GP9A 1YC5A 2PL5A 2VF5X 4PLGA 5IM4F 2GBFA 3M1AA 4C14A 1UAAA 4I4NA 1BXGA 1F5SA 2NTJA 3RVRA 1HOTA 1XDBA 2CDCA 1WVIA 4UMEA 5REQA 3WNDA 5FWDA 3VM6A 2C9ZA 5KDOA 1CVLA 3B3FA 3EQ2A 4I8XA 2OOKA 1YBHA 4UPDA 4Y2VA 5EVJA 3MLBA 4YROA 1GQOA 3BBLA 3OBBA 3TI9A 3LQRA 5AVOA 4D02A 1E4YA 4AU1A 5L6MB 5JAOA 3MWEA 5KQRA 16PKA 2WKQA 3OA2A 5AH0A 1XFDA 4JZKA 5F7XA 3FHTA 3DE1X 3D8TA 1N0VC 2AFIA 4GGOA 2WG0A 3IRVA 4LW8A 4NV0A 1JR3E 3KEGA 5LU9A 2J0QA 1N0UA 1FFDA 2XDWA 3TLGA 4POAA 3ZZ1A 5C4IA 5G4LA 2WSSD 4LV5B 4TWZA 3WLFA 3QNUA 3HO8A 1STOA 3JATA 3CT4A 4FYXA 4WCDA 4AF7A 4WBNB 1WO8A 3THYB 4Y6PA 3P2MA 1J90A 1RXYA 5KX5F 1UINA