2QPOA

Thermotoga maritima thymidine kinase in the apo form
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
180
structure length
153
Chain Sequence
SGKLTVITGPMYSGKTTELLSFVEIYKLGKKKVAVFKPAHVIERPEEMRKYIEEDTRGVFIDEVQFFNPSLFEVVKDLLDRGIDVFCAGLDLTHKQNPFETTALLLSLADTVIKKKAVCHRCGEYNATLTLKVAGGEEEKYIAVCRDCYNTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidine kinase
publication title Quaternary structure change as a mechanism for the regulation of thymidine kinase 1-like enzymes.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 45
structure length 153
sequence length 180
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2007-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2qpoA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qpoA01
1AS3A 3DKPA 4BWYA 2JEOA 2JJ2A 4RJLA 1JQLB 1CKEA 1GIAA 1QDEA 2FEOA 2F1RA 4LYHA 4L8GA 2RMKA 3EC1A 3LBIA 4PPQA 5JMTA 4MGYR 4V03A 4ARZB 4JLNA 3HP1A 5M04A 2WWYA 2D2EA 1ESMA 2E1RA 3BORA 2ZJ2A 1GP2A 4QXAA 1E0KA 4PX9A 1F2TA 1G5RA 4CEJB 2ENZA 1U0JA 1XCMA 2F7SA 3IDQA 4GSYA 2UZIR 3RDPA 4DEYA 1KI4A 2DY1A 2VSFA 2WJVA 3G82C 3QOFA 3HYRA 3ZQJA 1KKLA 1W2HA 3MUFA 1UKEA 3I8SA 5HZHA 5CK4A 4M9ZA 2ZJ8A 5SZHB 1J70A 1YZQA 3TUJC 3WP1B 1Z07A 1XCGB 1CP2A 2JCSA 2ZJBA 1KKMA 4TMXA 5JSZA 1KAOA 5FL7A 5BN4A 3KQNA 2IS2A 4CGZA 1E1RA 1E96A 2N42A 3GJ8A 4JKYA 3SYKA 3BAFA 5KO2A 5DO9A 1QG2A 2P3SA 1US8B 3CUEF 4OI2A 1KI7A 1E9EA 2GF9A 4RSGA 1EFRA 2A7QA 2VA8A 3UMSA 4OQLA 5B64A 5A5GA 2VRWA 4LV5B 2ECKA 4RKEA 2OCBA 1Z83A 1G1MA 3F3YA 3OE7A 4ACAA 3LX8A 3AF4A 3AP2A 2W6JA 3GFTA 4GOXA 4BEBA 3BFVA 3KJHA 2IEZA 4NPHA 1T5IA 4MITA 4DIEA 3TJZA 4AI6A 4LYAA 2ZETA 1Z6GA 3P20A 1Z6TA 2ATVA 4OHZA 5B58C 4OK3A 3SQWA 1CBUA 3CPEA 3WHLA 2ZANA 1OH7A 2ZRHA 3QENA 1OYYA 3B5JA 1YE8A 3TNFA 2H5EA 4Q1FA 2WVJA 1NN1A 1NBME 5KDOA 4D4MA 3SZRA 4JLPA 1CR0A 2A78A 3LXRA 4K46A 3EPKA 4EIWA 4K81B 4RD0A 2FPMA 1IY1A 4CW7A 5FL3A 2QPOA 2CNWA 1KDPA 1NLYA 2WMNB 4JBXA 2UZ3A 5TVKA 3UGLA 2JLXA 2BMJA 1G8HA 2OHFA 3ZVRA 4ZI2A 2AXNA 4JJKA 4DLVA 2GEDA 3KXIA 3EZ6A 4PPGA 5J5CA 2AL7A 3W8RA 3CXLA 2IXEA 3FMIA 1Q1ZA 2ZR0A 4XWAA 3KB2A 4TMKA 1NRJB 2GDJA 1GZSA 5J4KA 4XIGS 4ESHA 1FP7A 4I4LA 1IY2A 1T8TA 3DDCA 4AK9A 1PJRA 1ZNXA 4TTRA 3LBNA 2DBYA 2RGGA 3A1UA 4KFUA 1LVGA 3E2IA 1BOFA 2G0NA 5K8TA 1OPXA 2BMEA 3GJ4A 5AJZA 3R9IA 1B0UA 2R6FA 3T12A 3RC8A 4QJ4A 3CONA 3K0CA 3TAUA 1W0JA 3B78A 1QF9A 4ZIRA 1Z2AA 4BGDA 2CE2X 2GJ9A 3HU1A 1Y3AA 2YOFA 1F3OA 2ZROA 3RS0A 3KX2A 1TU3A 1K8RA 4HZIA 1DAFA 3PQCA 4HAWA 3QEJA 2DFTA 2FE4A 1CJUC 1H65A 1T6NA 2RGDA 2XEXA 3KFXA 4G5OA 1ZIPA 4QKQA 3KQUA 1BMFD 4AKGA 2QORA 1G9XA 2RGAA 3HU3A 1I4DD 3PITA 4FMDB 3QKRB 3LAWA 1S3SA 1YJ5A 3OIUA 3SN6A 3QIAA 2EFHB 4Q4JB 2W0MA 4TN1A 1AQYA 4JJZA 3QF7A 4UNRA 2ZE6A 2ZI7A 5JI2E 2QAJA 3EARA 1ZRHA 2GKSA 1XEXB 2F55A 3ZS9A 4Y0AA 2IYQA 2WWIA 4FMCF 2F9LA 4HLQB 4PQRA 2IWRA 3G0HA 5CJ2A 5KTYA 3UATA 5FUVA 1GKYA 2B6HA 1VKJA 2MSEB 4PC3A 3QQ5A 1QHXA 2QT1A 1DAGA 5C1BA 2KE5A 2IYUA 2HT1A 2I4IA 2UKDA 4A82A 4OYHA 1M7HA 2A30A 4DXAA 2OBMA 4Q1DA 2YOGA 3KUCA 3K09C 1XTSA 3EAQA 621PA 5DI9A 5CB6A 4AYWA 2ZYUX 4IOLA 1OJLA 1QHSA 4IDQA 4MYCA 1XXHE 3SJZA 1COWA 4C9BA 2R9VA 3NC1C 2CHVA 2XITA 1KK3A 3NWJA 1NY6A 3SDZA 3W6OA 4EAQA 1KSFX 3QKSB 2NIPA 4B3XA 5DISB 2QZ4A 1UPTA 2WPDD 1PLLA 3O47A 1YZTA 2VLIA 4E03A 5H8WA 1PTQA 1K6MA 1R10A 5EE3A 4B34A 1LY1A 3D31A 5FBRB 2DFLA 2QENA 2GJKA 3F5FA 1F5NA 2V6JA 3RWMB 2FF7A 3WYGA 4P0TA 1R79A 2ODBA 1Z0KA 3WYFA 3CB4A 3ZH9B 2AFIE 3FFBA 4IEIA 2Q9AA 1KI8A 5G3ZA 3ECCA 1KI6A 3EZ7A 1Z28A 1S1CA 3QUSA 2YKGA 3K0AA 1EK0A 4C0SA 2DB3A 3R9XA 3B7GA 2SHKA 1JPNA 4R2HA 5JCZA 1NSTA 4MRPA 4PTLA 1RZ3A 2JIZD 4RCZA 5AUQA 4QHYA 3QPVA 1SXJE 1IHUA 1ZUNB 2DWQA 3K0FA 2D2FA 4A8JA 3NEYA 1NI3A 5DYGA 3T5GA 4DLWA 3OESA 4Q21A 3GEHA 2NG1A 1XXHB 1KO5A 4A9AA 3O8DA 2KB0A 3AP3A 3KB1A 3KL4A 4NCKA 5CLLA 5FTJA 1KAGA 3S1AB 3CNOA 2W58A 4QNRA 4QL3A 4JYCA 3SNHA 3G5UA 4FWIB 4B75A 1QZXA 4MKIA 4P4UA 1PUIA 4U00A 1E3MA 1G3RA 3IHLA 2DFNA 3AGQA 3MJHA 3P26A 3GLFA 5AR1A 2JJ1D 2J0QA 5D3QA 2ZI3A 2JA1A 5FOTA 2D7CA 1AJEA 1KJWA 5EP4A 1GKIA 2QGZA 3U44B 1SXJD 1Z2CA 5AK0A 4TYNA 4BRWA 1SXJC 1I2DA 4E09A 2ZYVX 1DEKA 1ZC4A 4M1KA 2PEYA 4G5RA 4QRHA 4U7DA 1TQ6A 1DADA 3KKNA 3NXSA 5L3SB 2HCBA 2JGNA 3PFIA 4JBYA 3V4FA 1W36D 3SS8A 1AM4D 4MRNA 1VCOA 5IT5A 1KO4A 1VG1A 2GESA 1TTTA 3CO5A 5FBVB 2ONJA 3KQKA 1SXJB 2Q3FA 3GLGE 3KQHA 1M8PA 4QOSA 3MGCA 4D26A 3R8CA 3C5HA 4QM7A 3R7WA 2XNDD 4IKEA 1XPRA 3BD9A 5CM8B 4A15A 1GM5A 4LYFA 2AK3A 2Q3HA 3WRXC 1G21E 2WJGA 3D3QA 1OHHA 1G18A 1Z22A 3DOEA 4L9SA 3I4LA 4DT1A 1T91A 1HTWA 4B33A 2DWPA 4DJTA 5AJWA 4LI0A 3X1YA 4Z51A 2FSGA 2BHRA 4IFBA 4Z54A 1JJVA 3KKPA 4V0OA 1JBKA 1HA3A 2BOVA 2ZREA 4ZI3A 1OB5A 3HR8A 1E4VA 2RHMA 3EZ9A 5DI3A 1MO5A 4DWJA 5KNCA 2ZRCA 1NP6A 3HR7A 4LZZA 4DSNA 2WKRA 1MKYA 4Q9KA 1FNMA 3FMOB 3LXXA 1IM2A 2IS4A 2BIFA 1E9RA 1X6VA 3REFA 3U7EB 1KZ7B 4NDZA 4M2LA 2YUUA 3OF5A 2HLDD 3LVQE 2QRZA 3X1WA 3GLIA 1OIWA 2FSHA 4QC2A 4B6DA 2ZSEA 1N6HA 3ADDA 1RJ9B 3GLGB 1JECA 2DCUA 2CCJA 2IBMA 2Z6VA 3QBTA 1YVDA 1W47A 2RKOA 3ADBA 2IA5A 2QGNA 1II8A 1S0UA 3ZD7A 4M1SA 2O8BB 3TBKA 5JI3E 5KOYA 4E5UA 1GUAA 2A5GA 3KKOA 3NC0C 4US0R 3SU8A 1YRBA 2A3RA 2NZ8A 3VU9A 1JR3D 3OEHA 4A0HA 4IEEA 1FMLA 1GRRA 1FUUA 4KCGA 4DKXA 2FSFA 1L4UA 3SJAA 5FOXA 4OHWA 3TSOA 2VH5R 1NVVQ 3SHFA 4JLKA 4DDWA 1SVMA 4BZPA 1Q22A 4UNNA 1MRNA 2QSYA 3HPQA 1TQ2A 3SJBA 1TAGA 5IF9A 3IBGA 1NJGA 1GG2A 3A4NA 3THOA 3A4MA 3A8TA 4WA7A 5AUNB 2EU8A 2AX4A 3VNVA 2H8KA 1NIJA 4DVGA 4JVLA 3PV0A 2YOHA 4PAQA 1NL3A 3PEVA 1ZC3A 2C78A 4GP6A 4QBGB 2GCNA 3NDPA 4EPTA 4AC9A 1AZSC 3CF0A 3B1WA 3BH7A 3GJXC 2XOKA 3TVTA 3VQTA 4F7WA 1AS0A 3AVUA 1BS1A 1E2EA 2PEZA 4UQOA 4HAZA 2N1BA 4LJ6A 3EIHA 4PHFA 1Z0IA 3RSLA 1W5SA 3L0SA 4MYUA 1XB2A 3QNUA 4NYIR 4QGGA 2OILA 5CIWA 2ZSAA 3QVVA 3EPLA 4B3GA 2W6IA 3MRSA 3LLMA 2KWIA 2Z4RA 3Q85A 3SBDA 2QE7A 2RB4A 4CF7A 4RD6A 2QBYB 1ESNA 1ZNZA 3REGA 1P62B 3C14C 4S35A 3VR1A 1QHHB 4TMTA 1QBKC 4RD3A 5FOWA 4CZ2A 4ZDWA 4KVGA 2OM2A 4XSGA 1G64A 2HF8A 4Q1CA 2J0UB 3ZZUA 4L4UA 3MWKA 5A4JA 5BQ5A 1CR4A 2BBOA 3DEFA 3IIMA 4PQYA 2CBZA 1OE0A 4HLCA 4YDSA 4BLQA 2F3RA 1KZGB 4TLEA 4TYWA 2ZTSA 2QY9A 4BZXA 4IOMA 4R2IA 3UEYA 3B1ZA 4NCHA 4ZDJA 2CE7A 3MAAC 1OT3A 2WAXA 2ZM5A 4JSYA 4N3NA 4LGMA 5FTNA 1ZM4A 4I81A 3SI7A 1Q3TA 1Z6AA 3H84A 3THWA 2CLCX 1ONBA 1N6NA 2GVZC 1DARA 2C8VA 3PUYA 1WBBA 3T1TA 3DHWC 2OCAA 3RRNA 2WIBA 4MUAA 3AEZA 4FIDA 5L3RA 4A6PA 4HUQB 4JVMA 4ZDKA 4ESVA 1Q20A 4XSHA 1KDTA 2Q9BA 4D81A 1IN5A 3Q8XB 4B71A 2GZAA 2XZOA 2XB2A 2NO9A 4KITB 1BYUA 3CIOA 1E2GA 4LHZA 3T61A 2VSOA 4DUGA 3PUZA 3IO5A 1CR1A 2ZVPX 1KY3A 1GRNA 2V55B 3FPAA 2EYUA 3PUVA 2BJVA 1LTQA 3TRFA 2BBSA 4PZLA 3Q9LA 3VR2A 4AKIA 4D2IA 1R5NA 3SR0A 4Q47A 4Q7JB 3P27A 2R44A 1J8MF 3PIRA 1F6BA 4PZYA 4DDTA 3EIEA 4KFTA 4HDOB 1GNPA 3W3AA 1VPLA 5GVRA 3D6TB 4AYXA 1HV8A 4LHVA 1W5TA 1UEIA 1U94A 1S9HA 2X77A 2YWEA 2VP4A 4OKSA 2HDNB 3DO6A 2A2ZA 2BKUA 2RGXA 4C0BA 2EWWA 4DBLC 4F4CA 1IJEA 3QKUA 3NH6A 3QF4A 4GPTA 1RE0A 4F92B 4RD1A 1XFAA 1KJYA 1YR8A 2GZHA 4BEJA 2W2TA 4L16A 3VKHA 3SEAA 5B2ZA 4LHYA 1K5GA 1U8ZA 3PEUA 4MGZR 4PR0A 4PFSA 3UFFA 1FUKA 5FPYA 1UBEA 2CJWB 2VYFA 3QJYA 1NG1A 1E9AA 3WBJA 3L8YA 5F98A 1VTKA 1TNDA 2GRJA 2GBLC 3ADCA 1A2BA 2GJ8A 2KI5A 2XTMA 3FWYA 1WA5A 1KMHB 2YVUA 2GNOA 4HAXA 2YJTD 2V54A 4OQMA 1ZVQA 5LB2A 3ZVMA 2BKEA 3GJ7A 1Q3HA 1XZPA 3O8RA 4BUJA 5KSYA 5SZIA 3LQQA 2QT0A 1XD8A 3DPUA 3K9LA 4V0MA 4D0LB 5LD2C 2F6RA 3WMEA 4DCVA 1XEWX 4FKDA 3L82B 4O0MA 2ZRFA 1M6NA 4NTZA 3VX3A 3U4QA 3FGNA 4NHOA 2ZJ5A 3ZD6A 1OKKD 2Z0MA 4B32A 2P0EA 5P21A 1ZYUA 3UXMA 4F91B 3U61B 2GVIA 3FKSA 2QAGC 4KLZA 3SJCA 1XWIA 5EJEA 1GTVA 1F2TB 3K53A 4YXWD 2CCKA 1I4LD 1NMYA 4W5WA 4CRWB 5LD2B 2QM7A 4PC6A 3A1VA 5TB5A 1G5TA 3M6AA 1P3JA 1P2VA 1IONA 3R9WA 4URUR 1LV7A 2AHOA 3VKGA 4D0NA 1D9XA 5JBQA 4FN5A 2ODNA 2QAGB 4RFVA 5DSZA 4IVQA 5CB8A 3SYLA 1WQ1R 1NVUQ 5L3VA 4Q9JA 2YYZA 4EFNA 4WIAA 1O87A 1I2MA 1VYUA 5AJXA 4Q00A 5H1YA 4L9MA 5JSZB 5DGXA 4NYMQ 4G5GA 1SVKA 3CZPA 2R6AA 2OO7A 3SYNA 1SKQA 2FGKA 4Q9HA 4QHSA 1GVNB 3CBQA 4PSAA 2VBCA 2FZLA 4G01B 4X8LA 4Q1AA 4C7OA 3EWSA 4D4JA 4B3CA 3TKLA 2O8DB 1Z0DA 1RRFA 2WJJA 3VHLB 2VRWB 3LRPA 2X1VA 3TW4A 1DTSA 1GDDA 1W2GA 3D8BA 4Q7KA 1HH4A 3CPJB 5B30A 3PVSA 2A5FA 3RAPR 1N5IA 2BMDA 3GFOA 3TSWA 1IXRC 2HEIA 1U9IC 3SFZA 2J0SA 2ZRIA 2BBWA 1DVRA 4UJ5A 1UDXA 1H8HD 1G17A 2A9KA 2IYRA 1MABB 2XSZD 3IPXA 3EX7C 3PENA 1HY3A 2EYQA 1ZCBA 2VIIA 4KAXA 2V3CC 5F9HA 1G3QA 3MWYW 4FINA 4AD8A 4C2TA 1YZKA 4LHWA 5IK2D 1T8UA 3AF3A 3WHKA 4Q4HA 2GEUA 3C8UA 2EFEB 5AJVB 2QQ0A 1NLZA 2PLRA 3CR7A 4MA4A 1E79A 3GQBA 1TF2A 3Q72A 1J90A 2I3BA 4IHQA 1TUIA 4JVSB 2RGCA 4C0AC 3LH5A 1MRSA 3UMRA 2FX3A 1N6IA 1NKSA 3ETLA 4PPFA 3JZAA 1RPZA 4HB4A 4MGIR 4Q19A 5KUTA 1AQUA 3PR1A 4HAYA 4LHXA 4HLUA 4A2PA 1W4RA 2JDIA 5JS8A 1W4AA 2NPFA 1E2MA 3RRZA 1KJZA 2QL6A 4WVFA 1P61B 1JB1A 1YR9A 2G83A 1S9DA 2PJZA 3QSYA 1W0KA 3AVTA 3DVLA 2FPKA 5IRCD 3AM1A 1OFIA 4II7A 3RNLA 4BECA 1Z0JA 1H8EA 1OFHA 3T34A 4V0LA 5TY0A 2AWOA 4NYJR 1MT0A 2LKDA 2ZE5A 3AKEA 4IW3B 4Q9LA 3K0CC 5TDHA 4TTQA 3BFXA 2HUPA 2ZSDA 1PTRA 1GSIA 4MRRA 1M1YE 5C18A 3PG5A 4JLVA 4KSBA 5JWHA 2K5UA 4LBYA 1N5KA 3U3KA 5G53C 4GBMA 4EPWA 4KYUA 3I73A 2IUSA 4ZIRB 5EP1A 3SE0A 3CR8A 2EFDB 1IN7A 4GZMA 1XMIA 1BKDR 3BXZA 3SHWA 1ELOA 3VTKA 2J7PA 4MKFA 2WBLC 1R8SA 4NCNA 4EJSA 3QI2A 2HXSA 4HAUA 3DOFA 4H1UA 1SKYE 5FR1A 1U90A 4Z8YA 2O8CA 3PJRA 2HF9A 2FSIA 5EE5B 4BRUA 3AUYA 3QEOA 2RGEA 1R5OA 5KNDA 5HCIA 4OI0A 5JEEA 2WSMA 3X1DA 4TQUS 1Z06A 4NBSA 4AIIA 5FI0B 2KJQA 4YC7A 5BWMA 2NTYC 2W0SA 3O8BA 4LJ7A 2OAP1 2IYXA 2ZJYA 2QG6A 1JJ7A 3EA5A 2FJUA 1OSNA 3TAHA 2G3YA 2VP0A 4R71A 5LBIA 2ZRBA 2BWJA 4ARZA 5BN5A 3X1ZA 3TQFA 1UKVY 3CW2A 1EX6A 1P9WA 2UVQA 3UG6A 1CF4A 4JLAA 2IYVA 1UKYA 1II9A 5J4HA 1G20E 5FTMA 4EPVA 2ROWA 1E2LA 2FGJA 3TE6A 4O25A 2WOJA 3K70D 4Q02A 1EFHA 4DC9A 3K70C 1X8JA 4AG5A 2ASEA 1GNRA 5F2EA 3TR5A 1NBMD 4US2R 1CXZA 2YWGA 4G0NA 4AURA 3I3SR 1NMXA 2O0HA 2H16A 4ILEA 4LJYA 4OI4A 1VMAA 3TW8B 1ZUHA 4GT1A 3UK6A 1NN3A 1E99A 2R8RA 2F9MA 4PZZA 3OAAD 1SKYB 2IUTA 1VG9B 3OHMA 4M0LA 4G5SA 4LDJA 2ZRNA 1PZNA 3K70B 1AA9A 1HURA 1U0HC 2NGRA 1FQJA 4HDQB 2JLRA 1EX7A 2GVDC 1N6KA 6Q21A 3GLHA 3I92A 2PBRA 8OHMA 1VIAA 1US8A 3A1TA 4MDFA 2G1JA 1EWQA 2D74A 3P4XA 5K8UA 3OEED 4P4SB 3TSZA 2AFHE 5DN6D 3ZIAD 3GJ0A 5BW8A 1WCV1 4YMWA 1JAIA 5HR5A 1UFQA 1GAJA 5D3MA 5FBLB 2V1UA 2PMKA 4AG6A 3THYB 3LV8A 1CR2A 3K9HA 3RS7A 2PCLA 4NH0A 5FUYA 4LSGA 1U0LA 4LPSA 2CXXA 3EA0A 4WZBE 3RS4A 4BLRA 5TARA 4BZQA 3H4MA 1J7KA 1AIPA 4DLYA 3K0FB 5EUMA 2WWGA 1Q57A 1KK0A 2R65A 3FDIA 1R0ZA 1SULA 2XZPA 3I32A 4TZ0A 1OW3B 1L7VC 4IOKA 4B6FA 1ZNWA 3WP0A 3C5CA 5FI1B 4BLSA 1KO8A 1SVSA 5FPTA 2VP6A 2Y8EA 4A6XA 2QMEA 3WYAA 3U6BA 4ABYA 2ZQ5A 2QEQA 1AN0A 2ERXA 2FDCA 4P32A 2X2EA 1GNQA 4C30A 3OIYA 1JXMA 2YHSA 4I1VA 2QSZA 4UXHA 4W5JA 1I4TD 1G7CA 4QJ3A 2IF2A 5L3QA 2QU8A 2WJYA 3LBHA 1VHLA 3GP8A 4HI0E 1ZUIA 4CYMA 4DDVA 4FI3C 1FX0A 1MO6A 2OXRA 1Z08A 5C4MA 1VCIA 4MRVA 5EE0A 4MQBA 5FPHA 1F2UB 5CK5A 2YV5A 4IJMA 4BQSA 1P73A 5JZVA 3T1OA 4KJZA 2Z43A 1UJ2A 2GHIA 4TSFD 2VHJA 5EUQB 4EQ6B 3X2SA 2VHCA 2Q9CA 4RCYA 4BPBA 1R5BA 5ELXA 4PPNA 3L0PA 5SZKB 3UGDA 1G19A 4TZ6A 1HT1E 1XX6A 1J8YF 1A7JA 2VP2A 5JJLA 4OQFA 2JLUA 4D0GA 4NKRA 1XCPA 4B3FX 4KI0A 4O3MA 3NBZC 1GFIA 2OLKA 5BN3A 3CNLA 1NBMA 2JATA 1C9KA 3FFAA 4NMMA 3B9PA 5FBQB 3PEWA 4DT1B 3MSXA 5CJPA 2J1LA 3X1XA 2FNFX 1L8QA 3ADKA 5CIQA 4N1AA 5KSPA 3RVBA 2BM0A 5J4YA 3EXAA 5DE3A 4FMBB 1E32A 3QKRA 4ZKDA 4M53A 1HEIA 2FFAA 3EIQA 5DI3B 5C2JB 2XTZA 5K8LA 2QPAA 2A5YB 2OAQ1 3KTAA 3VAAA 1VHTA 1VCMA 3FB4A 5DYIA 3ZZ0A 2AKAB 4TMZA 2ENNA 4BFZA 4L9WA 3PXGA 4FXPA 1T3SA 3ZIAA 2RCNA 4RFSA 4TLDA 3BH0A 1BMFA 4TLBA 3A36A 1KNXA 1Z6YA 2J46A 5DIFA 1DAEA 2OE2A 3NVAA 4OHVA 3GLIB 3HYTA 2ZUBA 3WBKA 2HV8A 1IN8A 4OBEA 5IHPA 5LDDC 3VR5A 1XTJA 2IX3A 4IFEA 3VX4A 2B21A 4B2IA 3THXA 1OB2A 1W4CA 3RSOA 4HAVA 4ZCIA 1D2MA 4B47A 4UNPA 1IAQA 1XD2A 1Q0UA 2OZEA 4I1OA 1R0XA 3CX8A 4BFUA 2IEYA 1VYVA 1D2NA 1HQCA 5DLQC 2ZUCA 4PC7A 4M8NE 1WP9A 4TQ9A 3BJIA 1LNZA 2V7QD 3SFVA 1TPZA 2JASA 4WZ6A 1R2QA 2LWIA 5AJYA 5LB4A 3AKDA 1K5DA 3UANA 1OH8A 2O8FA 4C0JA 5BYJA 4CT5A 2D06A 4IDOA 1E1QD 3W8NA 1A1VA 1F60A 1KYIA 1SQ5A 2WM9B 2X8AA 3KXKA 2O8EB 1D8TA 1DG3A 1LW7A 4FCTA 1S1MA 2CL0X 2ZRAA 2MSCB 5JRZA 1B23P 4QGAA 4XWOA 1VG0B 1GWNA 1ZD1A 2WPDA 1G7SA 1HQYE 3LVRE 4YONB 4D82A 3OZXA 4LOAA 2ZS7A 4XVQA 3CM0A 5HKKD 3PEYA 4CEIA 4JLJA 3LNCA 4ZPXA 2OFOA 1G7RA 2FV8A 1JEDA 2XAUA 3FE2A 4WBSA 3GD7A 4ASUD 3VHXA 1CLUA 1MO3A 2XXAA 2CVFA 3GEIA 1J99A 1KMQA 2LKCA 2ZI4A 1HE1C 2QMUA 2CCGA 2AR7A 3RANA 1SZPA 2JIZA 1Z3IX 4XWKA 5JCPA 3LD9A 1P75A 4CVNA 4CT4B 3CWZA 3AKYA 1ZNYA 2B92A 2GXQA 2V4ZA 1QHIA 1U8YA 3NTUA 4DCNA 5J4VA 2Q3MA 4DSUA 5J4LA 4PXAA 2RHDA 1NLFA 3QE0A 2QI9C 2GXSA 3MWLA 4IXMA 5EE9A 5EP2A 3MG9A 2V1XA 4ITRC 4Z1MD 2P6NA 3AP1A 1XMJA 2IW3A 3AQ4A 1G3MA 1NN5A 1X1SA 3HJNA 3UMFA 5JJKA 2CDNA 3F0TA 3A4LA 1FARA 2DHRA 3B1YA 3TUIC 4FMDF 4UXJA 1NKTA 4DLZA 5L3SA 4JZKA 5JFGA 4C2UA 521PA 5F3WB 1FQKA 1Q1EA 3IBYA 2JJ1A 4UXIA 2IXGA 3THWB 1EGAA 1T4GA 3K8YA 3P4YA 4TT3D 3EPHA 3U2QA 1ZU4A 1D6JA 1SXJA 4PSKA 1CJMA 1TUEA 1FL9A 1AGRA 2J45A 4PANA 1CJTC 3AKCA 4WW0A 2GAAA 4PHHA 4KXFB 3T06B 3M1IA 4HZUB 4URZR 3NBFA 3KUDA 4TL8A 4LUCA 3KY9A 4IRUB 2XB4A 1RRGA 1G3UA 2CK3D 1IOZA 4R98A 1EXMA 3M4YA 3RWOA 3A1WA 4TLCA 4B73A 2NPIA 1P9NA 2WHXA 3CZQA 2WKQA 3T15A 5HPYB 1IXSB 4A36A 2ATXA 4KYIB 4XD7D 1G3IA 2V7QA 1T9HA 1E9DA 2P65A 2H92A 2NQ2C 2REBA 2PL3A 3IILA 2XNDA 2DR3A 4I1UA 1EFCA 2HYDA 2W2VA 4GFDA 3F8TA 5JECA 1V5WA 2CEAA 3WNCA 3RS5A 4V0ME 4NCJA 1Z6XA 1T3HA 4DCSA 1JNYA 2EFGA 4AKHA 3EC2A 4I1SA 1UBGA 4OI1A 1XMVA 3DMNA 4F93B 2OBNA 3U7HB 4QGHA 4JLDA 2VHTA 4HYYA 2CL7X 1YZNA 4P4TA 1ZCAA 2AWNA 1R8QA 2FNAA 1OXVA 4NCIA 3AVWA 3QF4B 1AKEA 1RJ9A 2VP9A 1FTSA 1YZLA 1E94E 2J0VA 2J59A 5HKKA 2J7KA 2ZVQX 1HYQA 2O8BA 1GL9B 1XD9A 1WB9A 3FHCB 4U5XA 1FFHA 1OXTA 4Q4AA 1JR6A 2HLDA 2ZXUA 4IOJA 1CEEA 4YMUA 1EFUA 4JKIA 3QXHA 2HCJB 4XTCS 1YRAA 1TEXA 2X2FA 1WE2A 4TLAA 4DZZA 1JEEA 2Z5FA 4A92A 2IYYA 1RKBA 4CIDA 1OIVA 2PLFA 4QM6A 1YHNA 5E7JA 1W44A 2JLZA 1E2PA 4CEHB 3FOZA 3Q3JB 1P2SA 1W7AA 2GXUA 4Z8XA 2PT7A 4LV6A 3VFDA 1LB1B 1JR3A 2GTPA 3ICEA 4A2QA 4KFRA 3A1SA 2C03A 3GJ5A 2OBLA 4R9UC 2OFXA 2VF8A 5AWFC 2IUUA 4NYIQ 1G6OA 2YINC 1RRPA 1NN0A 3LWNA 4M9XA 1E0JA 1NIPA 1R0WA 3EW9A 2HT6A 3DMDA 1VIYA 4AYTA 5G40A 4EPYA 3AB3A 4TTPA 1S96A 2O52A 1U81A 4M1OA 4URWR 3LW7A 1P2TA 4GDFA 1ZAKA 1KOFA 1E9CA 4QFMA 5TXGA 4A0FA 2DYKA 3BB4A 1XRJA 1QHNA 2CVHA 2QUZA 1PLKA 5G41A 3MFYA 3B2EA 2QP3A 3UWKA 1IBRA 1XJ0A 2GCOA 4LCBA 4RZ3A 2DB6A 1S3GA 3TVDA 2G1KA 2B7BA 1QHHA 2BCGY 1FAQA 4ON9A 4WZAE 1JI0A 4V0KA 1T3LA 1ANKA 1E2KA 1ODFA 2GETA 2OCYC 4GRAA 4S2EA 2P6RA 1Z0AA 2D7DA 2YC2C 1CRPA 3T1VA 5C46F 1JQJC 4KSCA 4A0GA 1P7CA 3B85A 1TBNA 4B43A 5BYKA 5FR2A 2JJ2D 3WNBA 1BYIA 1NY5A 3KDSE 3AGPA 1RRCA 5FOVA 4FD2A 5TV2A 2C98A 3AVVA 1UF9A 3PUWA 4D6PA 3ZVNA 3VR3A 1HT2E 2RGNA 4HDCA 3QXXA 2QMOA 3HU2A 5DH9A 2MSDB 1NNEA 3MLEA 1XEWY 2VHQA 2G88A 4DLRA 2ZJZA 3K9GA 2WJIA 3EG5A 1DOAA 2QTVB 4JSTA 1KY2A 4TL7A 4MGKR 1DO2A 4XOIA 3NG1A 3UKDA 2R6GA 1DS6A 1LS1A 2PZGA 1N3BA 2ANBA 4HATA 2IS6A 1WBDA 1ZM3A 5JWRA 3RRMA 2CMKA 3IPYA 3IUYA 3L0IB 3AF0A 4Q4HB 4UNQA 3W90A 4C3ZA 1X1RA 1OYWA 1ZBDA 3U3MA 4JLOA 4MUBA 3TLXA 1XA6A 3B8HA 3BH6A 4AKEA 5EQTA 5KDLA 5FL7D 1ZJ6A 3IQWA 1KK1A 1BO6A 1X3SA 2ZI9A 1C1YA 4GZLA 1E1RD 2ZAMA 4LC0A 1DO0A 4JMPA 4UKDA 2GF0A 4V02A 4M1TA 4XH9B 4H1VA 1ZM9A 4JL8A 1S8FA 3MD0A 1EFRD 5CDFA 4DEXA 1M2OB 3HWSA 2I1VB 3VKWA 4M22A 2ZR7A 5KDDA 1P5ZB 2IF0A 4Q03A 4Q66C 3OE7D 3N5CA 4FMCB 1Z0FA 2PCJA 1KSJA 2VQSA 2W6JD 3VNUA 3FTQA 2GK7A 2BV3A 2ODWA 3H2YA 3WXMA 1W4BA 2O0KA 2XX3A 4W5HA 5HTKA 1SVLA 3UG7A 3C15C 2ZE8A 3DM9B 4RVCA 4EJSC 3NDBB 1G4UR 4GNKA 2D4HA 4DRZA 1QHYA 1YR6A 2JLVA 3KKQA 3B1VA 3WMGA 3WY9A 3ASYA 3CF2A 3CNNA 2OG2A 1P6XA 1CULC 1V43A 5HZKA 1OXSC 1L4YA 2C95A 3BE4A 2OFWA 3L2OB 4EJSB 1ZW6A 2CJWA 3FVQA 3W6PA 1T0HB 2F3TA 2JLSA 4AWXA 2CNWD 4TL6A 1AK2A 4RKFA 2JLYA 4MKGA 4KU4A 1DG1G 2QTHA 2YWFA 2J41A 3BS4A 3CH4B 3EZFA 1PVOA 4Q9IA 3GLHE 4DSOA 4M9SA 4DSTA 4ERNA 5JEDA 2ZITA 3QG1A 1HE8B 3VR4A 5DHAA 3FHTA 3O8CA 4HUTA 1KSGA 1VG8A 3W6NA 2WSSD 4IDHA 2ZRDA 4LYJA 3CRW1 3RS2A 2GBLA 3WRYC 4PQFA 1NG9A 3I5YA 1XPUA 3UPUA 4Q01A 1E9SA 1UDWA 2BMFA 1QVAA 1N6PA 3LO5A 4F38A 4ACBA 4KVAA 3TMKA 5B57C 2ORIA 1GL6A 1W0JD 1KNQA 2ZRJA 2ZRPA 2VP5A 1OKKA 3WNDA 3IHWA 4ZDIA 3TH5A 3CF6R 3I8XA 2CL6X 2QAGA 3LDAA 4YMTA 4DB4A 4B35A 3I5XA 4HSEA 1UEJA 2GZDA 2ZU0C 4QNMA 3BRWD 4YXWA 5TMPA 2IHBA 2AN9A 3CRVA 1IJFA 3ZDQA 4BFSA 1NF3A 2C9CA 4R7ZA 1CIPA 5KSZA 3K0EA 3H0KA 2MMCA 3TIFA 4CDGA 2H1LA 5FTKA 4Q1BA 4LK2A 3GLHB 3ZQ6A 1U99A 3BOSA 5HE9A 3A37A 2HJGA 3U7FB 4MDEA 2NO0A 2O8DA 2IL1A 2WJHA 5D3MB 1E98A 3B6EA 1UKZA 5FUXA 4DLUA 1EFTA 1AGPA 4K8OA 1XU4A 2D3WA 2F43A 3U60B 1AZTA 4XJXA 3AV0B 4X8OA 4BFYA 2BEKA 3T5DA 2FFQA 5KPDA 3KZ1E 3BGWA 1Q12A 1OFTA 2XJ9A 1MABA 1KO7A 2Q21A 2PX0A 4L5BA 1G291 1WXQA 1COWD 2QP4A 2WWXA 3AVPA 4A0RA 3TGPA 1KI2A 221PA 1U9IA 2PH1A 1X8KA 2P6UA 2GCPA 4CEJA 3GJ3A 3AH8A 5SZJA 3EWAA 1KDOA 5KPJA 1H8HA 4PC1A 3RYTC 2PX3A 4LC1A 5CYOA 2XZLA 2XSZA 1LFDB 1Q21A 4NP6A 5FPKA 2CLDX 4NYJQ 4BFTA 3W34A 2R6CA 3LW8A 2IC5A 1UM8A 5IK2A 5L3QB 1P2UA 1VYTA 2EFCB 5EE1A 3L8ZA 2C2HA 1A4RA 4D80A 5KNBA 3RS3A 2P2LA 4TMWA 5E7IA 2FOLA 2ZRKA 1FX0B 2BDTA 4KLNA 4ZCLA 4URXR 2IT1A 4FCWA 1UBFA 1YKSA 2VPPA 2C99A 3UWOA 4TL9A 3SBEA 3U7GA 1KBEA 4Q4LA 1M34E 1N5LA 2WWWA 1PV4A 3GLFE 4OK6A 2WSSA 4M4SA 4LV8B 4IXNA 3BB3A 1KO1A 3NBYC 2ZI6A 1XTIA 4QBFA 4C0QC 3CRMA 4JT2A 4GOKA 3IKJA 4HB2A 4A8JC 2JLQA 1X86B 1KI1A 4QBHA 1NSFA 2VL7A 1M7GA 2ZPTX 1QVRA 4B74A 5DNYB 3TQCA 3UGIA 4B2PA 3U6KA 2PT5A 1KI6B 1G8FA 3ICQB 2NZJA 2RH5A 4M1MA 3CPHA 3K0AB 3C41J 1KI3A 2XJ4A 3CLVA 1QHGA 1DAKA 2RAPA 1E69A 4WOPA 4JBWA 2MMGA 4A8JB 3IO3A 5FOSA 1Q1QA 3UEJA 1D5CA 1Z29A 1NMZA 2ERYA 2VEDA 4IVRA 3NHBA 4P33A 4Q7LA 2WTUA 5E4FA 2R2AA 1W46A 2CLSA 3TR0A 4F4JA 3K9NA 3C4JA 3MJRA 5FPSA 2WICA 3KTAB 2F1JA 3Q5DA 4EUNA 1QG4A 2G6BA 2WOOA 3BB1A 4Y0VA 421PA 2EW1A 5GJCA 3CRQA 1RIFA 2OXCA 4RFSB 1XTKA 3GLFB 2VHUA 4JIMA 1KSHA 3DZDA 4A4DA 5KSOA 2AXPA 1TBOA 3DM5A 1N0WA 4IVPA 4MYTA 3B9QA 4OJQA 4DHEA 3IGFA 1Q1BA 1Q44A 5JLJA 1SVWA 1XEFA 2QPTA 3BBPA 5EXTA 3Q5EA 2WIAA 1G41A 3BJIC 1DE0A 3QPUA 3QBVA 1FOEB 2AD5A 2GAOA 3THXB 2HYIC 4DB2A 1LS6A 5KU1A 1AS2A 1XD2B 2Q0HA 2C96A 3FMPB 2NMVA 3T1QA 1OHHD 5GJVC 4IDNA 4N0DA 2A5DA 3N70A 2G9NA 3GLIE 821PA 1IN4A 1M74A 1KHTA 2WV9A 2YNMA 4QJ5A 1VECA 4D4LA 2DPXA 1OV4A 1P60A 121PA 2ZIAA 4NONA 2EVWX 1HUQA 1EWRA 3R7WB 2B7CA 4O2LA 5AUPB 1R4AA 2ORWA 3NIBA 2ZS9A 1WMSA 2FWRA 2W00A 1LF0A 2O8FB 2FPLA 2IYLD 5E3HA 4RZUA 1F48A 1XTQA 1ZMXA 2WWHA 3QXJA 1DBSA 5A0FA 4P4SA 3SC3A 2VO1A 3OIVA 1XP8A 2PZFA 4DDUA 3EPJA 2EWVA 3OAAA 1MV5A 1U8AA 2P5TB 2QP9X 4JT4A 2Z4SA 3THYA 1E9BA 3QVUA 2REOA 5JHHB 4DLXA 4E22A 2B8TA 4FCVA 3LQRA 4EDHA 3N2IA 1TQDA 2VF7A 5K8IA 3P1JA 4Q4JA 4DCUA 2FFBA 2REXB 4BLTA 3QXCA 1N0UA 2AK2A 5JHGB 3U5ZB 1XEXA 3OEEA 4CEIB 2FN4A 2H7VA 2QQEA 1FP6A 2BJWA 2GA8A 5DN6A 1NVWQ 1P9RA 1E2IA 1SHZA 1R0YA 3E1SA 2ZS8A 1FNNA 4U02A 1N25A 2ELIA 1FMJA 2OEPA 4LJ9A 4YLGA 3EZ2A 1GKUB 3V4RA 1VCNA 1DELA 1CU1A 2XXAB 4N0EA 3OEHD 4AY2A 2HXYA 5EXSA 3WMFA 3IQXA 3GJ6A 1Z8FA 3B60A 3I1FA 3IIKA 3AF1A 1SVIA 3QY0A 2JAQA 1NJFA 4EKDA 2PJRA 1QRAA 4DLTA 1OH5A 3H1TA 2H57A 1II8B 5CITA 1M7BA 4XVRA 2XNSA 4UNSA 3H86A 2IYTA 3JZMA 1DAMA 3AVOA 5EZ5A 1CS4C 3C16C 3ZJYA 4A2WA 2QA5A 1CRQA 3RC3A 4ZCMA 3VU9B 4TYPA 3LX5A 3CRRA 2KBFA 4M9QA 3QKSA 5CM9C 3SOPA 1MOZA 2JLWA 1SHKA 3K09A 2QM8A 3AVQA 1N6RA 1ZD9A 3ASZA 3D7MA 4Q7MB 3CKLA 4HB3A 4LBWA 4B76A 4NE2A 2QNRA 4JVNA 1F2UA 1ZM2A 3E5HA 2XOKD 4JL5A 3AVXA 4WAUA 5HE8A 2OT3B 3HPRA 5FFMA 3L43A 1AKYA 4LY6A 4EQ6A 5FUWA 2FA9A 4QHTA 1TEVA 1W36C 1E2JA 1Z5ZA 1A82A 4JLMA 5EZ6B 1NVVR 1TX4B 2W6ID 4M1YA 4W7SA 5UKDA 4ZV4A 2WAYA 4LJAA 2IXFA 3LFUA 3ZLJA 2QE7D 2ZAOA 4QGFA 5GJWC 3ZS8A 5HCNA 1N6OA 3QKTA 2V6IA 1W36B 4TSFA 1MH1A 1XDBA 3LY5A 2RGBA 4OK5A 4C0KA 2J5XA 4NU0A 3KXLA 1SGWA 3NH9A 1GILA 1G16A 1GITA 1E2QA 4TMVA 1XXHA 2NO6A 1E2FA 4PO8A 2OESA 2W2XA 3MWJA 3PUXA 3GEEA 1OH6A 3S1AA 2W83A 5CYPA 1FZQA 2G0TA 2KSQA 2ZE7A 5JRJA 3ZZTA 2ANCA 1JR3E 4Q1EA 4GOJA 3KFVA 1RFLA 2JJ8A 3IEUA 4P3YA 1ZD8A 721PA 2ZSFA 5JWOA 4J0QA 3MMPA 2AD1A 4YDHB 1N0VC 3U44A 3KJEA 1UADA 5J47A 5JS7A 4KODA 1G8YA 3NBXX 4OJKA 1YR7A 1ETUA 2FFHA 3N2EA 2FEMA 4X8MA 2GK6A 2J3EA 3Q7QA 4B44A 1Y8FA 2P67A 4PHGA 3AVYA 4Q4AB 2F1HA 3GCGA 2IK8A 3NHAA 1D9ZA 2GEVA 4BFWA 2QRNA 1E2NA 1T0JB 4DUGD 4XTRA 1RYHA 4EPXA 4YQFA 2J9RA 3RABA 4BFXA 4PAMA 4GL2A 1G4AE 1YZGA 2CHGA 2FMXA 1FTNA 2QMHA 2C9OA 2BCJQ 4I99A 4M1WA 3CWQA 5E95A 4BLPA 4D25A 1GL7A 4HEJA 5FBWB 2IWHA 2B8WA 4PO1A 3I62A 2LCFA 3B13B 1RW4A 2CHQA 4JL6A 4KHZA 4TWZA 1XZQA 3ZYCA 1OF1A 4DIDA 1NVXQ 4L15A 2GILA 4P31A 4G5QA 2ZRGA 3JVUA 2O8EA 1PLJA 1P72A 5ANRB 4GP7A 4C0HA 2G77B 2WMOB 3RHFA 1L2TA 2VTKA 4O2RA 4NZYA 1A5TA 3LA6A 2F1IA 3A58B 4JS0A 3K1JA 2BVNA 1TU4A 2OUKA 3DZ8A 3KJIA 3B1XA 3C7KA 1E1QA 3HDTA 2HJVA 4HLDA 3KKMA 1WF3A 2QROA 2WKPA 3GFPA 3ND8A 3QPWA 1O3YA 4LX0A 4WXRA 2ODEA 3VR6A 2O5VA 2IS1A 2DWOA 5EXXA 2YC4C 5IDVA 2E73A 2C04A 1OLOA 4URVR 5FOUA 2DFKB 1G8PA 2IHYA 1KTVA 4TYYA 3BC1A 2GCOB 3GLGA 1TQ4A 4FWTA 2C77A 1SVOA 1KGDA 1XJQA 4H9GA 1ZP6A 2RGNC 3QXSA 2ORVA 2QN6A 4OHXA 4W9MC 4QBIA 1GOTA 1E0SA 3KQLA 4ASUA 3U3JA 4V0NA 1Z63A 2PZEA 3RLFA 2GWHA 3W9YA 5CDFE 1FPMA 3B82A 3NKVA 4B48A 2ZJOA 4D4KA 4MKHA 1J2JA 1TMKA 1GRQA 2GXAA 1BH2A 1TL7C 2ZSBA 3OFND 1N5JA 3FKSD 3V9PA 2R62A 2WZQA 4EPRA 1P4SA 2H18A 4MRSA 4PSVA 1E9FA 3I72A 5EP3A 2V9PA 3JVVA 5L8VA 3DL0A 4GMXA 1OXXK 4TQAA 1WDTA 1OIXA 4RY2A 2ZU6A 2Z83A 3CX6A 3U4QB 2IYSA 4Z1MA 4TYQA 3U3RA 4GMDA 2NO7A 4KBFA 5KHOC 4FW9A 4OHYA 1KIMA 2NOAA 3AUXA 3GMTA 4G1UC 3K0SA 3PCRB 4LJ5A 4RD2A 3W5JA 2C9YA 4HZUA 2V8OA 5CLQA 5GADl 3I61A 4PO9A 4EFMA 1CTQA 5J40A 3A6PC 2ZYTX 4ZO4A 4TT3A 3TK1A 1MO4A 1JXOA 3BIFA 4YMVA 3IEVA 2ZEJA 5GJBA 4LPKA 4LRWA 1VDZA 1Z47A 1MR3F 4PHTA 1S4QA 2QTFA 3P32A 2WWFA 2QBYA 1KDRA 4YMSA 3Q7PA 4JYBA 1G7TA 2GJAA 4RD4A 1II0A 1XPOA 2CK3A 4MH0R 4BLOA 1XJCA 2X19A 4UJ3A 1TF5A 1R7RA 4LJ4A 4B3DA 2H17A 4US1R 2J0UA 4KBGA 4KO8A 4NL4H 4XD7A 3SQXA 5DHFA 1EG7A 4JLBA 2NO1A 1UAAA 2FH5B 5F9FA 4C7OB 2FG5A 1IQPA 3BERA 4ZKEA 1U98A 2ZR9A 1IN6A 2D62A 3OIWA 4NYMR 3W3ZB 1Y63A 1CJKC 4X8HA 1RC8A 2FU5C 2ZJAA 4QG7A 1IXZA 5C4GB 3V00A 1E79D 4PAOA 5LPNA 2BBTA 3AF2A 4Q48A 5KYKA 2ONKA 5BXQC 2OCPA 1G6HA 1W1WA 2IYZA 1KI9A 2ZRLA 1IY0A 1JALA 2Q6TA 1TADA 1XF9A 2JDID 2PMDA 1ZINA 1E2DA 3FHOA 3LLUA 1E0AA 2ZUDA 4HLUC 4HUQA 1XBTA 5FH9A 1W0KD 2ZRMA 3RRYA 3TUZC 1OFUX 3GPLA 1FW6A 4BFVA 4WXPA 2E87A 2YWHA 2TMKA 1U2RA 4LBVA 1R6BX 4E07A 4CEHA 1H8ED 1JPJA 1DAIA 1DAHA 2BEJA 3VMFA 4EFLA 4LBZA 3CH5A 4LJ8A 5H70A 4B3BA 3FKQA 2P5SA 1ZU5A 1N6LA 2OSBA 3IIJA 4OQNA 4HB0A 4PC2A 4B2LA 1E4YA 1EESA 4G3XA 3ONWA 2AKYA 2BC9A 1YU9A 2XTNA 3L0OA 5EXPA 5FTLA 1W48A 3OFNA 5G3YA 1C4OA 1ZIOA 1ZM7A 3CX7A 1RFHA 4A1FA 4MYHA 4OQXA 3EASA 3M0EA 4XVUA 2L0XA 1KBFA 4URYR 5H68A 3R8FA 3KJGA 2KBEA 1LF5A 2BM1A 1A2KC 1DPFA 4DLSA 4M21A 4C0LA 2J7PD 1TF7A 2YZ2A 2A5JA 1E6CA 2FZ4A 4RZXA 5E7MA 3BK7A 1E2HA 3ND9A 2I1QA 2OLJA 2IYWA 1XMSA 1KK2A 2ZI5A 3FMFA 4BASA 1W49A 1OXUA 4IDPA 4GI7A 1T5LA 4OL0A 1RYFA 1D2EA 1X8LA 2GJSA 3W5IA 3BWDD 4DCTA 1YZUA 1RVDA 3J81k 3QG5A 2EQBA 2N46A 3MCAA 3R20A 4LWZA 3UIEA 3DKVA 1UBCA 1XTRA 3ZVLA 5GVSA 4POAA 1YQTA 1N2CE 1PUJA 4Q18A 1G8GA 5JJIA 4Q5IA 4KV9A 4F4IA 2O8CB 1S2MA 2XGJA 2C5LA 1CJVC 1G5PA 2J87A 3T35A 4B6EA 4KFSA 3NEJA 1KMHA 1XNJA 2ZYWX 1BIFA 2R6DA 3FYHA 4RZ2A 3ZGXA 2F43B 3E70C 3U3OA 2E9SA 5AUOB 2OV2A 3BFKA 4BE7B 4C4PA 1WRBA 2VSXA 1JAHA 2O0JA
chains in the Genus database with same CATH superfamily
1AS3A 3KPJA 3PDCA 5I7WA 4BWYA 1P74A 1T9AA 3CLSC 2JJ2A 4NG5A 1IE3A 2H2AA 4RJLA 1CKEA 4PXSA 1GIAA 1QDEA 2A67A 2FEOA 4D9BA 3FTCA 1JZSA 2Q29A 4L8GA 4G9BA 3EC1A 4LYHA 2B5OA 5M04A 4AP9A 4TXLA 1QTNA 2Y1EA 1EK5A 1ESMA 1Q7RA 2E1RA 5KVVA 3CJRA 5TS2A 3U4IA 4IIFA 2OQ2A 2ZJ2A 3ZDRA 1GP2A 4QXAA 5T3UA 3HP4A 1E0KA 2FETA 1G5RA 3BAZA 5GGYA 2XMGA 4JCOA 5LQUA 3DGFC 4O2BA 3WE7A 4KQJA 1USIA 3WJ7A 3AR4A 3IDQA 4GSYA 1QAMA 4N5LA 5DW3A 2M32A 1OLUB 2GO1A 4HJRA 4MVYA 2E85A 3I83A 3N58A 3HYRA 1W2HA 4B3JA 3IIEA 5LIPA 2N1AB 1W581 1K3TA 1D2CA 1O54A 4NATA 1W1UA 2ZJ8A 1LA2A 1GKLA 1C7ZA 1U7OA 3QUQA 4YPFA 2EGUA 2QTGA 2WEKA 5IS2A 4W9RA 1RLMA 1NW5A 1CUBA 2Y1KA 2PQ2A 5DJ5A 3N59A 5E6SA 1LTHR 1NJ1A 3MTEA 4V24A 1KKMA 1RYZA 1KAOA 5JSZA 3TTUA 2C1ZA 1A0OA 4CI0B 1U3VA 1E5DA 1OA0A 1B74A 2BM8A 1S8AA 1KORA 2PDAA 2ZTUA 4RK7A 1E96A 3A9WA 4JKYA 4RMNA 5DO9A 1SWVA 4EJFA 1US8B 1JDZA 1F3LA 1NXPA 2FDRA 2XDYA 3DO8A 2TMGA 4X95A 1IULA 2B7LA 3G6KA 3QA9A 1HRKA 1EFRA 3KR1A 5A5GA 1V2HE 1VP9A 1X39A 3AR5A 2RB5A 3HV2A 1AKRA 2WQZA 4C6RA 4X71A 4ONEA 2YWCA 2EBWA 4IHKA 4P38A 1SIBE 4ZEWA 3ROQA 4ACAA 3AKZA 1RBZA 4O8ZA 2OO5A 1IHXA 3LX8A 4N9WA 3PNBA 3GFTA 3BFVA 3DMRA 3SKVA 5CAEA 1T5IA 2IIQA 4WD3A 2CJSC 4QTXA 3D64A 3ZD8A 1GZ5A 1XQVA 4IMIB 3AEXA 3H3FA 1EX9A 4H6PA 3MTDA 1DJOA 3HB9A 3PNLA 2ZBQA 3SQWA 2SECE 3DE4X 3OMLA 4AT1A 4UMEA 5J58A 2J33A 1NYRA 2O7RA 2ZANA 5AI5A 5FOQA 2HPHA 3COYA 3WGUA 3TNFA 1JHUA 2XZTA 4RAOA 2BGWA 1PKEA 1HLPA 2A0FA 4Q1FA 4L0DA 2NUAB 4PFJA 2FQXA 3IULA 1GD1O 1YQGA 3NGMA 2A78A 5NULA 2Q8PA 4F86A 5BV8A 2GN0A 2DM6A 3UBMA 1TURA 1GZ4A 1NT4A 4K81B 5A7HA 2XVXA 2PV7A 2FPMA 2IUYA 4CW7A 4YMLA 5FI5A 3O1JC 5FL3A 4MHTA 2CNWA 4JBXA 2G28A 4R2LA 4KNVA 2ZSKA 4QGSA 2UZ3A 2ZJ1A 5M29A 2DQ4A 2BMJA 1G8HA 2YN0A 2ZYGA 4MVJD 4MV6A 5GM2A 1AO3A 3U62A 1PS8A 4BP3A 1WZUA 2VQDA 4OLBA 5C7LO 4JJKA 4KGZA 3PQEA 2EFJA 1GVHA 2EERA 1KU6A 4JGIA 5KVCA 2PS3A 5B1DA 3W8RA 2AL7A 1HDRA 2O2XA 3H2HA 4Y2VA 2IXEA 1PWHA 1AK9A 2X5NA 3EDOA 2QRJA 2ZR0A 4TMKA 3L79A 1NRJB 4D3XA 4XIGS 2WQ6A 1FP7A 4I4LA 4XR9A 1YJCA 4M9CA 2C4UA 4AK9A 2V53A 2PH3A 3MYYA 4G23A 4TTRA 4MVJM 2RGGA 4MWGA 1ZD4A 4AS3A 5U9CA 4KFUA 3BGSA 1MTZA 3PXEA 1LVGA 1UFRA 2XH8A 4IQFA 5DNAA 1RAFA 5T8KA 4IDCA 3L5OA 1QO0D 2HIAA 4FU0A 1UH5A 4LN1A 3UMVA 1OLSA 2XUJA 1B0UA 1ULSA 3BD7A 1BU5A 3AHGA 1TGYA 4PINA 5F4BA 4CFSA 2OCIA 1EWKA 3K0CA 3NOVA 1IHDA 3B78A 3PUJA 4G0XA 1Z2AA 4E7PA 5TSDA 2GJ9A 1IMOA 2Q5QA 4WACA 1OX4A 4Q1VA 3WJ2A 1F3OA 1JBEA 1SRRA 4BDTA 1TU3A 3EFEA 3P52A 3QUTA 3VVMA 3UJCA 3NHKA 1T6NA 4L5IA 1LU9A 5CPBA 3OJCA 1ENPA 1TKAA 3CS3A 2A0KA 4EO4A 5BPFA 2YMLA 1KJQA 3G8DA 4RXTA 1G9XA 2D1YA 1O95A 1I4DD 3AM3A 4EABA 4II3A 1R9GA 3TG8A 3RC1A 3N39C 5TEWA 4UQLA 1A98A 4AKSA 1YRWA 2O23A 1Q84A 4TN1A 1CY4A 2EFHB 5AW0A 1Y7PA 1HYGA 4J2OA 1Q16A 4NFSA 3TX2A 5L53A 2CLLB 2ZE6A 1KXJA 2YFYA 2H06A 3T9AA 2A9RA 4JEMA 1MVOA 1T34A 1TZ2A 3TDNA 3DZFA 3QX9A 4IILA 5AI9A 3RVSA 1C9DB 2B6HA 1VXRA 3DAPA 5GONF 3QQ5A 4GXQA 3HDQA 3EQ7A 4QATA 1ZVMA 2YIJA 3EQ9A 2GZRA 2IYUA 1FF9A 2MYUA 4B1FA 2OHOA 3OPNA 5JJBA 4DXDA 5DBOA 2A30A 3FNGA 2EJTA 4DXAA 5LWHA 1PW5A 2OBMA 4E88A 1ZH0A 3K09C 3OLQA 1J5EB 1XTSA 3EAQA 621PA 2AJDA 4QPCA 4TWJA 2BUSA 1C3XA 4CQNA 1M2KA 4OLFA 3VV3A 2PXXA 2RHTA 4AYWA 2FQWA 3KYBA 2X1LA 2ZYUX 3COVA 5JSKA 1CVRA 4L4ZA 3PCXA 4S04A 2QQ5A 2I0FA 4V3CA 3N0WA 3P0JA 4KP7A 4NS4A 1KK3A 1XTBA 1KP2A 3NWJA 4M0DA 3SDZA 1KSFX 3ZWKA 4E30A 2J9GA 5CX1B 4B3XA 5KKCA 2RHHA 4F3CA 1AQJA 1NGSA 2DH6A 3IP9A 4FFOA 1S2LA 4UEJA 1L4EA 4R83A 3RVLA 4JC4A 1ZZEA 1PLLA 3N2NA 1BROA 4CKEA 1GA1A 1T4BA 4YUXA 5CB4F 1FRNA 3ZGOA 2Y1FA 2X52A 4M8IA 1V5IA 1K6MA 4BE4A 4BXOB 1HXHA 1YZHA 5JY1A 1EWVA 1J0CA 2FN9A 3D31A 2C7GA 5LXTA 4F2PA 2QENA 1CW2B 1CX9B 3WNVA 2V6JA 2R8ZA 1J9EA 1WCIA 1MAUA 1KMIY 4CKXA 2VTBB 5FA8A 3TRIA 1JWLA 3EMKA 2HNBA 3CB4A 3WYFA 1ZL2A 3FFBA 1LJUA 1ZCFA 4FUTA 4EG1A 1TJNA 1L5OA 2X4IA 1K0UA 1I1OA 1PKXA 1IUKA 2VDQB 2QRPA 3PGXA 3LHIA 2CXPA 3SSOA 4BVJA 2YKGA 3GBVA 3OKAA 4C0SA 3HACA 1HYEA 4R2HA 1J56A 2CV0A 1NSTA 4PTLA 1ZK4A 2JIZD 2FB9A 4UBMA 3BTOA 1GTZA 3UW3A 2RGRA 1SXJE 3SX4A 1IHUA 1R0RE 2IYAA 1G5HA 1CCWA 1N0IA 3HBNA 1NE2A 5LYYA 3RVMA 3T7DA 5JSQA 3T5GA 5LNK6 1P5FA 1F9AA 3LY8A 3WQHA 2LDBA 4INAA 4BMZA 4DXHA 4QPZA 4XD2A 4YAIA 2O48X 2YIDA 3LHSA 4A9AA 4JBIA 5BMVA 2IVFA 3AP3A 3OTIA 3ZCSA 1SAYA 1ODIA 3FUUA 3D6VA 3DTVB 3CNOA 1SH7A 2C54A 3WAKA 3HRKA 4QNRA 4D8YA 5ICEA 1U2GC 3A4IA 4FWIB 3ZI7A 4B4VA 2V7PA 1CB0A 3ZGYA 1PUIA 2BEVA 3PR2B 1XL0A 3HA5A 5J23A 3JQ7A 2C9MA 3AGQA 4XJTA 4ZJZA 2FOIA 4HG2A 1K9SA 3M6FA 2J0QA 3G9UA 4H7HA 1C9JA 4PCAA 5E4JA 1QCYA 4LOKA 4FYJA 3EH2A 2I6FA 5FOTA 2D7CA 1KJWA 5EP4A 3U48A 1Y98A 1T43A 2QGZA 1SXJD 5B3KA 1PTJA 1O94D 5AK0A 3RT7A 4HT3B 3ENKA 4JYAB 1I51A 1Z4NA 2IOYA 1GV1A 2CC2A 2XQGA 3FG9A 4M89A 2E49A 1TVMA 4KVFA 4M1KA 4MIOA 3C7CB 4DANA 4E09A 1BSVA 5K8JB 1UMKA 1RKUA 3HYNA 4I5IA 3S2ZA 3E9EA 3NXSA 2HCBA 1UAYA 3NAMA 4F9TA 4X6XA 1F7VA 1Z18A 2VJOA 2ZDGA 3PFIA 4JBYA 1N78A 3S7ZA 2FP3A 4Q4CA 2CV1A 4E4YA 1ZUD1 5A3VA 3LK6A 3OHSX 1AM4D 2AXQA 2FR8A 2AJBA 2H4HA 1VG1A 2XXBA 3GRRA 2XYHA 4HPJB 4MHSA 4XLLA 5DEIA 4ZGGA 1A7UA 3WLNA 1R5JA 4R9SA 2FMTA 3T52A 3KQKA 2Q3FA 1LPOA 4MUIA 4O3FA 3V1MA 5DGCA 2VPXA 3B51X 3H2SA 3QBDA 3GLGE 1H0SA 3KQHA 5EZQA 3TINA 3MGCA 2I2XB 4WCVA 4P0QB 4IUYA 3R8CA 2UUOA 4M36A 2C92A 5I8ZA 4IZOA 3GLTA 4AM8A 2AUTA 4EBBA 5CM8B 4D0SA 5K5EA 4A15A 1J0BA 3FDZA 1G21E 1OHHA 4QIHA 2OKGA 4CL3A 3V6LA 2BEWB 3I4LA 4HWRA 3CHYA 5AW5A 4DT1A 2GCIA 1ZA1A 4AO8A 3JALB 4MEAA 4JU8A 3JYQA 1UMDA 5JZ9A 4I3FA 1SCNE 4IHAA 1O96B 1VE5A 4XFJA 4DQKA 1JJVA 2VUUA 4AMVA 1HA3A 4AXBA 4ZRMA 2BHNA 1P44A 1OB5A 3K9FC 1N5OX 2G5GX 3AZOA 2RH9B 4M0KA 3HEBA 1D4FA 4KQIA 5DLPA 4DWOA 5L3QB 4DSNA 1CD5A 4KNWA 2SGFI 1YBHA 1LX7A 1FNMA 4MEBA 3LXXA 3KU4A 1CUWA 1NW6A 1XJ5A 3NM4A 5EKUA 1UOQA 3GF4A 1BZYA 3HVHA 3U7EB 4AY6A 2RH8A 3F4BA 2IOFK 3N6XA 2BFAA 2GHTA 3TR6A 1GUBA 2QRZA 4RSHA 1ODKA 3N87A 4BCCA 3WZLA 3RNOA 2C1EA 5JAHA 3RB8A 4B6DA 2ZSEA 4HDSA 1CQIB 1RPAA 2BLLA 1JVSA 1RJ9B 1A96A 2EHDA 1YVDA 5L4LA 4EY8A 3BYZA 5KINB 1DCKA 4MS1A 1AF7A 3WLSA 4U8HA 3OKFA 1RVV1 3U56A 2BN4A 5K7SA 4A6EA 3BREA 4ZHQB 5HZGA 4BLUA 3KKOA 3LXMA 4E15A 1JR3D 1I3KA 3WLEA 4A0HA 1EJ6A 1DV1A 3DXZA 3HGMA 7MDHA 1J07A 3KQTA 4KCGA 4DKXA 5L9AA 4R2XA 3SJAA 5KJFA 4FOSA 4CMBA 4MP3A 1U0BB 1O8CA 3SHFA 2NP6A 2NU0I 1U3FA 4ZVOA 4BZPA 4UNNA 4AWBA 1OUMA 4BVBA 3WL3A 1TAGA 3UJ8A 4EFDA 4NY1A 2WMYA 2LCIA 3GAFA 2JFNA 4HEHA 3A4NA 5JMPA 1L5LA 3A8TA 3RUHA 4ER5A 4GS5A 4F4CA 3A9RA 2FWAA 1NIJA 3HJTA 1SPBS 2NO5A 1GCUA 3PV0A 4DVGA 4EVSA 4FMPA 1HZJA 3LDHA 2FN7A 4BATA 1QIMA 3N2KA 2EAUA 3BDIA 3ICOA 3C87A 4GP6A 4ER6A 3M34A 1N2XA 1ODLA 3NDPA 4FBLA 4AC9A 4E21A 5J8FA 1T2FA 4XJSA 3TVTA 4O6VA 4B7AA 4BP8A 2DXIA 1BS1A 2PSEA 1C8KA 5B4VA 4UQOA 4CLHA 1SKUA 3EIHA 4OH1A 3INGA 1RD4A 3BIOA 1IQUA 1RQRA 1VL5A 1XB2A 1A3CA 1C7IA 1HL7A 4FPXA 2OILA 5CIWA 3EPLA 4B3GA 4F6CA 2W6IA 2BRUA 1JVNA 4PX5A 4PZAA 4S0ZA 4YEDA 3LUCA 2PR7A 3MC1A 2KWIA 3SBDA 1KP3A 4ENPA 3D8RA 2CNBA 1H0KA 3EZNA 3JSXA 1ESNA 2C7RA 4NMXB 1W73A 4RIFA 1DIRA 5BYBA 2BSQA 3VR3D 3MINB 1UT6A 1EE9A 1JUDA 2BFDA 4PG8A 4RD3A 4BX3A 4CZ2A 2OM2A 3DF9A 4XSGA 1NQTA 1G64A 3GDGA 4ND1A 3LUHA 1E6UA 3EVBA 3ORQA 4G81A 4KDRA 5A4JA 2OD2A 5BQ5A 2H4JA 1CR4A 1QH0A 3OE4A 2CBZA 1OD6A 2ZYDA 1OE0A 3H6GA 3SC2B 4B2YA 3D81A 1GCIA 2ZUVA 3UOEA 4LC9A 1ZGAA 4BLQA 2PRJA 2ZTSA 4GOND 1LSUA 3AHDA 3ZCUA 4TM7A 2I2WA 2D3TA 4ZDJA 5T4FA 4HXGA 3MB8A 3MAAC 1ZK3A 1A27A 4AP5A 1K63A 3B2QA 3Q0IA 4B3SB 1Y5LA 1VSBA 4LGMA 1ZM4A 4Q3BA 5JCJD 3U19A 2VQFB 1PUXA 3WO1A 4TTTS 3IP8A 3K5PA 1DARA 3SR4A 2RHCA 1WBBA 2H2DA 1FU8A 3DJYA 4MKXA 4RZQA 2WIBA 2QV7A 1XN4A 3MTBA 5C53B 3IESA 1KZ4A 4C3VA 4A6PA 1GLVA 1QAOA 2ZB2A 1IY5A 4ZDKA 3R5HA 1B2LA 1DKNA 2XRMA 1YAJA 4XSHA 5AO9A 5JH7A 4JLUA 1Z4QA 2Q9BA 4EHNA 2W6ZA 1DXQA 1CJBA 1N8NA 1VDDA 2XKJE 2WF5A 1UQRA 3PHBE 2XUHA 2PT6A 4N7RA 3C8ZA 2YMMA 2NO9A 3PE6A 2XZOA 4KITB 3HCDA 4D41A 1BYUA 4F97A 3OZEA 4E5PA 2YQPA 1ZIXA 2VSOA 3K9WA 3PUZA 1ZR4A 1QRSA 3OXGA 2H65A 2ZVPX 4N0QA 4CV1A 1NUPA 5ALMA 5BQFA 1WLSA 3IP7A 1YZYA 4R9RA 5ES3A 5DGHA 4QAQA 1XVLA 1GZDA 1UBMS 5D6NA 2BBSA 3VOAA 5EG5A 1O97D 4IIVA 2GTIA 4CIXA 3H2KA 4RQBA 1QE3A 2GYYA 3SR0A 1HWYA 2R44A 1VLLA 5A3RA 1RQXA 3IPCA 4WHMA 4UVDA 5BVGB 3C3JA 3R5BA 1Z35A 3H19A 3OU6A 3ADOA 3L1HA 4LIPD 3R76A 2HWUA 3W3AA 3UKJA 3D6TB 1PJ8A 3K71B 4JA0A 3ELYA 4G6ZA 3IR6A 1JKJA 4G0MA 1D2HA 1M6HA 2UZ4A 3QEMA 1BQ4A 2VP4A 2DBRA 3IMEA 4KK4A 2XMBA 1G8AA 4ZQEA 2BKUA 2E37A 2RGXA 2RCYA 2NU7A 3DBHB 2DJ5A 3QF4A 5F2KA 3DB1A 1VPTA 4H7EA 1T5BA 4KQKA 3FA2A 3KU1A 3LI2A 5EL0A 2W2TA 4X45A 1H66A 3VKHA 1OU0A 2FPUA 4G1CA 4GRDA 1EWYA 4NENA 1SY7A 4LHYA 2BPOA 3IE0A 2GPYA 4XI9A 1QO9A 3NT2A 4OSOA 4PR0A 2ZIXA 4TKUA 4PFSA 1OWMA 1YT5A 2APJA 5CM2Z 4L7QA 3NX4A 1U3GA 2VYFA 3QJYA 2QXYA 3K92A 4CFZA 1NG1A 1CP3A 1E4EA 1H1LA 4X1IA 3M5CA 4JXZA 1PD0A 2GO7A 3FNEA 2CXSA 1BJKA 3ADCA 2XRYA 1WA5A 3ET5A 5CT4A 1QQTA 5KREA 4I4CA 4UU1A 1CUGA 2P4EA 3G9ZA 1TT5B 3G2IA 3QWHA 3EUFA 1BNCA 1DT5A 4A0QA 1MIOB 4BUJA 4RADA 4AY5A 5SZIA 4RM2A 2Z6UA 1XD8A 1XROA 4D0LB 4V0MA 3LLVA 3R09A 4Z3DA 2N3ZA 1T4CB 3MJSA 3DEJA 2G72A 1M6NA 3AK4A 3V1KA 3TXXA 4H4DA 1TUSA 4GG1A 4IDDA 4J3JA 3PRJA 3L84A 3WGKA 2ZBFA 1HTTA 2P0EA 2YJ6A 3PI7A 5EWJB 3U61B 3GZNB 1KOGA 2GVIA 1F20A 3DMPA 1PIWA 1WY5A 1GTVA 1K6XA 3STWA 2GHQA 4CRWB 4E3ZA 1BDMA 2UUAB 2QM7A 2X8JB 2JFXA 3R0IA 3FI9A 3A1VA 4RA9A 1G5TA 1TM4E 1WY7A 3M6AA 5TB5A 4ADSG 1GGFA 2GN6A 3DMYA 4KR3A 2FP4A 3LUJA 2H0RA 2ZJ0A 4KN6A 1IONA 3DOOA 4K6CA 4URUR 3IRUA 1UZAA 1FSGA 3R9WA 2BFEB 3S0JA 3QMVA 2PKWA 2VFAA 2VNHA 5JBQA 3ORHA 2HRBA 4MROA 4FN5A 4YTEA 3ZHOA 5JBNA 2QAGB 2E21A 4WCDA 1NUSA 2O3UA 3C45A 3JAWB 5TPWB 3RPEA 3QYJA 4C4XA 2WVGA 3MRXA 1WQ1R 1ST3A 3MA0A 1NVUQ 2XVYA 4Q9JA 1WP4A 3DBRB 1PWZA 3ZH2A 4Z9BA 4CKWB 3LT1A 1O87A 1MV8A 4H7JA 2A59A 1XEAA 2GFIA 2HHCA 4EB6B 3WGZA 5HRAA 1R88A 5I7RA 1RWVA 2Z95A 4NYMQ 1U63A 3CXRA 3MT0A 1SVKA 2M9MA 3DFMA 3A27A 4TTJA 2PA3A 3BL5A 1B76A 4Q9HA 1MP0A 3HJBA 4F45A 4PSAA 1UBHS 2VBCA 2AMYA 2XD4A 4I66A 3EDMA 3PF9A 5GOZA 2HFKA 4DCJA 5E2AA 1ZCJA 1JSCA 4IIUA 3TKLA 3A9CA 4IFTA 3ZWOA 2W4QA 3LSYA 3TW4A 3D8BA 1CHDA 1DIBA 3ICVA 3ZWYA 1LBIA 3PVSA 2A5FA 3U16A 3N7AA 1FXSA 2P4HX 2FMKA 3U13A 1K5HA 3RAJA 2AC4A 3PYLA 1E92A 2NXCA 5LQCA 1Q0RA 3QX7A 3WLJA 1BEEA 2IGBA 5C1IA 1YVPA 2DHEA 1DRWA 3QVGB 3LX6A 2HFJA 3MN1A 1T5HX 4LMBA 2GN1A 1R50A 3EX7C 4RGVA 2ECPA 1FCJA 3VDNB 4OHMA 2JGLA 2E5RA 3I23A 3OLCX 4IX1A 2O2ZA 4AD8A 4FINA 4DIBA 3KCNA 4YAGA 2V3CC 5F9HA 5CJJA 1NR7A 4EQZA 2EATA 5KNBD 5AJVB 1FTYA 3GAMA 3M8KA 1PF7E 1H1DA 4MA4A 1EP1B 3RHZA 4MLDA 2XNJA 2CFSA 3SHQA 3GQBA 2W43A 2XIQA 3AHCA 3BMQA 5DYNA 2QJOA 2I2AA 5JDIC 4CIWA 4C0AC 1QC5B 3MHTA 1PFYA 3LH5A 1GGEA 4PO3X 4TS3A 1BE0A 4WZAA 1TBQR 1T6BY 5A1JA 1IYZA 4FZ3A 1SG6A 4Q19A 1EVLA 3QY9A 3I0ZA 3IP5A 3K20A 3GLSA 1JKIA 1KEUA 2IU4A 4A2PA 4UATA 2ZTMA 1Y42X 2NPFA 2VJAA 4WVFA 4AULA 2PUWA 1YR9A 1PRYA 2G83A 3JWIA 2RJNA 4QUHA 4A5SA 3B4VC 2DR2A 3NYIA 3QVJA 4JOQA 4PRYA 1SZJG 5IRCD 3AM1A 3TZCA 5FLXA 2WUWE 2XT0A 4BECA 2LZ0A 2GPNA 2OHVA 4IHJB 3ROZA 2AN3A 3WDMA 3E3NA 4D46A 3C5WP 3IVCA 3F8SA 2LKDA 2WZDA 4D3DA 3UJ9A 3C7DB 4NICA 1TVEA 3TO5A 3ZLUA 2HUPA 5I6DA 3QFFA 1NXSA 1JDUA 2H1WA 2ZSDA 2WABA 1GSIA 4MRRA 3UBTA 4OLAA 3KSDO 3HLYA 3UENA 5C18A 2SGDI 1JIVA 4EJ6A 1XHEA 4JLVA 1G55A 4MWTA 4LBYA 4CQJA 1Y7HA 3ZWDA 5AI6A 3OWXA 1T3GA 1C3JA 4IG4A 4KYUA 4EPWA 2OZLB 3P9KA 5CB8A 2IPMA 3NDJA 5HJ2A 3I73A 1L3CA 3P97A 5J2UB 5EP1A 4DDMA 4ZIRB 1J8FA 1EIZA 3FJYA 3BXZA 3SHWA 4RTOA 1ELOA 4B8YA 4Q7QA 1NVTA 2R48A 2GNAA 2KYRA 3GD5A 1L7NA 3K9QO 1U8CB 3W5UA 4JJGA 5B3JA 2PX8A 3H1BA 4H1UA 2W37A 2AQKA 4CQMB 1VL2A 1U90A 3MMZA 3ELBA 5JQGF 3INTA 3BSFA 4X84A 5KJEA 2OYRA 2ZULA 3O1IC 1R5OA 5K6TA 1CUAA 1PDVA 1NPDA 4UPDA 5JEEA 2WSMA 1GUFA 3N74A 2HR1A 4TQUS 5KYNA 5B6JA 2GEJA 1YB4A 2NSDA 4TKMA 3GBPA 3DYVA 3RF7A 3C3KA 3TCNA 2NVWA 1NP3A 2W0SA 3F90A 4C21A 2IYXA 4R1UA 2VBFA 4F71A 1H2EA 4Q6BA 4DCPA 2BFOA 1JJ7A 1XI2A 2X6QA 3QI7A 3WSWA 3PICA 4Y2RA 4OXKA 4R71A 3R3UA 4KYVA 2JXDA 5BN5A 1JP7A 3IXQA 3CW2A 5E1OA 3TQFA 1C41A 3CIFA 4BVEA 5AFSA 5B55A 4BE9A 5IZ4A 2CGEA 3NHYA 1RHRA 3NP9A 2HJRA 1E61A 1II9A 2QUBA 1JBQA 3U4HA 1NNLA 5C5EA 2XGMA 4EPVA 2VTVA 2PRYA 1EVQA 1IB0A 2WOJA 3K70D 2RONA 2GEFA 3MB5A 3EIUA 3DBOB 1FDTA 1Z26A 3E15A 2W4IA 2MCFA 1U7DA 3WRYA 1GNRA 3JQEA 4R8MA 3K3PA 3ND6A 1NBMD 2PLAA 1CXZA 3PPYA 4IS2A 2YWGA 4G0NA 5F7JA 3RGGA 3UCFA 1E66A 3PWZA 4QO7A 2OG1A 3JASA 3IKVA 2OBXA 2J4FA 4NU5A 3LHFA 3TW8B 3W5BA 2QQDA 1E99A 1EQUA 1XCOA 3UMMA 2ZWVA 2IUTA 1VG9B 2O3SA 2L19A 4GUAA 3PNKA 1C50A 2ZRNA 1OI2A 3NHPA 1MQ9A 2J3HA 1X7WB 2FE1A 3FGZA 4GI3A 1GR0A 1HURA 3F3MA 2NV6A 3IMGA 5EFOA 4R1PA 3RI3A 4BO7A 3I2GA 4MQ5A 2BDUA 1YDWA 2GVDC 4MQ4A 4UREA 4YWHA 3S6JA 6Q21A 2CV2A 3OE5A 1P7ZA 3LJKA 3ZXSA 4X41A 4GXTA 1MAAA 1OWOA 1M8JA 3VDPA 3A1TA 4LECA 3OEED 3TSZA 1KARA 5DTMA 1Y6JA 3GJ0A 1WCV1 2NZVG 1P81A 3BTVA 2UVPA 4YN3A 1NZDA 1UFQA 4LDZA 2ZFUA 4AG6A 4UUPA 1OWPA 2M6LA 1VI6A 2QF7A 2WKWA 1B0AA 3JRXA 2WHRA 1SGQI 4C20A 5I7FA 5FUYA 3FUXA 4LSGA 1Y9EA 2V9CA 3ILHA 3EEOA 1YVEI 2O2DA 5CA0F 4U7PB 3A6LA 1B42A 2G70A 2FTKE 3K35A 1J7KA 1Z7KB 2JFYA 4JBHA 5IFKA 3M49A 3NLLA 2WWGA 3I32A 3REQB 3LQ1A 4PGAA 1CQPA 2QQCA 1L3BA 4YAJA 1WUYA 1Q1AA 2FHSA 2JAPA 4B6FA 5I5EA 1V71A 5BW5A 3C5CA 3HSKA 4CN9A 2V5UA 4DV2B 3COJA 1U28C 3DT9A 4CDRA 3WYAA 3U6BA 3F7TA 1Q7TA 4G8JA 2QEQA 2FDCA 2ERXA 4KUHA 1GNQA 1TMGE 5K3FB 2BKAA 4I1VA 5JO9A 2ZG6A 1W5BA 3GDFA 4CIBA 1CUZA 5JTUA 1TTQB 1Q92A 1WXXA 2Q0QA 1E3WB 2QU8A 2R4QA 3SXUA 1V3VA 2WJYA 4ZQGA 3PNVA 3LBHA 3FFWA 2PJDA 3BWMA 4W1SA 3VJLA 3ZN2A 1RJDA 5CH3A 4CYMA 2AFHB 5P8WA 1AB5A 4N41A 2ONCA 3OC6A 3M4XA 4YRSA 4ZWNA 1X15A 2WFAA 3MT9A 5CYGA 1JKMA 1R1DA 2YJNA 5C4MA 2C8KA 2QL5A 5CA1A 3RH0A 1UR5A 4QSMA 4GZ6A 3ZK9A 2VF4X 5EN4A 3IEXA 2NPOA 1F2UB 1VRCA 1OFVA 1PJTA 2I2CA 2Q8NA 3HCAA 2Q7DA 2DBVO 1LKZA 3EXFA 3AIKA 2PJUA 4KJZA 1V8OA 3O83A 2GHIA 4MQ6A 1L8AA 4TSFD 4WZBB 5CURA 5EUQB 3IAFA 4CTKA 4MVJA 5T64A 4EQ6B 1RWQA 2Q9CA 1IL0A 1R5BA 5SYNA 5GZ6A 5ELXA 3B3QA 3L0PA 5SZKB 1L5HA 5K4AA 1WVMA 4IX9A 1G19A 3HRHA 1YJXA 4OCZA 3AY3A 3NWBA 2AUNA 3ETHA 1TMYA 3MGGA 3QU4A 1XCPA 1YMQA 3URKA 4B3FX 4EGFA 2JIPA 4MI9A 1CUVA 1IFXA 3DTVD 4PS0A 4UUNA 4W8HA 1DB3A 1SCAA 4MLZA 3CNLA 3ANTA 2JATA 2LR0A 3BFPA 1C9KA 1S2GA 1WCWA 2AOTA 2O2EA 4XIIA 4YY3B 1B8VA 1PQYA 5FBQB 1T3ZA 4NV0A 4IRXA 4L5AA 1GCGA 1VL8A 4L6IA 3AM4A 3TOZA 1TYAE 1RXWA 3D43A 4YT8A 1L8QA 2ZJ4A 1XLTA 1ZHHA 2YS6A 1XQ6A 3O3NB 4P08A 5F7OA 3IOBA 4FMBB 3OT1A 1PFWA 3UXYA 3QKRA 4ZKDA 4CKCB 1Q74A 1CGJI 5DI3B 2XTZA 5AM5A 2E1PA 2JAXA 4FEGA 2A5YB 5AOAA 2GPSA 5CYFA 4PLHA 3VAAA 3MEQA 1R16A 2D0DA 3B20A 2AKAB 1CFJA 2EX4A 5DK6A 4EMUA 3EPRA 4AQDA 4L9WA 4MZXA 1MDBA 5K0ZA 4E94A 1MQAA 1YB1A 4TLBA 2FVYA 1KNXA 4ND8B 3ZVKA 1DAEA 1OLXA 2KLHA 1XOIA 4DCGA 1ESZA 2BR5A 1Z4LA 2V4UA 1I10A 1N9KA 4REMA 5CW2A 1GA6A 3UT0A 3BKWA 1GPBA 4CLRA 5L6MB 5TQ0B 1KPGA 1XTJA 3A3OA 3SEKC 2O0LA 3IURA 4I9GA 4A5OA 3JS5A 3ETCA 4RKWA 4F3YA 3THXA 1OB2A 1W4CA 3RSOA 2H4XA 4HAVA 4HN2A 4ZCIA 1PZHA 1IZ9A 1KEZA 4I1OA 2HSEA 3BZBA 4A24A 1LCIA 2WHEA 3P2OA 3VUFA 3QOXA 5TJ9A 5DLQC 5KTTA 1WHSB 3JWPA 1GNSA 1PGNA 1GN8A 2OV1A 3BXGA 1A72A 2X86A 5D7BA 3V7YA 4FLFA 4MWZA 3TOCA 4D9GA 1JGTA 3MJFA 1WSAA 4OJMX 1E3IA 3I6YA 2RHWA 1EK2A 2VNJA 1R2QA 1RXSA 2BZGA 4EO7A 2JARA 2W8BA 3K94A 3S44A 3AKDA 5DBEX 5HIAA 3N2ZB 5AVXA 2XMSA 4IDOA 4FYVA 3F6RA 3HH2C 2WM9B 1UJBA 4YALA 5LC1A 4KH0A 3MCUA 4EZEA 3PQDA 1D8TA 3M5PA 1LW7A 3E35A 4KXVA 1RRMA 3LT5A 4FCTA 4Y9TA 4BX8A 3HG7A 2ZIUB 3LUKA 1RKXA 2M1ZA 3UGKA 2Y92A 4CG2A 5I7EA 3L0ZA 3SQMA 4QGAA 4XWOA 2GHRA 2JGMA 1VG0B 3H18A 3IIIA 1C30A 4QFBA 3EDCA 3LPNA 4D82A 1RCUA 4EJMA 4QEKA 2O2JA 3QKIA 1QZTA 3CM0A 2GI4A 2XUAA 3UWSA 1XHFA 2YL2A 1L7QA 1GCOA 2HX1A 4C78A 5A0VA 1UWKA 2O5RA 3LNCA 4NXNB 4ZJUA 5JYEA 2XAUA 4NZNA 4U2EA 2VQ3A 2O2SA 3MRTA 4L22A 4XM0A 3IA2A 4ASUD 4BTVA 4DADA 3UJPA 1UM9A 1UZUA 2BGRA 1OCEA 3NTQA 1MRZA 3VJKA 2CVFA 4D97A 3ZZNA 2G9VA 4KGXA 3GZTB 1FVFA 4JELA 5E4YA 3TQQA 2P4QA 3FSYA 3MD9A 1KRXA 1LPBB 2OCDA 2H3EA 4K3VA 4UEWA 3RANA 1SZPA 2AOXA 2IXDA 1JKXA 2JIZA 3DD1A 1OFGA 3LD9A 1P75A 4CVNA 4D9IA 3CWZA 4MJ3A 1ZNYA 2GXQA 1DJLA 1FY2A 1U8YA 2E4UA 4OVKA 1CUHA 2EXXA 4PXAA 5ARCA 1OAOC 3L8MA 3QE0A 1EPUA 2WTBA 3GRUA 3KQPA 1ZUWA 4N03A 2QUKA 5AKKA 5EE9A 4IRMA 4ITRC 1PYDA 3HMKA 1T8PA 1L4HA 3E7DA 5B12A 5IFLA 1FB5A 1G3MA 1NN5A 1PQ4A 4MQFB 2Z56A 3HZOA 4IICA 2HKIA 3ICCA 4DRXB 3CJTA 2A1IA 4FMDF 1KL7A 1NKTA 2NTNA 3FPJA 5L3ZA 1MEEA 5C7OO 4Z7JA 3H6KA 4YJ2B 3WLKX 2NWQA 3AEKA 3IBFA 5HS6A 2IXGA 3FTNA 4Z49A 4OVOA 1MOQA 3ID6C 5JLAA 1EX1A 3P5SA 2IFTA 4FHDA 4RC9A 4Y18A 2Y1OA 3I52A 1SXJA 1VRWA 1C7JA 1O94A 2XWBF 1CJMA 1TUEA 3HEAA 1AGRA 2IV7A 2C2GA 4Y6QA 3LP8A 2I3GA 2PUJA 4MR7A 2PU5A 3QPDA 3ZC3A 1FSPA 1ENOA 2GAAA 4YR9A 4KXFB 2YYYA 5ESRA 3M1IA 1MNQA 2X1MA 3PUKA 5CNJA 2VAXA 4LUCA 3UOAB 1KEEB 2XB4A 3B1FA 1ULAA 1UC5B 2OHXA 1K08A 4XDYA 1BXGA 4R98A 4BEJA 5SY6A 2UVOA 1WR8A 4LVOA 2DSTA 4ER0A 1NJ5A 3USES 3QX3A 4PG6A 2WHXA 4GX5A 2WKQA 1NSYA 1GXSB 3G17A 2ATXA 4KQGA 3GP3A 1K5PA 4U6QA 5IBPA 3ZXYA 4B81A 3RFCA 1T9HA 3O4VA 5THQA 1HPLA 2WE8A 4LE0A 2NQ2C 2REBA 4UHDA 1RACA 5ALJA 4I1UA 4UARA 4UE2A 2W2VA 5JJIA 1YQDA 1XQ9A 2WT8A 3GRVA 2BAGA 1V5WA 2A33A 2CEAA 3K5WA 3R3VA 4HEA6 4HX2A 4MK4A 3FYTA 4JI3B 4AJHA 2IHJA 4ZVLA 1WV0A 4NCJA 4DCSA 2J6HA 1MJGM 3DMNA 4M7OA 2OBNA 4D4HA 4F93B 4QGHA 2ERWA 2PSSA 4WN9B 4JLDA 4ER7A 1PE0A 2VHTA 4J1SA 5IYZA 4UDNA 1E7MA 3Q3GE 3ZU4A 1MQ8B 3G9QA 1UZLA 1YCFA 1Y8QA 1YZNA 4KRGA 3ROFA 1WB5A 1ZCAA 2AWNA 2D2IA 2QSUA 1EVJA 3MBKA 4OHOA 2OMEA 1JEJA 4NCIA 5KYXB 3I9V1 4RE5A 2VP9A 3AXTA 1FTSA 2P91A 2C3YA 4NJOA 4DR2B 2E48A 4JCVE 2J59A 5F1YA 3S28A 5KQSA 1QPGA 2J7KA 3S4YA 4YX9A 1BDHA 4RQUA 3ZCRA 2EJUA 3LY7A 3EHDA 4HWGA 2O8BA 1XD9A 4K03A 3FHCB 2HA6A 4Q4AA