2QPOA

Thermotoga maritima thymidine kinase in the apo form
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
180
structure length
153
Chain Sequence
SGKLTVITGPMYSGKTTELLSFVEIYKLGKKKVAVFKPAHVIERPEEMRKYIEEDTRGVFIDEVQFFNPSLFEVVKDLLDRGIDVFCAGLDLTHKQNPFETTALLLSLADTVIKKKAVCHRCGEYNATLTLKVAGGEEEKYIAVCRDCYNTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quaternary structure change as a mechanism for the regulation of thymidine kinase 1-like enzymes.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Thymidine kinase
total genus 45
structure length 153
sequence length 180
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2007-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2qpoA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qpoA01
1ZNXA 5E4FA 2W0MA 4IOMA 4TSFD 2DHRA 4KLNA 4WZBE 4EDHA 5FOUA 3RDPA 4A8JC 3BORA 2A5JA 4MITA 5FPSA 1LTQA 3GLFB 5CM9C 3B60A 1NY5A 5CYPA 5AJWA 1NNEA 3HWSA 3CF0A 1XXHA 3IGFA 3P20A 2P6RA 4NYIR 2RHDA 1E2HA 3B78A 3GJXC 4QHTA 4A82A 4CEIA 3A6PC 2HXYA 4DT1A 1MOZA 3R8FA 2FG5A 2W6JD 1H8HA 1R0XA 4LV8B 2XAUA 5AK0A 1ZMXA 4AIIA 4PFSA 4PC7A 1R0ZA 5L3QA 1NLFA 4I1OA 3TQFA 3VX3A 3UWOA 3BAFA 4B6DA 3RLFA 1HTWA 3SS8A 1PLKA 3TAHA 1XMSA 4JLNA 3I32A 1U9IA 2PJZA 2FNAA 4PC3A 4Z54A 1QHYA 1U81A 4QM6A 1RE0A 1DG3A 3RWMB 2QPAA 4DLXA 3PEWA 4F38A 2JLUA 2EU8A 4CEJB 1S9DA 3KKQA 4C7OA 2ZR7A 3QENA 2ZRJA 1G41A 1JBKA 3W6NA 2ZVQX 4P31A 3QXSA 1RYFA 2OAP1 2YC2C 3T1VA 5CDFA 4XVRA 3MSXA 5JEEA 2GCNA 4EPRA 1I2MA 3DKPA 4GZLA 2ORIA 4FD2A 5DNYB 1XD8A 1S96A 2FE4A 2ZIAA 2ANCA 3U44B 4JL8A 1I4LD 3W90A 1P5ZB 1KI8A 1FOEB 3U60B 4Q9KA 4LHVA 4LDJA 5KDLA 1TAGA 3ADDA 2IYLD 2QAJA 1TBOA 3A36A 4L16A 3RHFA 4G01B 3ZS9A 1KJZA 3K53A 1ZNWA 1L4UA 2IXFA 1EXMA 1R5BA 1S0UA 3K9GA 1AKYA 4M8NE 3TUIC 2H57A 2FJUA 2BHRA 4HAUA 4KAXA 3PQCA 3T06B 1NG9A 5JLJA 1T3LA 2GBLA 1KSJA 1XJQA 3A1WA 3O8DA 1GAJA 1SXJE 2C78A 3Q72A 3BJIA 2CMKA 3FVQA 3CIOA 1ZNYA 3R8CA 4PHTA 2IWHA 4TL9A 1FTSA 2CHQA 4BFSA 2J0UB 3DDCA 2AN9A 3CRMA 2IHBA 4KV9A 4US0R 1G7SA 2QAGC 3ZIAD 4DKXA 3E2IA 5K8UA 4OBEA 5KNBA 3BRWD 5GJVC 2IYTA 4YDHB 4MRVA 4A8JB 1UBGA 4ZDIA 2WJVA 4BFUA 1B23P 1E2EA 2OBLA 1YR8A 4XD7A 3WMGA 1E1RD 2OXCA 5CYOA 4F4CA 2ZM5A 4D4MA 1W1WA 2ZRDA 2MSCB 3NWJA 5FOXA 4TTQA 5HZHA 3SQWA 4C2UA 4PQRA 2C95A 2BKUA 1LB1B 2DY1A 1OJLA 2ZJBA 3R9IA 5JWOA 4HEJA 2V7QD 1G9XA 4JVLA 1LY1A 3CLVA 4YMWA 3TJZA 1BYUA 2VBCA 3KZ1E 1NRJB 5EP1A 3NC1C 2GVDC 4GFDA 4LJ6A 4LBZA 1WMSA 4BRUA 5DH9A 1KMHB 2V8OA 3I8XA 2GJKA 1KI2A 2HLDD 2GEUA 1P2UA 2V54A 2B7CA 5P21A 4L9SA 4M0LA 2XOKD 1LFDB 3KJHA 2P6UA 1ZAKA 1W5SA 3PFIA 3T15A 2GNOA 4QBGB 2REXB 4PHGA 4OHXA 3OFND 4M9QA 3JVUA 3WNCA 4P33A 2ZI4A 1C1YA 4MRNA 1OSNA 3IUYA 1JQJC 2GCOB 5L3QB 1KI4A 4L9MA 3OIWA 1E99A 2OZEA 1NKSA 3H2YA 4IOKA 4PPFA 4AKGA 1II0A 1P4SA 3ECCA 4P4SB 4TQAA 1KGDA 2PX3A 4MGIR 1QHNA 5FTMA 3GJ6A 1HY3A 1FX0B 1KAGA 4LHZA 2IYZA 3I1FA 3RS2A 3T5DA 2ZRGA 2W6IA 3VNUA 1YJ5A 5G53C 3EPKA 2GZAA 1G3IA 2BKEA 3BH0A 3H86A 4RZ2A 1GSIA 2WJYA 3IIKA 4LC0A 4YC7A 5EJEA 3BB3A 1KY3A 3QPUA 2EWVA 4G3XA 3KQNA 1QVAA 4JLJA 4DIEA 2QRZA 4EJSA 1Q1QA 1DPFA 3K70D 3QOFA 2QGNA 4HI0E 2BMJA 3CZPA 4RY2A 1K5DA 4EKDA 4RD0A 1IOZA 3LO5A 3DM9B 3TKLA 2QRNA 3AVPA 1LS1A 3ZH9B 1XTKA 1G18A 2DWOA 3CNOA 4TL8A 2GJ8A 1VIYA 3C8UA 3B1XA 4E22A 1OH6A 1TF7A 2VRWA 5DI3A 3X1ZA 4BFXA 1T3SA 3Q9LA 3WY9A 3O47A 3HU1A 4KFUA 2CLSA 2ZRCA 2NO9A 4B48A 1FTNA 2R62A 1QZXA 4GBMA 4G5GA 4R7ZA 4A4DA 1JPNA 3EASA 4Q4AA 5KDDA 4N3NA 3LV8A 2GVZC 1W49A 4BFTA 2EFCB 4M53A 2VP6A 1OHHD 1G19A 3PUWA 4QGGA 5B2ZA 3SZRA 3JVVA 1WP9A 1E2KA 2Q0HA 3THXA 1AS3A 2CEAA 2ZUCA 3LH5A 3H1TA 3AVVA 3B6EA 1CTQA 2CJWA 1IJFA 4XVQA 4Z8YA 1W4AA 5KOYA 1IHUA 4A6PA 1VCMA 1SXJB 3UKDA 1P7CA 2C8VA 1MRNA 4CF7A 4JMPA 2GXSA 3W3AA 4NCNA 3HYRA 4JVMA 5KHOC 1E0AA 5AJXA 3R9XA 3BH6A 4JLBA 5DHAA 1ZJ6A 1AZTA 2F1IA 5KSPA 2KBEA 5JZVA 2BBWA 5KNDA 2IYWA 3ZS8A 2HF8A 3DO6A 2G0TA 4WA7A 3TW4A 2MSDB 2ZU0C 4UNSA 5KPDA 3CXLA 3UGLA 4C0QC 3K70B 1HEIA 3UK6A 2QM8A 1UBEA 4DDWA 3N2EA 4L4UA 2IS1A 1IXZA 2RMKA 4W7SA 1HYQA 4QNRA 4TMKA 3D6TB 3WXMA 4LV6A 3NXSA 5JSZB 4TL7A 3R20A 3ZZUA 4CEHB 2BV3A 3L0PA 4KFTA 5E7JA 3KJIA 3PR1A 2OCPA 1DAGA 4KI0A 4LYFA 2JLYA 4A6XA 1Z0IA 4Q7JB 3GLGA 4AI6A 3VKGA 4B3CA 2ZITA 2XZOA 4WBSA 4PZLA 4EFNA 5EP4A 2QROA 1ZW6A 5KU1A 2V4ZA 4P3YA 4C0HA 2ZRFA 3U44A 1R0YA 3CF2A 2OCBA 4DB2A 1OH5A 2XB4A 2VRWB 5DI3B 2F1JA 1RJ9A 5HZKA 3B82A 1LF5A 4KHZA 4KXFB 3SNHA 4KVAA 1D8TA 3KJEA 4M22A 1KO5A 2DR3A 1K8RA 1VYVA 4LZZA 2F43A 4DIDA 1QHHB 3B1WA 1N0WA 2H16A 3GLIA 3IKJA 1CR1A 1P2VA 2FPKA 1W0JD 2ZEJA 4DLUA 4HDCA 2BVNA 1KAOA 1HUQA 3CR8A 1M1YE 4XTCS 3UG7A 4NKRA 2AWOA 1TQ6A 2HXSA 1DAKA 3KB2A 1TUIA 3MJHA 4WXRA 5F98A 3HR7A 4BGDA 2Q9CA 3WRXC 1IBRA 3FMOB 1GDDA 1QG4A 3QF7A 2PMKA 2DFLA 4AC9A 3SN6A 4B34A 2ZI3A 3IIMA 2XXAA 2ROWA 3A37A 3CPJB 5G41A 4M4SA 1X6VA 2XTNA 1F2UB 2ZJOA 1E0JA 5DI9A 4A0GA 2WWWA 4TMVA 2O8DB 1NLYA 1NBMA 1XTJA 2OE2A 3DM5A 2PLRA 4NYJQ 2RGAA 1TU4A 1E2QA 1P9NA 2FX3A 3PUXA 1T91A 3TRFA 1IM2A 1Y3AA 2E87A 2YOHA 3RSOA 3W8RA 2ODNA 2DB3A 4M9XA 4DLRA 4MKIA 2C03A 3R7WB 4BPBA 2WPDD 4QGFA 4URYR 4P4TA 4F92B 1XFAA 3QBTA 3SOPA 2D2FA 2YYZA 4UNPA 3A4NA 4HLUC 5JBQA 4DDVA 4OL0A 4D4JA 5L8VA 3NHAA 3QUSA 2XNSA 4KO8A 1KTVA 2ZR0A 3W5IA 3KKNA 3EPLA 2ZI6A 2NGRA 4EPXA 4Z8XA 2YJTD 1RYHA 4LOAA 3I73A 2VP9A 4PX9A 3I4LA 4Q7MB 2GJSA 4OHYA 4MYHA 1NLZA 1T5LA 4A8JA 4DUGA 1Z0FA 4MKHA 1KJWA 4MYCA 1TBNA 4NMMA 4E5UA 4OI4A 1ZM9A 2IEYA 2D06A 1OYWA 1XTRA 1XMJA 4XWKA 1N5JA 1W36C 3AQ4A 1P9WA 1E96A 3C15C 3UXMA 1I4TD 1RFLA 5AR1A 5F3WB 2WBLC 1JNYA 4U5XA 1UAAA 2A9KA 3QY0A 3BD9A 4LV5B 4AY2A 3V9PA 5BXQC 2AFHE 3LNCA 3N5CA 3KTAB 3DEFA 1GVNB 3SU8A 2GXAA 2QAGA 2P6NA 2C77A 3NH6A 4M2LA 3THWB 2IWRA 2XSZD 2VL7A 2Z5FA 3LWNA 3QE0A 3MFYA 1RJ9B 2WWGA 4RKFA 1KSFX 3O8CA 2Q9AA 4M1YA 3BXZA 3QNUA 4FN5A 4JYCA 4A0FA 4B76A 3T1OA 3SJBA 2WKRA 3ZVNA 2G88A 1JECA 1JEEA 1J8YF 1N0UA 2QNRA 3CRQA 4HUQA 4DT1B 4YMVA 2FWRA 3NBXX 4Q48A 4RJLA 3U7FB 1Z22A 1ONBA 2O0JA 3RYTC 4JBWA 3AVOA 1M7BA 4YONB 2J0SA 1TPZA 2ONKA 1RZ3A 4UNRA 3DPUA 3K8YA 3LLMA 3CPEA 1II9A 2NO6A 1OKKA 3MD0A 4NDZA 5B30A 1UKVY 3RWOA 3MWKA 1ZYUA 1SXJD 1ZU4A 4RD2A 2Q6TA 5FUWA 2EQBA 4TQ9A 4NTZA 4U02A 5K8IA 3KKMA 3SEAA 1A5TA 2IK8A 4XJXA 4JJZA 4JYBA 1Z6XA 1II8A 3NKVA 2FDCA 4AYXA 1W4RA 2WM9B 4JL5A 5CK4A 4LHXA 5FBWB 3WRYC 4E09A 5JI3E 2CVFA 2AFIE 3PXGA 1OFTA 3QVVA 3H0KA 2DCUA 3FB4A 1G8FA 3H84A 4B6FA 1P72A 1JXOA 2OXRA 1M7HA 4I1SA 1VG9B 1OIVA 1GRNA 3LBIA 4DDUA 3K0AB 4C30A 2V1UA 5JMTA 3VFDA 1TF2A 2ASEA 4BZPA 3UMFA 5GJWC 1D2NA 1YR7A 1AQUA 1GITA 4TLEA 4MKFA 3C41J 4Q9JA 4CW7A 5C2JB 1G8HA 4ZCMA 3RS0A 3AUYA 3CKLA 5KSYA 1NF3A 1XEXA 1FW6A 3PITA 1VHLA 5FOSA 1DAFA 1G4AE 2QA5A 4NYMQ 1E79D 4KBFA 3TQCA 1NIJA 1VMAA 3GJ8A 4AG6A 3VR5A 2QN6A 2HJGA 3W6OA 1JAIA 2XXAB 3F0TA 4S2EA 4Q4LA 1ODFA 1S1MA 2RHMA 5G3YA 5DISB 1CP2A 4M1OA 5BQ5A 2GZHA 2QQEA 4JBYA 2WWYA 4DCTA 1XD2B 1W47A 3EARA 4ILEA 3FOZA 1ZC3A 2A7QA 1PUJA 3U3MA 1A7JA 2BWJA 1FP7A 3QKSB 3TUZC 2V6IA 4YXWD 3KKPA 4IJMA 1W36D 3QJYA 4D26A 1FPMA 2CK3A 3C14C 1US8B 1KDPA 2RGXA 4ZI2A 4LBVA 1UEIA 2F3RA 2ZE7A 5HCNA 1JPJA 2ODWA 4IDPA 1FFHA 1IJEA 1FNMA 3KXKA 1MABA 4FINA 5FTKA 3W8NA 5SZHB 4IVRA 1LF0A 2NO1A 1SZPA 2BCGY 1QHGA 3THYB 3DZDA 2P0EA 3GQBA 3K9LA 3L8ZA 3TGPA 1G3MA 4NCJA 1M8PA 2YWFA 4WVFA 4H9GA 2IT1A 2HJVA 2VP0A 4H1VA 1VIAA 3QXHA 1F48A 2E1RA 1UADA 2ZAMA 1UBCA 1VYTA 4FW9A 1N0VC 5GVRA 4FKDA 2O8EB 4KFSA 3VHXA 3U7HB 4D0GA 1U2RA 3LDAA 2CHVA 1G3RA 1T0HB 3T1QA 1TQ2A 3RANA 2GDJA 1F60A 3WNBA 4EPTA 3GJ4A 1TQDA 1F2TA 4PZZA 4TT3A 5H8WA 2JDIA 3KQLA 1T3HA 4V0ME 1U0LA 5H1YA 1CIPA 4NL4H 1KBEA 1TL7C 2ZE6A 3CBQA 4ON9A 4LJ4A 521PA 5BWMA 3TLXA 2LKDA 1KZ7B 1XMIA 5K8TA 5FR2A 3I5XA 1J8MF 1Z63A 2QSZA 2FEOA 3C4JA 3WHLA 3K0FA 4UNNA 4IXNA 4GMXA 1Q20A 4JZKA 3KUDA 5CJ2A 3ZD6A 5CIWA 1MH1A 1R4AA 4IFEA 3I72A 4ARZA 5A5GA 2G83A 4TSFA 2XTZA 3UG6A 5C46F 4B3BA 2XJ9A 5EUMA 2JLZA 2FNFX 1CRQA 4ZDKA 5JS8A 4M1WA 2R8RA 5BN4A 3QKTA 1GKIA 5C4MA 3OEED 4HAXA 421PA 5DYGA 2WOOA 2ZE5A 4CT5A 5L3RA 5IHPA 3OESA 2VLIA 3GFOA 2GBLC 3SYLA 4GDFA 2ZANA 3CWQA 4OI0A 3TE6A 4B75A 2F7SA 5FFMA 4EFMA 3IQWA 1T9HA 2W6JA 3FMFA 4RD6A 5EUQB 2KBFA 3G5UA 1XA6A 5JSZA 2VTKA 1SVSA 1WF3A 4XSGA 2JJ2D 3QQ5A 1SVWA 4IDOA 4Q02A 5FI0B 2AKYA 3X1WA 1ZIPA 2YWHA 2ZSBA 1YR6A 5CJPA 2XX3A 4DBLC 2F1HA 2G77B 5FTJA 1PTQA 2W2TA 4PC6A 2REBA 1NP6A 1AN0A 1V5WA 5HE9A 4HAWA 2QORA 1HURA 1Z2AA 4BLRA 1GKYA 5LB4A 4IFBA 3P4YA 4DSUA 4XOIA 4JIMA 1T0JB 5DGXA 3E1SA 1Q44A 5G40A 4UXIA 1DELA 1K6MA 1Q21A 1MT0A 2ODBA 3QXJA 3FMIA 2P5SA 1NBMD 2OBMA 3B1ZA 2FZ4A 3C5HA 2YC4C 3FWYA 2FOLA 1SHZA 1NMYA 1G7TA 2IYQA 2HUPA 5JRJA 1Z5ZA 4GRAA 2ZS8A 4M1SA 5FL7D 4TZ0A 4YMSA 1F6BA 3RS3A 1GFIA 2YKGA 2E9SA 1XCGB 5DHFA 1X86B 4JLOA 4P4UA 2ZE8A 1KKLA 1UF9A 4MGYR 3VR4A 3GLHA 2XZLA 3L2OB 3KQKA 1WDTA 1N6NA 2GESA 2VHQA 1DO0A 4XH9B 4A36A 3MJRA 3IBYA 1RPZA 3FPAA 1W5TA 3IILA 4OJKA 4MGKR 3TVDA 4N0DA 1LVGA 4BLTA 4C0JA 4F91B 4Q19A 2N46A 3HU3A 4A0RA 4B3GA 2V1XA 3EX7C 2PMDA 3LBNA 2ZRIA 5FPTA 4O0MA 3RRZA 2WZQA 2O8BB 3VMFA 3LBHA 3ND8A 4NU0A 4AWXA 3CB4A 3IQXA 5TMPA 1VDZA 4B2PA 3H4MA 4TT3D 2BOVA 3EZ2A 1C4OA 1SXJA 3TNFA 2NTYC 1KMQA 1MABB 2QP3A 1G8GA 1YHNA 3AH8A 4EQ6B 3KXLA 3UGDA 2CNWA 4DHEA 1W2HA 1DAEA 2A5GA 2NZJA 4RD4A 2IYUA 1E9RA 1TU3A 4FMCB 4Q03A 1AGRA 1Q3HA 2ZQ5A 1L4YA 2ECKA 1OYYA 3GMTA 3REFA 1ZD1A 1OXUA 3BBPA 3UEYA 2D7DA 1QRAA 1KI7A 4JJKA 4DCUA 2I1VB 3SE0A 3UMSA 1XMVA 1G4UR 1KK3A 4EFLA 1P60A 3QXXA 2OLJA 1YU9A 2IS4A 2DB6A 1EWRA 1N6PA 1XD9A 3A1TA 1I2DA 1QVRA 1IAQA 4DVGA 2H18A 2FV8A 4URXR 1CR2A 1BMFA 3C5CA 2GJAA 2ODEA 2IYRA 1CS4C 2HV8A 1CULC 3X2SA 1NMZA 4OQMA 2VPPA 2QM7A 2NPFA 3P4XA 2TMKA 2QT0A 4TN1A 4C0BA 1UJ2A 1VYUA 3LVRE 3T12A 4FIDA 3CO5A 3FKSA 5KDOA 4PSVA 1PVOA 3J81k 3W9YA 2W83A 1VKJA 4JL6A 1E9FA 3Q8XB 4DEXA 4OI2A 2J3EA 1U0HC 2A30A 1IN8A 3CH4B 3DHWC 2QY9A 5D3QA 4RZXA 3BGWA 2FF7A 2C9YA 4HAZA 2ZYTX 3U6BA 1XU4A 4N0EA 1FP6A 2CHGA 3SYNA 3NDPA 4Q00A 1FZQA 1D6JA 1R6BX 2H1LA 1U0JA 2UZIR 2YWEA 4G5OA 1KI3A 1X8LA 2F6RA 4Q1AA 1P2TA 3NIBA 4Q18A 2VHUA 2BMDA 2VF7A 3O8RA 4HZIA 4BUJA 3U61B 4NONA 1IN6A 1ZUNB 3SJCA 2W6ID 3HU2A 4IHQA 2GZDA 4ZKDA 3EPHA 3M6AA 1JEDA 3AVQA 3E70C 1HT2E 2CLCX 721PA 5EZ6B 3NEYA 2F43B 1J99A 1E98A 1ZM4A 5FPYA 4YMUA 5HPYB 1W44A 3ZLJA 3D8BA 3ICEA 4I81A 1G64A 4AKEA 2I4IA 4HSEA 1FX0A 2B7BA 2HCBA 5HKKD 1Z0KA 4C4PA 4IVQA 4LWZA 5GJBA 1DVRA 2H7VA 3ZVRA 2VSXA 4JKIA 2W58A 4HB3A 4PAMA 2ZRMA 4JLAA 2A5YB 2ZAOA 4BLOA 2DBYA 4WW0A 4A2PA 1BYIA 5FI1B 5FL7A 1IY1A 1GM5A 3K09A 5DN6A 2X2FA 3SDZA 4HAVA 2ZI7A 3K9HA 4PANA 4Q1FA 2WVJA 4CRWB 4B74A 2VHJA 1IY2A 4JSYA 4BEJA 3I5YA 4N1AA 2CL7X 1N6OA 4TYNA 3X1YA 3GEIA 1XPUA 1FMJA 4AYWA 3B85A 1PV4A 3LXRA 3C7KA 1CEEA 2R65A 3B1YA 3LX5A 3T5GA 1XF9A 3GLHE 5AJVB 1E1RA 5EE9A 4BLQA 1DAIA 5F2EA 4HLUA 2VSOA 2ZS7A 1Q12A 1T4GA 4OYHA 1OB5A 4GOXA 3QKRB 1Z83A 3AEZA 4GNKA 4FWTA 3IPYA 3ADKA 2FPMA 2HF9A 1OH7A 3GLGE 4C0KA 3U3KA 4B33A 5FUXA 2QQ0A 1BMFD 5TVKA 1GNQA 4ARZB 2PT5A 1XWIA 2D4HA 2FFBA 2ZSFA 3GLFE 2J7PA 4RKEA 3KY9A 2CL0X 1XZQA 4BFWA 4TMZA 2BBTA 5IK2A 2IX3A 3FKSD 5SZJA 1Z28A 1W46A 1SVOA 3HYTA 5FBQB 3KQUA 2QMEA 1A2KC 2PEYA 2WAYA 4NBSA 3FDIA 4EQ6A 3QG1A 2WJJA 3PUVA 4B32A 3LLUA 2VHTA 5JJIA 4PTLA 1HH4A 2NZ8A 3MWJA 4MRSA 3OAAD 1NN5A 4POAA 3PENA 5LB2A 3V00A 2FSHA 5E95A 4LHYA 2AXNA 1RC8A 1QBKC 2FSFA 4HUQB 2AX4A 3LVQE 5AUPB 4TYPA 1DAHA 1AIPA 4D0NA 5J4YA 3UANA 3AVTA 3AP2A 1F3OA 4NCIA 1Z2CA 2GEVA 3EXAA 1OHHA 221PA 5JS7A 3BFKA 2FZLA 1UM8A 2WWFA 4QBIA 4FMDF 1A1VA 2JDID 3RABA 4Q1CA 1QHSA 3THWA 4TYWA 2ORWA 4F4JA 4D80A 3PV0A 5EE1A 4NYJR 4Q5IA 4LK2A 4D81A 3B8HA 2NQ2C 1MR3F 2FH5B 3EA0A 1XPRA 3EC2A 1AKEA 4CEHA 3AF4A 2O52A 1XEXB 4LYHA 1DADA 2ZRAA 2ZJAA 3EWSA 1XEWY 4G5QA 4HZUA 1I4DD 4XWOA 4KSCA 3AM1A 1P75A 1KDOA 1EFTA 1EESA 1Z6AA 1XCMA 1TQ4A 2PLFA 4CEJA 1X3SA 2ELIA 1NIPA 3CRRA 3FKQA 5IDVA 1LS6A 1SKYE 1UEJA 4FI3C 5LD2B 3AGQA 3VHLB 1Z6YA 1KI6A 2JJ2A 2KB0A 3VQTA 1N2CE 5AUOB 3A58B 2VQSA 4UKDA 2MSEB 2UVQA 3F8TA 4M1KA 2RH5A 3IEVA 4LX0A 3ASYA 4QGHA 2OCYC 1Q1ZA 2J46A 5GVSA 3AVXA 4OK3A 4ZCLA 3V4FA 3M0EA 1R8SA 2G3YA 2N1BA 3CX7A 4Q1BA 4RCZA 4V0NA 1DTSA 2V3CC 2QP9X 4FWIB 2BMEA 1G7RA 4A0HA 4ZV4A 2FGJA 1TF5A 4HDQB 4QXAA 3THOA 2H17A 4UXHA 3HP1A 4DSOA 2CJWB 1GOTA 2QZ4A 3QSYA 1AM4D 2VSFA 3KUCA 3UATA 1KSHA 3WHKA 3ASZA 3ADBA 1CJTC 1E4VA 4IXMA 2OG2A 4R71A 5DE3A 3CF6R 1CLUA 2QEQA 4TMXA 5F9HA 1P2SA 3SJZA 1WXQA 3VU9A 2CCKA 2HT1A 2QMHA 2XEXA 2QPTA 4DWJA 2JASA 8OHMA 1W36B 1QG2A 2WWIA 1ESNA 1G5TA 3A4MA 2GTPA 4TL6A 5EE3A 3K1JA 4D82A 3CRW1 3QI2A 2C5LA 2ZYVX 2V7QA 3FE2A 2FFHA 2ZJ5A 1A2BA 4MYTA 5LDDC 5JCPA 1RRCA 2WJGA 4PC2A 1NVUQ 1SQ5A 3Q3JB 1SXJC 1VG0B 1XZPA 3MAAC 3QPVA 1T8UA 2PZEA 3ZZTA 5B64A 2OAQ1 1XTIA 1IONA 4UJ5A 2IYVA 4KYIB 3TH5A 3NBZC 4ZIRA 4Q1DA 4OI1A 1MRSA 1D5CA 2IYXA 3OF5A 2ZJ2A 2CLDX 4HZUB 2EFEB 1JR3E 1NJFA 2NG1A 2ATVA 3RVBA 4MH0R 2IL1A 4A1FA 4DCSA 4MA4A 4HYYA 5AJZA 2HEIA 1EG7A 1AS0A 5UKDA 2ZUDA 1ANKA 2GAOA 3TSZA 2DWPA 2NIPA 3MG9A 3MLEA 4IW3B 2VO1A 1FARA 5FBVB 5IRCD 1Q1BA 2Z4RA 3UMRA 1NI3A 4P4SA 1XEWX 2J7KA 2PCLA 5GJCA 3VNVA 3ZIAA 2WV9A 3WYAA 3LAWA 2OCAA 2GJ9A 1OF1A 2FFAA 2BCJQ 5LD2C 1E0SA 4OQNA 5FR1A 1JAHA 4IVPA 1Z08A 1EWQA 3RS7A 2OUKA 1RW4A 5AJYA 4TLCA 5EXTA 1NSTA 1ZC4A 2QUZA 3MWLA 2G9NA 3R7WA 3M4YA 3RSLA 2J7PD 1VCNA 2AXPA 2BMFA 5CIQA 5SZIA 1E9DA 3VTKA 3I61A 2O8FB 3AF3A 1GG2A 1Z0AA 3VR3A 5FBLB 3EWAA 3QEOA 4K46A 2R6CA 4ZPXA 3NDBB 3EZ7A 2ZETA 4F93B 4FCVA 3DOFA 4US1R 1GUAA 3WMEA 2BBSA 2NO7A 2B6HA 4CZ2A 4LC1A 3LXXA 2B21A 3ZGXA 5EXXA 5JCZA 4HB0A 2OILA 2WJIA 5J4LA 4KITB 1CRPA 1VECA 1AQYA 3EAQA 1J70A 1U8ZA 3PVSA 2WWXA 3VU9B 4U00A 3U3OA 2QE7D 4G1UC 2W2VA 4RD1A 2YOGA 3TUJC 4Z51A 3FFBA 3GD7A 4ITRC 4TLDA 1ZRHA 2BJVA 4AYTA 5BW8A 1VG8A 2FMXA 4JT2A 3W6PA 2PZFA 4PSKA 1YVDA 3PJRA 1W0KD 4BZQA 1NL3A 4ZIRB 2GVIA 5HCIA 3K0EA 2CDNA 3KFVA 821PA 5JHGB 2ZJ8A 1O3YA 2CCJA 1G6HA 1G6OA 4MRRA 5SZKB 3BC1A 3VR2A 2RGNC 3QKUA 3UWKA 2Y8EA 3FGNA 1N6RA 2WIAA 4M9ZA 3A4LA 1WE2A 4QKQA 2CCGA 4Y0AA 2YZ2A 2W2XA 3K09C 2ERXA 3UGIA 1Q22A 3P1JA 2NO0A 3VR1A 2ZRNA 1NMXA 2VP4A 3B9PA 3LQRA 3K0CC 4B43A 1P6XA 4QOSA 4LJ8A 4QM7A 1HV8A 4JT4A 4UJ3A 5J40A 4DRZA 3G0HA 3LRPA 1KDRA 4M9SA 2R6FA 1RIFA 4AURA 3QIAA 5DN6D 2Z83A 4LYAA 4B73A 3IPXA 1XDBA 3AKEA 1E69A 2O8FA 1Z0DA 3A8TA 3IO5A 4O3MA 1GZSA 5JWRA 2I3BA 3O8BA 2X1VA 4XIGS 1JALA 4TYYA 3TW8B 4YLGA 2GXUA 2ZSEA 4QNMA 4AD8A 3DMNA 4AG5A 2JJ1D 4IOJA 5M04A 4Q1EA 1W0KA 1OKKD 2JA1A 2YVUA 2EW1A 4KSBA 4FXPA 2ZI9A 4TTRA 2J1LA 4QC2A 4P32A 4FMDB 1MO6A 2OSBA 1X8KA 2GK7A 2RGDA 4B3XA 5J4HA 3UFFA 4I1UA 1UKZA 4DSTA 4LJ7A 4DLVA 1OB2A 2X77A 2KI5A 4NCHA 1AJEA 2QTFA 2J41A 3X1XA 2JLSA 2I1QA 2O0KA 3AKCA 2A2ZA 1D2MA 4XD7D 3ZQ6A 4ZDWA 1XXHB 2C98A 1X1SA 1T5IA 1OV4A 4DUGD 1CKEA 2JIZA 3KX2A 4DLSA 2QBYA 3LA6A 2OLKA 4HB2A 2VH5R 2D74A 2XSZA 4L8GA 4Q4JB 2WAXA 4DLYA 4A15A 1WB9A 3BK7A 1XPOA 2IUUA 3OAAA 1YZUA 4HLCA 4UNQA 4X8MA 3MCAA 3U3RA 3L0OA 1NJGA 2ORVA 1VPLA 2IHYA 2JEOA 2BDTA 1ZBDA 5BYKA 3AGPA 4K8OA 2CVHA 2PH1A 3ZJYA 1KK1A 1GNPA 2JLXA 2K5UA 4OJQA 4OK6A 2J0QA 2GRJA 4TMTA 1KK2A 3SBEA 1NVXQ 1NVVQ 2CXXA 1DO2A 4IDQA 2IS6A 1ZU5A 2ZJYA 4HUTA 1G7CA 2Z6VA 3ONWA 4OHWA 3KJGA 4HDOB 5DYIA 1S9HA 2EVWX 2GXQA 1R0WA 3AF1A 3GPLA 4D0LB 1PLLA 2ZSAA 3CRVA 3GCGA 3T35A 1AGPA 2R9VA 5EE0A 3PEUA 2ZYWX 1JB1A 3QF4A 4AKIA 3R9WA 1ZD9A 1JXMA 4DLTA 1W4CA 1ZIOA 1D2EA 1X8JA 3AB3A 3I8SA 4D6PA 1RRFA 4UQOA 2WPDA 1RRPA 1NVVR 1L7VC 1G5PA 2IYYA 2W00A 2KWIA 4Q4AB 2XB2A 5CLQA 4GP6A 5K8LA 2DYKA 1MO3A 2JJ1A 5CB6A 1Q0UA 1R2QA 2FFQA 1RKBA 1DAMA 2PBRA 1KI9A 2ONJA 3U6KA 5FPHA 3F3YA 2PT7A 1S1CA 4PHFA 1UKEA 1NBME 2GCPA 1U8YA 4JLPA 4PR0A 4RSGA 1XTQA 2WMOB 4TMWA 3EIQA 4URZR 4QJ3A 5GADl 3CUEF 4Q4HA 3W3ZB 4ACBA 2XTMA 3T34A 1XEFA 1GKUB 1TEVA 2O8CA 4RFSB 1WBDA 1S2MA 2GILA 2E73A 1M6NA 2ZRLA 3QEJA 1ZCBA 1G1MA 3CPHA 4MRPA 2ZXUA 1G17A 2GA8A 1N3BA 1EFRD 1Q57A 1E2FA 3P27A 2AK2A 4KODA 5C18A 4LBYA 2O8DA 4Q7KA 4L15A 4URWR 1N25A 4RCYA 4MUBA 4IEIA 3U2QA 1HE1C 2NPIA 3WNDA 4AK9A 3OFNA 2JLWA 3CX8A 1ESMA 1KOFA 3WMFA 1N5IA 3TSWA 3CH5A 3B5JA 3ND9A 2H8KA 3GJ5A 1E2MA 1KI1A 1YQTA 3JZMA 2C9OA 3UEJA 2EFDB 2EYQA 4PZYA 1IN4A 4NZYA 2QP4A 4W5HA 1EFRA 2DPXA 2QAGB 1M2OB 2FSIA 1KDTA 1Z6GA 1QHIA 1QHXA 4OK5A 1UFQA 1E2IA 4RZUA 4UXJA 3MUFA 4O2RA 2XGJA 3BIFA 3WBJA 1G8PA 1QDEA 1E6CA 2CBZA 5TB5A 3U7GA 5H68A 4MDEA 3K0AA 1F2UA 3FFAA 3SHFA 2FPLA 4BFZA 2G6BA 3BOSA 4PHHA 4A2WA 2J9RA 4JLMA 5F9FA 4P0TA 4NP6A 3U7EB 2Q21A 2L0XA 5FTNA 2JIZD 3IIJA 2AWNA 2VA8A 1XRJA 3OIYA 4GZMA 3WBKA 5JJKA 4QL3A 2JLVA 1CR4A 1EX6A 2QMUA 1LW7A 4ZO4A 3D31A 4L5BA 5KPJA 3T1TA 3DKVA 1Q1EA 4DDTA 1M74A 4LPKA 4MUAA 2A5FA 5D3MB 1ZM7A 3PEYA 4Q4JA 2JLRA 2ENNA 4KVGA 5DIFA 4IEEA 1Z0JA 2JGNA 3FTQA 5LBIA 2Q3HA 2O8CB 2D62A 2OFOA 2B8TA 4EUNA 4V02A 2OHFA 4J0QA 4F7WA 2MMCA 2ZTSA 4JLVA 1KO4A 4B71A 3EPJA 1N6LA 4TLBA 4FCWA 4URVR 3BB1A 2J87A 1SVMA 2IW3A 3SQXA 4DCVA 4X8OA 3GJ7A 4WIAA 1EGAA 2YV5A 4S35A 3TIFA 1UBFA 4GT1A 1E2NA 1OFIA 2ERYA 2IBMA 4G0NA 4CVNA 5ELXA 2IA5A 1OFUX 1T6NA 2VYFA 4US2R 1LV7A 2QSYA 2ZJZA 3BFVA 4BRWA 1S3SA 3GLHB 3PCRB 3BERA 1KNXA 1Z07A 3NBFA 2P5TB 4JVSB 5AUQA 3V4RA 4XWAA 4B2LA 1EFHA 1KSGA 3F5FA 4PPGA 2C9CA 4PC1A 5FPKA 4XSHA 2D3WA 3AF2A 4LY6A 2XNDD 4IOLA 3VKHA 4C7OB 4RFSA 3PUYA 2PL3A 5TDHA 3GLIB 2A3RA 2G1KA 3MMPA 2QG6A 4V0LA 1H8HD 2IF2A 2IXEA 4JBXA 4C0SA 2IUSA 4DZZA 1U98A 4QFMA 5KNCA 5EP3A 3BFXA 1O87A 3N2IA 4YMTA 1V43A 1XD2A 1S3GA 1G5RA 2VIIA 4QHSA 1IXRC 2OFXA 3RS4A 1E9AA 3OZXA 5JECA 1CR0A 3ZD7A 1IXSB 3B9QA 3EZ6A 1G16A 2WIBA 4OHVA 4PPNA 1YZNA 2EFGA 4Q9LA 3GFPA 1EFCA 1WQ1R 1FNNA 3CM0A 1NG1A 1UKYA 1Z8FA 1GL7A 4B44A 3BS4A 5CB8A 5FOTA 2PEZA 4IDHA 4JSTA 4TZ6A 4GOKA 1Z06A 4Q01A 1OW3B 4Q21A 3CNNA 1NN1A 2AK3A 5KSZA 3Q7QA 2GEDA 2PZGA 4JS0A 5D3MA 3IHLA 5TY0A 1OFHA 1WRBA 4WZ6A 1JR3D 3A1UA 5TARA 1YRBA 1R5NA 3K70C 4URUR 1OXVA 1E2GA 3KQHA 1W7AA 1ZUHA 1R79A 1IQPA 1KBFA 3FYHA 4LSGA 1DOAA 2WHXA 3BE4A 3RRMA 1ZM2A 4ZDJA 3LX8A 3AP3A 1WA5A 3KFXA 4HLDA 4Q9HA 4C3ZA 2ZI5A 3SFZA 2IC5A 1E2JA 4EPWA 4OQLA 4W5WA 4ASUA 2O8EA 4NPHA 4I99A 5L3SB 1FUUA 4W5JA 5J47A 4EIWA 2BM0A 5CK5A 5J4VA 4ERNA 2ANBA 2WJHA 2ZVPX 2WKQA 3LY5A 4A2QA 4V0MA 1VG1A 3Q7PA 4RFVA 1U9IC 3RRNA 1TADA 1R8QA 3TSOA 5JFGA 2ZS9A 3SYKA 5TXGA 1E32A 5JEDA 4D4LA 2AL7A 2D2EA 5JWHA 1G8YA 2J45A 2G0NA 2GF0A 3TK1A 3HR8A 2QI9C 3K0CA 4CDGA 1KNQA 1Z3IX 3AKYA 4F4IA 3B13B 4WXPA 3AVYA 1J2JA 1N6KA 1OIWA 1N5KA 2LWIA 2OESA 1TNDA 3LW7A 4BE7B 1E2LA 4KBGA 3RRYA 1MO5A 4KLZA 4WZAE 3OE7D 2O8BA 1HA3A 4JKYA 1G21E 2P2LA 1U94A 5FOWA 5KYKA 1ZD8A 121PA 4FMBB 1E2PA 3GJ3A 4PO1A 3RC8A 2ZUBA 3B2EA 4V0KA 3GEHA 1OT3A 3ETLA 3SFVA 1G3UA 2F1RA 3DZ8A 1GL9B 2C2HA 4ZI3A 4KFRA 3OE7A 3Q5EA 4H1UA 4B35A 3DMDA 1A82A 1E3MA 1IN7A 2RGCA 4DCNA 3KL4A 1CJKC 1S4QA 1MKYA 2B8WA 4TYQA 4E07A 3OHMA 3IO3A 1E1QD 2BEJA 4NCKA 3WYGA 4NYMR 1AS2A 3LQQA 1L8QA 3CNLA 3MGCA 1KJYA 4PPQA 3QKSA 2ZRKA 3U4QA 1SHKA 4MQBA 2X8AA 4B3FX 1JJVA 4DXAA 4QJ5A 2R6DA 2CNWD 2QENA 5L3SA 3EW9A 1DS6A 4BWYA 3FHTA 1GWNA 2WSMA 3A1VA 1XXHE 2RGBA 1TUEA 4BECA 3OIVA 1VTKA 4MKGA 4Q9IA 1KHTA 2IS2A 5FL3A 2PJRA 2YOFA 4HB4A 4DJTA 1KYIA 1XP8A 5DO9A 1DEKA 4BEBA 2RKOA 1ZNZA 2YINC 4ESHA 3S1AB 5EZ5A 2LKCA 5J4KA 1FQKA 4XTRA 1CU1A 2BM1A 1P3JA 5CITA 1E9SA 2FN4A 3P26A 4M1MA 3PEVA 2DFNA 5IF9A 1E9BA 1EK0A 1WCV1 2IXGA 2BBOA 5FTLA 2J59A 2QTVB 3IDQA 2YHSA 3KDSE 1KMHA 4LJ9A 6Q21A 3THXB 2O0HA 5E3HA 4HLQB 1Y63A 3KB1A 4LHWA 1HE8B 1VCIA 1XBTA 5AUNB 2CE7A 1F2TB 1XJCA 2RCNA 2ENZA 3EG5A 4TTPA 1JR3A 2BC9A 4BFYA 3OEHA 1YZLA 3AVWA 1UDWA 1AZSC 4M1TA 1COWA 2P65A 2MMGA 5CDFE 3NHBA 4PQFA 3IEUA 2XNDA 3S1AA 4ASUD 4C9BA 3QVUA 3ADCA 1YE8A 1SKQA 3TAUA 2Q3MA 5L3VA 2R2AA 1SVLA 3ZZ0A 3U3JA 2OBNA 4IKEA 2B92A 3WYFA 4CT4B 1TMKA 2OO7A 3K0FB 4O25A 1P62B 5IT5A 3NTUA 4LGMA 1NN0A 1DBSA 1OLOA 1CJMA 4PAOA 1G20E 4R98A 1KO8A 3Q5DA 1PTRA 2J5XA 3K9NA 3L8YA 4MDFA 3CW2A 3QF4B 4EJSB 4LCBA 1GNRA 1H8ED 1QF9A 4ZKEA 5EP2A 2CE2X 1PJRA 3SR0A 3NC0C 3AVUA 1CBUA 1RRGA 4GI7A 4CGZA 4GMDA 1AA9A 1SVIA 2XJ4A 1BH2A 2HLDA 3SC3A 4DC9A 2XITA 5B57C 3HJNA 5ANRB 1XB2A 4GP7A 5BYJA 3FMPB 1MV5A 4D2IA 3BB4A 4X8HA 1OIXA 1R7RA 3KXIA 2AR7A 5LPNA 1M7GA 2GETA 2ZU6A 4Y0VA 5BN3A 3TBKA 1PLJA 3U5ZB 4L9WA 3KKOA 4DEYA 2AD1A 3CWZA 1ZM3A 1W2GA 2EYUA 1NVWQ 3HPQA 5E7MA 5HR5A 4JLKA 4O2LA 3GEEA 3HPRA 4W9MC 3AUXA 4LJ5A 1BKDR 1U8AA 4OQXA 621PA 5J5CA 5JJLA 3GP8A 2GHIA 4MGZR 3T61A 2GKSA 3I3SR 1YZQA 2XZPA 4PAQA 3REGA 1SVKA 5CM8B 1PUIA 3EZ9A 4Q66C 4HATA 4TQUS 2RGNA 4JLDA 4B6EA 4CIDA 2DFTA 5TV2A 2F9MA 4M21A 4BZXA 4E03A 1Y8FA 2RGGA 1SGWA 2FGKA 1GTVA 1YRAA 4DLZA 3LD9A 2YUUA 2WSSA 2YWGA 2WTUA 1LNZA 2H92A 2REOA 5EE5B 2OFWA 1N5LA 2ZSDA 3DL0A 1NKTA 3OIUA 1SULA 1NSFA 3VKWA 1OH8A 2BEKA 3AV0B 1D9XA 3TMKA 4R2IA 2A5DA 4PO9A 2CK3D 1EX7A 1N6HA 4WAUA 1KIMA 1YKSA 3QBVA 4IRUB 4R2HA 4DSNA 2JJ8A 3EZFA 5KTYA 4QBFA 2Z0MA 5KO2A 1GILA 4I4LA 1BS1A 1JR6A 3WP0A 2IEZA 2O5VA 3MRSA 3M1IA 1TEXA 1NY6A 3E5HA 2GWHA 5HKKA 2QGZA 2Z4SA 5IK2D 3NH9A 4AKHA 3EIHA 2V55B 4ABYA 2KJQA 1CJVC 2N42A 5DSZA 4HAYA 5KUTA 4QBHA 3I92A 5FUYA 1K5GA 1N6IA 2A78A 2X2EA 1JJ7A 4LPSA 1G291 2RB4A 2AKAB 4RVCA 2QPOA 4TLAA 2R44A 2ZROA 2BIFA 1W4BA 4FCTA 4QRHA 1E79A 2KSQA 1B0UA 4YXWA 1RVDA 4B3DA 1E9EA 3DVLA 4GOJA 2Q9BA 1JQLB 2JAQA 4NHOA 2UZ3A 3SJAA 4CYMA 4X8LA 1U99A 1W48A 2Z43A 3L0SA 5FOVA 3VAAA 1WBBA 2C96A 5EQTA 3I62A 2J0UA 3L43A 4TWZA 5HE8A 5FBRB 1DE0A 3GJ0A 5E7IA 4U7DA 1COWD 1J7KA 2BJWA 1FUKA 5H70A 4KU4A 3B1VA 3KTAA 3P32A 3PIRA 3JZAA 2OT3B 5EXPA 3CR7A 1Z29A 2XOKA 4QHYA 1E9CA 3ICQB 3RS5A 1HQYE 4QG7A 2DFKB 5JHHB 4D25A 1KY2A 4ESVA 1ZP6A 1E94E 2Q3FA 4IDNA 1YR9A 4KCGA 2FSGA 2YNMA 3EA5A 1UDXA 2EWWA 5HTKA 3ZVLA 1UPTA 1E2DA 1R5OA 5JRZA 3VX4A 3K0SA 2ZRHA 1ZUIA 2IYSA 3AP1A 2VHCA 3DOEA 4QGAA 1W0JA 3CX6A 2QTHA 1P61B 2SHKA 4LRWA 3FHOA 1JI0A 3GFTA 3HDTA 4KJZA 2GF9A 3LFUA 1GP2A 3D7MA 3OEHD 4A92A 1KO1A 4LJAA 1KZGB 1TX4B 2IUTA 4QJ4A 4OHZA 4EPYA 1OXXK 1U90A 3ZVMA 4FMCF 1VCOA 1XNJA 3NG1A 3AKDA 4OQFA 3TR5A 4B2IA 4BFVA 4NYIQ 4ACAA 1C9KA 3EC1A 1XCPA 4PSAA 4RZ3A 5AWFC 1OXSC 3THYA 2P3SA 2QU8A 1YZTA 1BO6A 2GK6A 1BOFA 2X19A 4V0OA 5A4JA 2EFHB 1TTTA 2HYIC 1SKYB 2FU5C 2H5EA 5A0FA 3D3QA 3SHWA 3X1DA 3RNLA 3Q85A 1L2TA 1F5NA 4DLWA 4BLSA 2JATA 2JLQA 3CONA 2F55A 2V9PA 2QT1A 2RAPA 4Z1MA 4WOPA 2VF8A 2WMNB 3ZQJA 1FMLA 1AK2A 2OEPA 2HDNB 3NBYC 4YQFA 2ZREA 2VP5A 2WWHA 2AHOA 1S8FA 1YZKA 1ZVQA 2CL6X 4XVUA 2FEMA 4DB4A 2D7CA 4NH0A 1DG1G 4PQYA 3FHCB 2WOJA 3SBDA 2NOAA 1CF4A 2VP2A 4NE2A 5C4GB 1ZCAA 4KYUA 4C0AC 4CEIB 1E1QA 1KO7A 5EXSA 2AD5A 1A4RA 2RGEA 2ZR9A 5DLQC 3UPUA 1P73A 1KK0A 3QKRA 5FUVA 4GSYA 4EPVA 4D4KA 2OV2A 2PX0A 4BQSA 5G3ZA 2QE7A 4PXAA 3U4QB 2VEDA 2HYDA 4BLPA 3L0IB 3NVAA 3TR0A 1E4YA 4EAQA 3OEEA 3MWYW 1H65A 1HQCA 2WSSD 4LBWA 3BJIC 1RFHA 2FA9A 3PUZA 3QPWA 2DWQA 4C0LA 1J90A 2QL6A 1GIAA 4A9AA 3BWDD 3WP1B 4EJSC 1CXZA 1IN5A 1OXTA 4LYJA 3SI7A 4V03A 3TVTA 1VHTA 2ZRBA 2R6GA 3IBGA 3ZDQA 1FAQA 5C1BA 1Q3TA 1GL6A 4OKSA 2J0VA 4YDSA 4Z1MD 1XTSA 3L82B 1DARA 3LW8A 3CZQA 4K81B 2C99A 2JCSA 2OM2A 2G1JA 2F3TA 2W0SA 4JVNA 2GAAA 1CJUC 1NN3A 3IHWA 3QXCA 1GRQA 4PO8A 1II8B 4Q47A 3UIEA 1KI6B 3GLGB 2P67A 4GPTA 3GLIE 2HCJB 4R9UC 2WICA 2ZPTX 4LUCA 4Q7LA 3VR6A 1X1RA 5KSOA 4C2TA 2ZRPA 4LI0A 3GLFA 1KKMA 2R6AA 1XJ0A 1FL9A 3AF0A 2ATXA 2IF0A 3A1SA 4II7A 2F9LA 3QG5A 1XX6A 3ZYCA 2QBYB 1US8A 1OPXA 2UKDA 5BN5A 1P9RA 1M34E 3RAPR 1T8TA 4Q4HB 1QHHA 3W34A 4B47A 4RD3A 5B58C 4GL2A 1ELOA 1MO4A 3RC3A 1BIFA 1H8EA 2QMOA 2ZYUX 3PG5A 3BH7A 1YZGA 3B7GA 2PCJA 1D9ZA 4G5RA 4I1VA 4BASA 4MYUA 1E0KA 4LJYA 5JI2E 2KE5A 3W5JA 1Z47A 2HT6A 1OE0A 3EIEA 4G5SA 2NMVA 1IY0A 2V6JA 2LCFA 3N70A 2GCOA 5CLLA 4ZCIA 1ETUA 1ZINA 5FH9A 1EFUA 1R10A 3C16C 2WKPA 1PZNA 3NEJA 1GRRA 3G82C 1FQJA 1G3QA 1HT1E 1Z6TA 2C04A
chains in the Genus database with same CATH superfamily
2EJTA 4FUTA 1R50A 4GPD1 5DFAA 2VTBA 3NJRA 3ZQ4A 5E4FA 5DLDA 4N7RA 4UMVA 3D7NA 1EBUA 3AEUB 4CFYA 2JHPA 4KLNA 4WZBE 5JPCA 3KQWA 5LYJB 2CNDA 3MUNA 3RDPA 2JYYA 1VMEA 4A8JC 3SVTA 4IV0A 1XUOA 3EQZA 4DWWA 4EG7A 1NPDA 1TUBB 1HRKA 3E9CA 3I45A 5IYZB 1I0ZA 1V16A 4KXXA 3IC5A 2YFQA 3B60A 1MOPA 2AFRA 3CF0A 1XXHA 1YWGO 3DR5A 3HWSA 3IGFA 2A94A 3BWVA 2DWUA 4FFPA 3IE2A 3E03A 4MUIA 5ARDA 4D96A 2HH9A 4JI3B 3T3DA 3LTEA 5DGDA 2G8NA 3FNGA 2VJYA 4ZEVA 4CEIA 2W6JD 4KBYA 2HZ7A 1TK3A 4C6TB 2H4YA 2BDUA 2JCVA 5CLIA 5AK0A 2WU8A 3I9OA 3ORFA 3NHPA 3OE4A 3PNSA 4OMCA 5BW6B 4CKWB 4EUKA 1N34B 2YFHA 4X1OA 2PQ8A 4I1OA 3PI6A 5L3QA 4G26A 3TQFA 4OGFA 4Y6LA 4BTLA 2I55A 1V7ZA 2QRQA 3IUEA 3GVHA 3NIGB 4JLNA 4PC3A 2FNAA 3W2HA 1KZYC 3UT5B 4MQ6A 1KRWA 1GZUA 3R5SA 1DG3A 3IMKA 4RHCA 2HD4A 3FCUB 4XGRA 4DLXA 4DMKA 1IVNA 4NECA 2D54A 2GZSA 1S9DA 4TYMA 1C0KA 1O1YA 3ZEAA 2ZRJA 1GUFA 3HI6A 3W6NA 3UA3A 5CLHA 1S89A 3VV3A 2B4KA 1YKGA 2I29A 1G0OA 1WDMA 3PFWO 5C5DA 3DDWA 5D01A 2VQ6A 3Q2IA 3C85A 1O96A 2QD4A 2Q4TA 4OX9B 3ONFA 2AC7A 3DKPA 5DW0A 2OC4A 4BNZA 1P0QA 4TN5A 2WHRA 4ZGBA 1QDUA 3LKZA 1XHEA 4ZYLA 3VZBA 1XRQA 3C5EA 5B1YA 4JL8A 1I4LD 3W90A 1ZSVA 1KI8A 4NFHA 1E6KA 1NXSA 1J1IA 2QZSA 5EZYA 1ECGA 4CUZA 4DJFC 5HTOA 1LXCA 2E4UA 1RHRA 2IYLD 4ZJPA 2Z1DA 4W9RA 1OGIA 1L4HA 3AYZB 2NVUA 4KIFA 3ZS9A 3D8SA 4EHJA 5TMBA 3PICA 1KAHA 1ZNWA 2PYDA 1L4UA 4OGKA 1EXMA 1HMYA 1S0UA 1MTZA 1AKYA 4LCEA 4LF8B 1S7CA 4JQOA 1VYHA 4MIKA 1WZCA 3O8NA 3Q12A 1QKJA 4DILA 2NTVA 3PQCA 2ZUEA 1ISGA 1BRTA 2AYXA 2ZATA 3PKJA 1JIVA 4LJSA 1XJQA 1PSDA 3FPCA 4AJJA 1GAJA 4DYHA 4LVOA 3ZVKA 3KAJA 3RQSA 3Q72A 4PYLA 2QYOA 3RIMA 3BQ9A 4TRJA 1MQ8B 4JP8A 1KS2A 3V4PB 3N7UA 4C4OA 4TL9A 2CHQA 4O59O 4OB7A 1KJQA 4ZVVA 2J0UB 2A9FA 1OV6A 3L4BC 3S5UA 4MK4A 4DKXA 4EG4A 4BMCA 3HH2C 1UJNA 3BRWD 5JJ5A 1OWPA 4KJXA 3NYQA 5EMLA 4Q6BA 3IAAA 3A2LA 2OBLA 5TMDA 1YR8A 4IGIA 3QV1A 3UH0A 1EJBA 3ZW9A 4MWDA 4D8WA 4HGZA 5CYOA 4CG0A 4D4MA 2ZRDA 3DEIA 1EP2B 2NV0A 3G9TA 4RJIA 1KJIA 2BTEA 3PSAA 1R4NA 4PQRA 4TZKA 5B1IA 3HCAA 3AINA 1OJLA 2ZJBA 3R9IA 4RA9A 1B73A 5HQ8A 2C31A 2QX9A 1NW4A 2ST1A 1G9XA 1WF6A 4FGZA 1BYUA 3DXFA 2HQBA 4JI5B 1WXIA 1SK9A 3ZZMA 3KKLA 3D1LA 1YZHA 2BONA 2PH7A 3G1TA 2DUUA 3LO8A 3NP7A 4GFDA 3GNSA 1IHXA 1MQ9A 1PBNA 1KMHB 2B98A 1UANA 1PFQA 3I8XA 2P1RA 2GEUA 4FUQA 4KXWA 4P3OA 5D3KA 1TB4A 4L9SA 4M0LA 1MW8X 1Y8RB 2P6UA 1ESCA 2Q5LA 3BKWA 1E3WB 5MGBA 4LY0A 1GUBA 2QN1A 3OFND 3ZI0A 3ZLTA 2FR0A 4JITA 4B74A 2WRZA 1TD1A 4JU8A 4BXOA 4C01A 4ZZ1A 3IMCA 1XLTC 2ZI4A 1ZEMA 4BAGA 4UPEA 5KC9A 1H05A 2J09A 5L3QB 1SPBS 3OIWA 5DWDA 4IOKA 3H2YA 4AKGA 3MTAA 4AS1A 3IKMB 4JP2A 1P4SA 1GTL1 3Q3EA 4X20B 3RG8A 2PUFA 3RFUA 3RKUA 2C2WA 3MJCA 4TQAA 1KGDA 4EW6A 1TE2A 5SYNA 1QHNA 1BXGA 1OTYA 1ZVJA 1PYDA 3GJ6A 5J2UB 2IYZA 3QYFA 1TU0A 3I1FA 3OZBA 2QD5A 3QJ5A 1I13A 5DM70 3AUUA 4GICA 3QLVC 3VNUA 3RCBA 5C5IA 3W5AA 2BKEA 3BH0A 4PLCA 4NESA 5I8ZA 3B2QA 4LC0A 4YC7A 5ELLA 5P8WA 4C78A 1KY3A 2GEJA 2D0IA 2GZMA 2EWVA 2VAMA 4JLJA 3GHYA 3NOVA 4EJSA 3DDSA 1WXWA 4ZARA 2OL4A 3M81A 3ABRB 3QOFA 3TQQA 4HI0E 1ZN7A 1SCNE 3I04A 1SGDI 2FPOA 4LTMA 1HDYA 3V7NA 1K5DA 1TKBA 1HK7A 3KG2A 4RE5A 3LO5A 1Y4AE 4PZPA 2IFTA 1AD2A 3UTCA 3LBAA 5HGJA 2Q9UA 4WBNF 1L4MA 4XGQA 9LDBA 1AN9A 1BFUA 1IY9A 4TL8A 1PR9A 2WU3A 1P0CA 3C8UA 4ZOLB 2ADMA 2P7HA 3IAS6 1TF7A 5T3UA 5DI3A 5KYWB 4JB8A 2Q2WA 4HDSB 1VI5A 3GC6A 3NCTA 3KVNA 5FBHA 3MM4A 5TS3A 2FZWA 2NO9A 4ID9A 1QZXA 2XQIA 4R7ZA 5HG0A 1JLKA 1Z74A 3E84A 4Q4AA 3IQGX 1TMOA 1RAGA 1AQLA 4FLEA 4GX5A 2WVHA 4KB5A 4CBVA 5C53B 1W49A 2OR3A 3HWWA 3IMFA 2VBGA 4POOA 3PNLA 1G63A 1G19A 2RAVA 5B2ZA 5C8DA 4ND6A 3CUTA 4K3UA 1EB9A 3ZGLA 1WP9A 3THXA 1C30B 1N9GB 2CEAA 2G80A 1E3JA 3RAGA 5GGXA 3LDGA 1WY7A 1E5DA 4RIHA 1YULA 3PWZA 5EXEA 2GSWA 5DOZA 2CJWA 1G4HA 1WHSA 1KY5A 1W4AA 1DV2A 4I9FA 1IHUA 4Z8YA 5KOYA 5JZOA 3CVXA 1L3CA 1D6NA 3ASUA 2BE7A 1GZ7A 1P7CA 4OUDA 2C8VA 1MRNA 4CF7A 3FYUB 2F64A 3HA5A 2NO4A 4FOSA 3VPXA 1V1HA 4NCNA 1XVAA 2R8YA 2R1VB 2HSDA 4PYMA 3KUUA 3TO5A 1R16A 5AJXA 1V6SA 3H9CA 3PQ4A 1GPBA 1L5WA 4AN4A 5IMBA 2GN6A 3VJLA 3M1AA 3ZS8A 4HBZA 2HF8A 2R1UA 1A7KA 3EXEA 3NONA 4R54A 3DWIA 5AQ1A 3TW4A 1PU2A 1C9MA 2MSDB 5KPDA 3JQ8A 3UGLA 4BVBA 3N6VA 1EFVB 1SUIA 3QX8A 2JKYA 3NT4A 4OQ4A 3BJZA 3WB0A 1X1EA 1TW3A 3U0BA 3P2MA 4LNHA 1HEIA 1UC8A 4BNMA 3K70B 2QM8A 3PK0A 2QUBA 1QIKA 2ZIEA 4IIFA 4M86A 4OOEA 4CKXA 2OK7A 2IZ0A 5CG1A 1IXZA 4YRIA 1QAMA 4W7SA 1ZGHA 4BGUA 3SF0A 5EZYF 2VYCA 1PDWA 4WOBA 4QD3A 1G20A 2V65A 2NTEA 1Q0HA 1S3FA 2R97A 2DH6A 3SLRA 3HBFA 3ZZUA 4CEHB 2BV3A 1M2OA 1A5AB 3C8HA 3L0PA 2IODA 4KFTA 1WNTA 4GYKA 4NBUA 3IEXA 1HMPA 3A3YA 4NEHB 1DAGA 3WK9A 4MKXA 2JLYA 4QLAA 4XR4A 5IC6A 4P38A 4A6XA 2LUOA 5CA0B 3VKGA 4F4HA 3NJ8A 4TS1A 3FRHA 1HT3A 4B3CA 3COJA 4EW1A 2FPIB 2AG6A 3LF1A 2H2AA 4PZLA 2V58A 4EFNA 4UUOA 5CEFA 2HXGA 5HHTA 5HRUA 4GXTA 2WG2A 1TOAA 3K3PA 3ORQA 2FPXA 4C0HA 4YCDA 1O6ZA 4R9SA 1R0YA 3Q6NA 2OCBA 5I4BA 2JAUA 1SXIA 3CEMA 3SX2A 1FTWA 3EGXA 3SX4A 4C7BA 1JMVA 4D9BA 4XFJA 4KXFB 1QFSA 2XY4A 3HUFA 4JJAA 5DTRA 1D8TA 3FLEA 3P45A 2ZBFA 4C5CA 2DQZA 2VDMB 1BQ4A 4M22A 1KO5A 3EE6A 3PE6A 1AK1A 1VYVA 4LZZA 4FZVA 4L0QA 2EW2A 3B1WA 1MVLA 2PIDA 4WZBB 4IIXA 4QDZA 2R6R1 1RXWA 2XVZA 3AR2A 3PRJA 4ZVTA 1WZEA 5C37A 2PUBA 4HGRA 2O5EA 2BVNA 3RH0A 1HUQA 4MVYA 3CR8A 2IHUA 4PRZA 1Q7RA 4EB3A 4XTCS 1PV2A 1PJAA 1KH1A 4QT0A 1OBHA 3KYCA 3UG7A 2AWOA 2P4HX 4B4VA 4CE6A 1HOXA 1KPHA 5TS2A 4NK5A 1N8SA 4YCMA 3DMRA 3OQMA 1HFKA 1EUQA 1G60A 3EQ6A 2C4TA 1RP7A 2JB9A 1PP4A 3AT1A 3LDUA 3F7OA 4WX2B 3WRXC 1QG4A 1N1MA 3I5AA 2MT9A 2PMKA 2DFLA 1JDVA 2HNAA 3PNMA 3D02A 4JEMA 3L8GA 3I4CA 4XM0A 5DXAA 4AC9A 1KQFA 4B34A 2CHUA 4MV6A 1Y8ZA 2FWIA 3IIMA 5IAOA 1XNGA 2WF9A 3FRJA 5G41A 4BKPA 3IPLA 4IRXA 2GCGA 2GO1A 1QP4A 2GR9A 1F2UB 3KD2A 5JU6A 1RTKA 4RU1A 2WWWA 1A2QA 4IJKA 3D00A 3HKBA 1RVV1 1JTEA 2WKWA 3OZFA 4TV9F 4B4UA 3VNAA 4RA6B 1XHFA 1E2QA 2FX3A 1M2WA 2HWUA 2IPLA 2C61A 2JJYA 1IM2A 1KJJA 2PS3A 1JZQA 2Y0CA 2YOHA 4FILA 2G5GX 2ODNA 4I3GA 1YR2A 3RSOA 2JH8A 4DLRA 2HF2A 4GKAA 4MKIA 2RH8A 1NNI1 1SK8A 5DMXA 5F2NA 5FEUA 1Z75A 1TZKA 4URYR 2B69A 4F92B 4NH4A 2MYPA 2Q50A 3LVBA 2D2FA 2WUWE 1RIIA 2QLTA 2YYZA 3FTNA 3DMPA 1TUGA 2DFVA 2VT3A 4DKJA 3PNPA 3RUPA 3TZ6A 2D2XA 4XEUA 3YASA 4KO8A 2QDXA 3OJLA 5T41A 1ODKA 2P75A 2ZRQA 3OCCA 1SY7A 5EIWA 5IX8A 4EPXA 1H5UA 2C9DA 1R88A 4X94A 4DNOA 2QSUA 2VP9A 3R3JA 2BSAA 2GJSA 1NLZA 4XLTA 4HCJA 4KRFA 1VPVA 3A9SA 4MKHA 4ZO8A 1KJWA 3B7WA 5G4KA 1TBNA 4HWOA 4BMYA 5KAMA 4E5UA 2KLHA 2KPOA 2NPOA 1ZM9A 1RYBA 2EJUA 2IEYA 3ED1A 4JB2A 3W9BA 2YBDA 1XTRA 4HPJB 1CT9A 2NV2B 4RAOA 4CKCA 1CQIA 1R0BA 1KVSA 3FCXA 4IJ6A 8GPBA 3VA7A 4XX0A 1W36C 2UVPB 3C5VA 4ICIA 1K75A 4K03A 1HSZA 1P9WA 1EVKA 2LE0A 3LT4A 1D4ZA 4FHGA 5JNVA 3SKYA 5BVGA 3DD5A 1I0IA 1JDBC 1L9KA 4QX6A 1UAAA 4AY2A 1L7PA 3LKDA 4RAQA 3R24A 5K6AA 5BXQC 3JAKB 2PZLA 4NEQA 2DE0X 4PICA 2VUHB 3D3JA 1DUIA 1GVNB 1MF7A 3DEFA 2QAGA 4QTTB 1M10A 4EYGA 5COAA 5AKIA 4V38A 1GU0A 2VL7A 2Z5FA 1QAQA 3C3AA 4L8YA 4QEZA 4HV4A 1IPFA 4QDJA 3O8CA 5CW1A 4G4IA 1R1DA 1H2ZA 1PFGA 1WZIA 3QITA 4Q3BA 5KCMA 2FY8A 4HHEA 4CU2A 2HY7A 1JECA 4BNHA 1N0UA 2O9JA 3CRQA 4ROTA 4Y9UA 3I9V1 3OBBA 4EVSA 3NVKI 2FWRA 4FKMA 3U7FB 4O4HA 4N6GA 3V3TA 1IVSA 5K3DA 3SY8A 3AVOA 3GQBB 3TZKA 4XGNA 3WV5A 2IIPA 4PNZA 2I2CA 4I55A 2R47A 4MP6A 3ZCPA 4RK5A 3I2YX 2I66A 1E8MA 1JEJA 3BD7A 1P7ZA 1L4GA 3HUTA 1UKVY 3I8OA 2I78A 2NUAA 3D6NB 3MWKA 4G8CA 1ZJJA 1ACJA 2DOKA 3ELWA 4JUCA 3WLEA 4LQ4A 5K8IA 1T8SA 4ZOLF 4S2UA 3OXFA 1G8AA 2IK8A 5I9LA 1TI7A 4WA8A 4QLOA 1NDHA 4BBJA 2ZZMA 3F6RA 2JI7A 1R15A 3JYPA 3H9JA 3ITKA 3UYLA 1II8A 2ZPUA 3NKVA 4XIFA 2FDCA 3AL0C 1W4RA 3O0DA 2QXUA 1PGPA 4MIOA 3HDGA 3WRYC 4E09A 2A9JA 1JYSA 4Y1RA 2CVFA 2AFIE 3PYLA 5ALIA 5BY2A 5ADHA 1A0OA 2GI4A 3HCEA 3U7JA 3FTPA 2YCBA 2O59A 1HEUA 3H84A 5F64A 1JXOA 1Z7KB 1Y3HA 1FMCA 4HQ0A 4I1SA 4DDUA 1GRNA 5IZ4A 1DIAA 5AVYA 1T13A 5ALLA 2V1UA 1MJFA 2JJMA 3VFDA 4JUAA 1U1GA 1TF2A 1IN1A 2NT4A 2X6QA 5GJWC 2QVYX 3NTLA 3BMXA 1L1EA 3A9TA 4DLLA 2LPMA 5DM0A 2Q6LA 2D5LA 4P92A 5D6NA 5KB3A 1HLGA 4F21A 4K9RA 2BGRA 4CW7A 1G8HA 5C2JB 4KWCA 5ALVA 1EBBA 5E9QA 2NU9A 4XPZA 3DF9A 1M54A 3PITA 1I36A 1FNDA 4CM6A 4PCUA 5IJ0B 2AJCA 2IGTA 3OCVA 3IAHA 4K26A 1NW6A 5IUKC 4Y6PA 1J2EA 1LLFA 2QA5A 3GARA 4MWGA 4YREA 1TT5B 4OYYA 3V2IA 4M83A 5CX1A 3GJ8A 1UODA 3CH7A 2HJGA 1BEZA 4RMHA 3N58A 4O2AA 1ODFA 3E9YA 1QIDA 1L5HB 3DDNA 4DY6A 1K66A 1N2JA 1TCVA 1CP2A 2O8NA 4ABTA 2RG1A 2C1XA 4JBYA 2X4LA 4EUHA 3ED5A 2XNCA 4YJKA 1QV9A 1XD2B 4YBZA 2RB5A 1WGCA 2DQ4A 4YPOA 3EARA 1OC2A 1T36B 2XF2A 4CHGA 2Y05A 1ULHA 3GUZA 4UAUA 1FP7A 5MN6A 1NMQA 1P4GA 3QKSB 3PGMA 5K01A 1GYRA 4MW6A 3ZXSA 3KKPA 4AUNA 2XQFA 1HEYA 4W4TA 4D26A 1XN4A 1FPMA 2GPSA 1RXVA 2CK3A 3BFPA 3C14C 5A3SA 3Q2OA 4OIFA 1EXVA 4LGCA 1NXWA 1BU5A 1W8DA 2IUYA 3AOEC 2JAPA 3ZHUA 1DKPA 1OI7A 2YWRA 3F6PA 3OCZA 1JPJA 4IDPA 5FTKA 1FNMA 1IJEA 3W8NA 1MABA 4BV8A 3A3OA 2FRDA 2M6KA 2NO1A 3DLCA 1PRYA 2BCGY 1QHGA 4UMFA 3THYB 1NMSA 3H5WA 2HHHB 2VJDA 3K9LA 1W34A 5HS6A 1L7AA 2HWXA 2H1IA 2MWMA 1NUBA 1RM3A 1TK2A 4GR5A 5EJMA 3SJUA 3LOUA 3ZU6A 4IKPA 3BX1A 2IT1A 3H0EA 1HE4A 2VP0A 1A9TA 1FTYA 4H1VA 1NI4A 4X3OA 4XASA 4YCNA 4E08A 5KNBD 2JFXA 4HQ6A 2I4OA 3KSBC 1VYTA 1C7IA 3KPYA 1N0VC 4X7MA 5BORA 1E4OA 2O8EB 2YYSA 1FP2A 4KFSA 1SGNI 1RBMA 1U2RA 2E2WA 2R87A 2QLNA 1FVXA 1MV8A 1Q0LA 2CHVA 3KKKA 3TZQA 1HYEA 3KYDB 1CT2I 1JJBA 2O1EA 4RPLA 3T4EA 3E35A 4BS9A 3H1FA 1PNVA 5DTIA 1XOIA 1MC1A 1KEVA 5LBTA 1EH5A 3N2NA 3TIVA 5HFJA 2JDIA 4F6RA 3E05A 3E8MA 3BM5A 1J0XO 3NUGA 5DYWA 1AKNA 1CIPA 3LP8A 3L7MA 3ESDA 1KBEA 1TL7C 3CBQA 3LT0A 3OG9A 2J07A 2QV0A 1MJGA 4XJSA 1DLJA 3AJ8A 3PVZA 4CTOA 5IJWA 1PX0A 1YBMA 2QSZA 4X5OA 2WTEA 3WIEA 3ZWDA 5HQJA 3GVPA 2C0CA 3JQAD 4UNNA 5TQVA 2X42A 4LJLA 2C0PA 1LR9A 5CIWA 1R4AA 4IFEA 4RW0A 3B9RA 1RI3A 2VAVA 3P5BA 2E37A 1FFXB 2XJ9A 4ZQCB 5I7OA 4RJJA 4LNAA 4OXRA 5TEVA 3OJEA 2B2XA 4XYBA 3L49A 2GKOA 1T1JA 3OEED 1JVSA 1OXMA 2AOUB 2WOOA 1UFKA 3OZRA 1I2AA 1C3LA 3EXG2 3GFOA 3RVOA 1I6MA 3SYLA 2ODAA 4H6XA 5JAPA 4B75A 2FETA 4O1IA 2R6JA 2F7SA 3AONB 1E89A 1PJ3A 4GXNA 4P7BA 4Z0PA 3HDQA 2RK3A 2P78A 4ZK6A 3PTZA 4WCFB 2I99A 2KBFA 5JXJA 1WTCA 4OCZA 3C6BA 3H16A 2LGJA 4EUEA 5CT8A 1P4AA 2AMFA 1SVSA 5AOBA 1QK4A 3KE9A 2C2XA 1WF3A 4UM7A 3UOGA 1A97A 2I80A 2CBXA 3HU5A 3QQ5A 1OBVA 1NRIA 4L51A 3M5PA 2AKYA 2Q8QA 3AR7A 4X93A 1P2DA 1ZIPA 4NWIA 2UUPA 3ECAA 2VXYA 4OHBA 2VQEB 1YR6A 2XMCA 4KPEC 4DBLC 1A5BB 1L7NA 2F1HA 3ETCA 4AUKA 1PTQA 4HRAA 1NP6A 2V5AA 3ZX5A 4BX2A 1UZUA 3EXG1 3M5DA 1U1IA 2REQB 3PWSA 5EKTA 2CSXA 2WIDA 4K2HA 4BNNA 5DTMA 2XPCA 2I4RA 3LY8A 3P4YA 4IFBA 4NFSA 4QUKA 5HDQA 3UHAA 1LPAB 1HG0A 1JV2B 5FBKA 4ENUA 4YJ3A 1DELA 3QPBA 5CHEA 4R3NA 3K5WA 2P62A 2XUDA 3LC7O 3FMIA 1NBMD 3ENKA 3VUFA 4C20A 3ENVA 4RX1A 4L4YA 1F0KA 3C5HA 2EJVA 1FFBA 1XIVA 2HUPA 2SGEI 4DNPA 2IEGA 4PN7A 2ZS8A 5FL7D 2Q49A 4S1VA 4E6PA 5E7JA 4BEWA 3K16A 1JDJA 1Q6YA 2YKGA 4LSMA 2QNBA 2ZE8A 2NAFA 5AOCA 3ZJ5A 1YS4A 3FSGD 1JQBA 4UBJA 4XIJA 4MGYR 1CQZA 1QNFA 1ZWLA 3E9RA 1MJBA 2GFIA 3GNLA 2MYNA 3UKJA 3ZWKA 4JB0A 1QWSA 4GEGA 3NEPX 2PUJA 3D8NA 1RXIA 1DO0A 2DPGA 1XVLA 2WFZA 4FDAA 2EFYA 1GTJ1 4Y2XA 4HNRA 1RPZA 4MVXA 2JBAA 3IILA 4OJKA 3IALA 4RO0A 2PX6A 4N0DA 3VYRB 3FXAA 4C0JA 1V8PA 2O7QA 4YRBA 1YBFA 3KUXA 5L6LB 4IWXA 1NBWB 4B3GA 5E8RA 2O8BB 2HO4A 3CB4A 3IQXA 3EFHA 3I9FA 4C08A 5FLEX 1BJTA 2ZQZA 3H4MA 4LGVA 3JARB 4TT3D 1YE5A 4NNPA 4SGBI 4LHSA 4FVTA 4N12A 3QW4B 1BWSA 4PG8A 1THMA 3FPLA 3E1GA 5KTOA 4M6WB 1HLPA 3L8CA 2RI6A 5B7GA 1BUSA 2D6FA 2FF5A 2IP4A 4EQ6B 1UVGA 1UOOA 2CNWA 3KXLA 1D4OA 1EX1A 4E12A 4PGFA 1EK5A 1GRCA 1U4SA 3O3MB 2GEKA 1E9RA 4Q03A 3ICPA 1D07A 4UCFA 3TIGA 2A1UB 3WGLA 3FTFA 2I7CA 4R4JA 2ECKA 2VXOA 1YQDA 4GQBA 3S99A 4YRFA 1D0IA 2NSDA 2EGGA 3UEYA 4NV0A 1GFWA 1S5PA 5GZ3A 2D7DA 4AUEA 3UJCA 5IKPA 4RTPA 4TKUA 4WDQA 3REOA 4DCUA 3ZHRA 1NF2A 4HLNA 1FXSA 1F3LA 1HE5A 2I1VB 2YWDA 4LQLA 1G4UR 3CUSA 2UUCB 2ASVA 1QE0A 3VI4B 3V4LA 3EGCA 5IVIA 1MA0A 2WTAA 2YX1A 3PDWA 3QXXA 7MHTA 3AC0A 3KHKA 2AF4C 3JQGA 4E1RA 2YXNA 3L9XA 1JU9A 1VPEA 1JKMA 3A1TA 3FPJA 3A4IA 4GGMX 2FV8A 2W6ZA 4MWCA 1E3IA 4WZAB 2GJAA 3CNHA 4Y2TA 4YP6A 2HV8A 4FONA 1QLHA 3GDGA 1PW5A 2ZBQA 3VZSA 4AAYA 2VPPA 1NVAA 2HCRA 4TWRA 5TEWA 1AF7A 2JK0A 1M1NB 2QT0A 3B3FA 4C0BA 3AW9A 2ZWIA 3CO5A 3ZDBA 2ZB7A 3N6XA 4LMRA 3OUTA 1AE1A 4QVGA 2DLNA 4GC9A 5L4NA 3MB5A 2G04A 1RPNA 1LRKA 1QC5A 5JD4A 2W83A 2W2MA 4F9EA 5I9IA 2GHTA 3PT9A 2O6HA 3BHIA 2CUNA 4BMSA 4E46A 4EA9A 1DHRA 1FUIA 4RC9A 4DV3B 1IN8A 4IXTA 2W4MA 3CH4B 5D3QA 5ALUA 4J1TC 5ERYA 1I3CA 1TIHA 2FF7A 1J42A 2C9YA 2RHOA 1VC2A 4NOKA 4BCCA 5LVAA 3U6BA 4EUFA 4N0EA 3H7AA 3USCS 1NUQA 1BDJA 2PPVA 2GUGA 1FZQA 3QWBA 2NVOA 4ZA2A 3ZY2A 1U0JA 1X8LA 1A4IA 1XK7A 2F6RA 4PSCA 1P2TA 3NIBA 3OPQA 4GBJA 4G0ZA 1IUNA 1QF7A 2VF7A 2Y0DA 1U7PA 2HZBA 4H2DA 4HG2A 1KH2A 2IV7A 4NONA 2RHBA 1IN6A 1K2VN 1DBVO 1JKXA 1HETA 4I3FA 4ZYWA 2BF7A 3SSNA 3N74A 1G9TA 2F62A 2ZZKA 3M9XA 4LISA 1CDEA 1P29A 4EEXA 5J9FA 2WD9A 3WGKA 3E70C 3DAPA 2K4MA 2P69A 3MWGA 4GXRA 3SGQI 1QR6A 1QB8A 1A8SA 1XU7A 1IOVA 1W44A 3WDSA 5HPYB 5BRNA 1L8OA 3OFJA 4ARUA 1JHVA 4QJBA 4F5DA 2IDZA 1RCTE 4HSEA 1SQGA 3GU3A 4KNYA 2B7BA 4JC5A 2HCBA 4TWIA 4G0WA 4JYAB 3OLQA 3VR2D 2XKKA 5GJBA 2H7VA 3QKWA 2VJLA 1DS3I 1W8IA 2CWWA 2QM3A 5HDBB 3SC6A 3WJ2A 3WSVA 3ZVRA 1YSCA 6REQA 3BMQB 1YFKA 3NMUF 4RH0A 1CT0I 3O3CA 4BLOA 1I1QB 1YKFA 1XT6A 2VJAA 2A5LA 2BL4A 2I5PO 2XDAA 4BKRA 1WS6A 4DR4B 3I6YA 3K09A 3LSYA 4DIFA 1RM5A 4HWPA 4A2CA 2X2FA 3PP8A 3SDZA 3KLOA 1J2TA 2R25B 3TE7A 3OHSX 2V0CA 4YPVA 2Q2VA 1ZD3A 3OICA 4IO1A 2Q4BA 3ZDYB 1F06A 2FW0A 4ZICA 4N1AA 1YACA 4TYNA 3X1YA 1N1EA 3B53X 3UC9A 5CDYA 3LWDA 2J6IA 3Q15C 4UBLA 1YFZA 2DTDA 3CN7A 3B85A 3H05A 2IHKA 2PGDA 3LXRA 4R0NA 1MT1A 5REQA 4DPKA 3S2UA 3LX5A 2AZ4A 1MJAA 2QUHA 5AJVB 1H1DA 1KU6A 2QVGA 2ZSJA 2DG2A 4JGBA 4MRMA 4BLQA 4P36A 1GCAA 5TQ2B 1JDSA 5CURA 3OT5A 2EBWA 3OO1A 4O4IB 4NAVA 1RWQA 1U5AA 1X39A 3BXOA 4IEFB 1M2KA 4WHMA 5FEMA 2ZJFA 1JFFB 1Y48E 4ARIA 1A76A 2H6EA 3GO4A 1LUAA 1Z83A 2HU5A 4UQLA 2FQYA 2FVYA 1ULZA 2H5JA 4HXGA 5AM5A 5KVQA 3ZCXA 4WJLA 5LOVB 5A03A 4B7XA 1N92A 2WABA 3U3KA 2H5IA 4RJ2A 1SRQA 2JFGA 4X6LA 1LDBA 4ZQIA 1GNQA 4OBBA 3UGJA 4OHPA 3PKZA 2DBVO 3U7QB 3H97A 5KKNB 1VSTA 2ZOSA 2ZSFA 3P0IA 1JVNA 2WF6A 5KWSA 2CL0X 1GYQA 1YRHA 5DYTA 1AURA 5CXXA 5AVWA 3FZQA 2BT4A 5SZJA 4L72A 3KWJA 1W46A 1SVOA 3G02A 4L22A 5FBQB 4CM5A 4DMGA 3NOOA 1DJQA 2PEYA 3MWFA 4FBLA 4JENA 1NW3A 4NQZA 1WLSA 3QG1A 5BSHA 5CBPA 4YHBA 2ID8A 1Z13A 1JDUA 2CLEB 2X8LA 3DBHB 1T6BY 2VHTA 3QFTA 5AICA 3RVNA 3ZIUA 5IS2A 4MRSA 1RMYA 3H65A 1OPRA 3OAAD 5LB2A 2W4QA 3V00A 5E95A 4RS3A 5F33A 3C1AA 4U2KA 3P2YA 1RC8A 4DIUA 1PTJC 1U8XX 1X3LA 2C4UA 2O3TA 1DAHA 1AIPA 3E7FA 3GOQA 1F8FA 4YBRA 3BFJA 2G5PA 3E9MA 3PC6A 3KT0A 3UANA 3AP2A 1NM5C 1F3OA 4NCIA 3N8KA 221PA 1PT5A 4QIHA 3BFKA 1UM8A 3GLSA 2WWFA 3NXKA 1Q83A 2B1RA 1A1VA 3RABA 4FLFA 2VT2A 4R5HA 3JRXA 4BKUA 1V2HE 1L4EA 3ROFA 4FGUA 2JLCA 1WKVA 2HBYA 4CLOA 1QIJA 2V1CA 1UPBA 3LUKA 2OFPA 4GGOA 4BNKA 2FH5B 2WWRA 2W5UA 3EA0A 4C03A 5LP6A 5EL0A 5NULA 3M6UA 1WHSB 3OVMA 3TNJA 3HXQA 1NBEA 2X5XA 1KQ3A 2IIVA 4EX6A 5BMVB 5IXYA 4DR1B 1YIDA 3FUVA 4KGVA 4G5QA 3I2KA 3WQRA 1I4DD 3DL7A 3L7JA 3RKSA 3GN2A 2LCQA 1EVQA 1OWNA 1DU4A 1E9VA 3DHEA 1XZIA 2PLFA 4GMFA 4JI4B 1X3SA 2ELIA 1X8XA 3NCHA 2OZPA 5LD2B 5AQEA 4B6QA 2DKVA 4Q9NA 4S1OA 3W0LB 1FDWA 3NBMA 1DX4A 5FLYA 1CHDA 1MJ5A 1NAHA 3A58B 3KBOA 2E49A 2HFJA 3HXKA 4AS2A 2MSEB 4B0OA 3HKEB 1TCAA 3FMGA 3IEVA 3UAVA 2Z3WA 4LX0A 3KU4A 2EX0A 4QGHA 2OCYC 2JH3A 3LS2A 2X23A 1DLIA 3L7BA 1ZD5A 4M1QA 5GVSA 1P1BA 3TQOA 2QS9A 3DGEC 3K35A 4TUYF 3TSYA 2GGSA 4OU5A 4OK3A 4HQLA 1TVKA 2GPTA 2XWSA 3D3WB 3OT4A 4PM4A 3KJNA 5FB3A 3SF8A 2XCLA 3F1KA 1GSOA 1GY8A 4RCZA 3Q1LA 4V0NA 3TKYA 2QP9X 3V34A 1IC6A 4ZV4A 4U1RA 2QHXA 1WXFA 1R5JA 3CLUC 4QXAA 1J0AA 1QGDA 4UXHA 3OJFA 1STOA 2CJWB 4E5YA 3JQRA 2V53A 1HE3A 2VSFA 2BKLA 5B3JA 3UATA 2F3CI 1XQXA 3JATB 4TTAA 4LKOA 3GH3A 4RETA 1GZHB 4IXMA 2ENWA 3U3DA 3OJWA 1CLUA 3MCVA 1R9NA 3AHGA 1J06A 1P2SA 1WXQA 2AGVA 2QMHA 2XEXA 1EVJA 1U9YA 2QPTA 1HR0B 5KQRA 3ZY6A 1WKCA 2V7UA 4EHLA 3SDSA 2RJ3A 4UAGA 3A4MA 2C2OA 3TRHA 5CT4A 1QF6A 1DIOB 3GAMA 3K1JA 1AXEA 1OA0A 4RZIA 3RYHB 2C5LA 5K03A 2FQQA 2I4LA 2OGSA 3EMDA 4DIBA 1S2OA 2WSYB 1A2BA 1PF7E 4RYLA 2JHAA 4ZZIA 3ZTTA 4KACA 1NVUQ 2HA0A 4MLZA 1G5HA 1SXJC 1SO8A 1VG0B 1Z33A 3EIXA 3QVGB 5DLPA 3TXAA 3QPVA 1XKLA 4CIBA 2PZEA 3IVAA 3VOTA 1BDHA 2PUDA 2FRXA 2OAQ1 1XTIA 2I8LA 2O2SA 2HQRA 4RHFA 3ZC3A 4Q34A 4UJ5A 4K9PA 4ZI7B 5G4LA 5LKRA 1MRSA 3QELA 2JFNA 1U4OA 1KZ9A 5C34B 1RAEA 1F8GA 2X7XA 5A04A 2XWBF 1IUKA 1HTTA 2NG1A 3DHNA 4RA6A 1LSUA 1C1XA 1S8NA 3RVBA 2YY7A 3PEFA 4AJLA 5AJZA 1K4KA 1PR5A 1AS0A 5I3CA 4P83A 1CUUA 1LJ8A 2FXIA 4XDHA 3WLIA 3MXOA 3IJRA 3WNVA 3CVWA 4BB6A 2Q4OA 3MLEA 4ZVUA 2FUCA 1FARA 2JA2A 4M60A 2H7YA 5ER9A 1G2OA 1P74A 3CLSC 4X6XA 5DX1A 1FXWA 2Z4RA 1BKSB 1NI3A 2DT5A 2O2DA 2J7KA 1NYQA 3EZYA 4JXKA 3EG9A 5F78A 5GJCA 3VNVA 4NXMB 2WV9A 2VNJA 2OCAA 3LAWA 4W5QA 4B8WA 1JAYA 2PUWA 3P2JA 4R84A 1E5XA 1B6GA 3EYAA 3OPYA 3U39A 4A73A 5FR1A 3KPWA 3AJEA 4IVPA 1AKTA 1CZKA 1Z08A 4FZRA 3FJ1A 4O1MA 3HB7A 1W1UA 2E4YA 3O8LA 2OD1A 2J8ZA 2OUKA 1QGOA 3DMTC 3G1WA 4FYMA 4ND4A 1NSTA 1ZC4A 4TLCA 5AJYA 2B99A 2CFOA 5EWJA 3VR0A 4OA5A 2GKGA 2AXPA 3RPEA 1WDLA 5CIQA 1E9DA 1XZDA 4HQNA 3BGDA 4Z9XA 4AO6A 2IXDA 4E2XA 1GG2A 3EC7A 1OY1A 3QIVA 3WYDA 5ICCA 2Y2VA 1SXPA 5FBLB 3EWAA 1H42A 5EKDA 5EWLA 2EG9A 3VU0A 4Z9YA 2ZBVA 2YICA 4H35A 3W5VA 2A4KA 4L5IA 1OT5A 1X13A 3JU3A 2EGUA 3WDKA 2XUPA 2E3JA 4XOUA 1PVDA 3ET5A 5ESRA 1JEYB 4FE4A 1GUAA 4E30A 1N2ZA 1RLIA 2H2HA 1DINA 5A3RA 4IZHA 5JUWA 1PX2A 4KLRA 4F5ZA 5DHTA 3FVTA 1G5FA 2ZDGA 4YJ3B 5FA8A 5EXXA 3ZGXA 4XYLA 5JCZA 4DUYB 1T4CB 1NOJA 1XRSB 2WJIA 4ALMA 2WLSA 4S1PA 3WE7A 8AT1A 4RTNA 3JPYA 3A27A 3EAQA 3PVSA