2QPOA

Thermotoga maritima thymidine kinase in the apo form
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
180
structure length
153
Chain Sequence
b'SGKLTVITGPMYSGKTTELLSFVEIYKLGKKKVAVFKPAHVIERPEEMRKYIEEDTRGVFIDEVQFFNPSLFEVVKDLLDRGIDVFCAGLDLTHKQNPFETTALLLSLADTVIKKKAVCHRCGEYNATLTLKVAGGEEEKYIAVCRDCYNTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidine kinase
publication title Quaternary structure change as a mechanism for the regulation of thymidine kinase 1-like enzymes.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 45
structure length 153
sequence length 180
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2007-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2qpoA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qpoA01
5TB5A 2H57A 4E5UA 5CYPA 1HQYE 4MKHA 4HI0E 1G3IA 4B6FA 4NE2A 3RS2A 3RS5A 5C4GB 4BFUA 5DE3A 1P3JA 4ZIRA 3R7WA 1Z07A 3NDPA 3B78A 3T1TA 4AYXA 4ZDWA 1HE8B 1JAIA 3U6BA 5C4MA 1E2IA 2UZ3A 1PLJA 2J7KA 3T06B 4CW7A 4E03A 1BH2A 2OCPA 5EUQB 4TMVA 5F3WB 4BFWA 5B30A 1DAMA 1YZQA 2KI5A 5GVSA 1E9CA 1YE8A 3RRNA 2ZI6A 1W2GA 2P2LA 2OFXA 2RHMA 3LQRA 4C0LA 2PMKA 1BOFA 1AN0A 1MR3F 4ILEA 4RD4A 2HLDD 4Q4AA 4TMWA 4OBEA 2J7PA 1ODFA 2C9CA 3D3QA 1DVRA 4D82A 2ZS8A 1WQ1R 4Z54A 3L8YA 2QT1A 4JMPA 1EG7A 4TYNA 4L15A 1YZUA 2C99A 1OXUA 1VIYA 2ZM5A 4W7SA 3JZAA 2V54A 4W5WA 4PO1A 2Q9CA 5FPTA 5CIQA 1RJ9B 3CWQA 2DB3A 3A4MA 1DARA 2WWIA 4LYHA 1P62B 1UAAA 2GXUA 4WOPA 4CIDA 2UVQA 5GJCA 1W0KA 1XCGB 4G5GA 2V3CC 1JPJA 4MGIR 3SE0A 3W6NA 2F1HA 1UBEA 3BB4A 3R20A 4C0JA 3IHWA 2XZOA 2HYIC 1SQ5A 3K53A 4TMTA 4KYIB 1UDXA 2XTNA 4A1FA 2OESA 1SXJD 3QF7A 4HAWA 2HT1A 1NKTA 2RGNA 4ZCIA 5KTYA 3I61A 1U8YA 1LW7A 2FV8A 3FKSA 4JBYA 2C77A 2GAOA 1C4OA 1EFRD 2NO6A 5DHFA 2GVDC 3NWJA 4TMZA 1M34E 4EPWA 4KO8A 1QG4A 1ZD1A 2QU8A 3DOFA 1N6PA 1LF0A 2QPOA 3BFKA 3IO5A 1IY2A 5SZHB 1NRJB 1FX0A 3QOFA 1ZAKA 3TKLA 2ZITA 3BGWA 5FOWA 4AKHA 3Q9LA 4V0OA 5AJXA 4D4KA 2VL7A 3VR1A 2L0XA 2IWRA 1N6IA 5TV2A 2VP6A 3CNOA 2F43A 3UMFA 2WVJA 3QENA 4PC2A 3DMDA 5KU1A 3TW8B 2IC5A 1HUQA 5EP3A 1W0JD 4DWJA 1D9ZA 3R8FA 3LA6A 1E79A 3P1JA 1Z6GA 3FFAA 2GF9A 6Q21A 2W6IA 1G7TA 1R5BA 5BW8A 4OHYA 3UG7A 2FSGA 3I4LA 1P9NA 2P3SA 2R2AA 4JL8A 4MRPA 1ZM3A 4OYHA 2BJWA 4NP6A 4M9QA 4GRAA 3EWAA 2VSOA 5J4HA 2IUSA 2VHQA 2ZYUX 4LC1A 2IXGA 3THWA 4EJSA 1GG2A 4TQUS 2OSBA 3B9PA 3Q5DA 2WV9A 4RD2A 4RKEA 1E0JA 3PXGA 1S3SA 1IBRA 4JLVA 1LNZA 1RC8A 3BRWD 4PXAA 1BYIA 2QI9C 1E2PA 1FOEB 5FFMA 4EDHA 4V0LA 3SYKA 4IDNA 1BKDR 5FI1B 4D0LB 3IUYA 3SZRA 3LVQE 1Q1ZA 4OK5A 3TGPA 2JLQA 3B1WA 1I4LD 2DWQA 1F3OA 2V9PA 1NY6A 1VCOA 3LBNA 5AJYA 2ZRDA 2C9OA 2ODEA 3SFVA 2ZUBA 2CBZA 2WKQA 2B6HA 3ICQB 4JBWA 2ENZA 3TRFA 2C5LA 1CR0A 4JL6A 1ZIPA 3U6KA 3VNUA 1Q1QA 2MSEB 4YONB 3BERA 3UFFA 1XB2A 2A9KA 2ZREA 3KQHA 1Z0IA 3Q7QA 2D2EA 2REXB 5JSZA 1G5PA 3I32A 3G82C 4AG5A 3MWLA 4W5JA 1G41A 4Q02A 4GDFA 1DELA 3WXMA 4M0LA 2GCOA 5DNYB 1XPOA 5KDDA 2IX3A 3W5JA 1E9RA 1OH6A 521PA 2QQEA 1R6BX 5GJVC 2BBSA 1WDTA 4ZCMA 4R71A 4KCGA 1OE0A 4HAUA 1E9SA 3GQBA 1N5IA 4QKQA 1JALA 2E1RA 1K5DA 1TQDA 4M22A 3L0PA 4C2UA 2OAQ1 3EPHA 1U8AA 2ZSFA 1S9HA 2D06A 2VF7A 2ERXA 2XNDA 3GLIE 5LPNA 2GJAA 1KKLA 3LWNA 1W5SA 4M9ZA 4URWR 4XD7D 1Q1BA 1G7SA 3AF2A 2ZRNA 3GJXC 4KJZA 4GT1A 3UGDA 4MUAA 1HYQA 4F92B 4X8LA 5JHGB 1EGAA 2QMOA 2I3BA 4KODA 1T0HB 3QVUA 1NN1A 4BLQA 2B92A 3EA5A 3TVTA 4TYWA 1OKKA 2CLCX 1XD8A 3ASZA 4MYUA 2REOA 1GSIA 2QPTA 3EC1A 4V0ME 3U3OA 1Z0KA 4PANA 4RZXA 5C46F 3AUXA 5FPHA 2AFIE 8OHMA 1II0A 4NCHA 1ZVQA 4MKIA 4BE7B 2DBYA 1CJUC 4HDOB 2J9RA 2GJSA 1JR3E 3NC1C 1CBUA 5CJ2A 1XX6A 4PFSA 1NVWQ 1L4YA 1MRSA 1OLOA 2PLFA 2ZRLA 4JSYA 3P32A 2AK3A 2HF8A 1FP7A 1YR7A 1MO5A 2YC4C 1CULC 1ZBDA 4Q03A 2AK2A 1B23P 2J0UA 4OL0A 1J99A 1UF9A 4M1TA 2WOOA 5BYKA 3K70D 1QHSA 4PAQA 3LBIA 3GLIA 4FCTA 2K5UA 1XU4A 4NCKA 3B1ZA 3MG9A 2OO7A 4H1VA 4QGFA 3GLGB 2F3RA 2H5EA 4LJ4A 1KNXA 2XZLA 4YMSA 2LKCA 2IXFA 2H92A 2XJ9A 1GKIA 4C9BA 2IYRA 2WKPA 1CP2A 2ZIAA 3KKMA 5DN6D 3RSLA 3I5XA 3SDZA 1XEXA 4A36A 1ZM4A 3X2SA 1PVOA 1KHTA 1BIFA 2AR7A 2IBMA 4US0R 4DEXA 3UKDA 3HP1A 3N70A 1GL6A 1VG1A 4R9UC 5FBLB 2QG6A 3BIFA 3CKLA 3QUSA 5K8IA 4Z8XA 4LYAA 3IQXA 2NOAA 1SHKA 3IQWA 1KI7A 1AM4D 4WZAE 4TSFD 2WPDD 1MABB 1XTKA 4G5SA 4NCIA 1K6MA 2ROWA 5JEEA 4JVMA 3L8ZA 3RWOA 1GOTA 4DLUA 3I73A 5F2EA 4M1SA 3VU9A 4M1WA 1COWD 2JLZA 3AF4A 4ESHA 1NMYA 4LC0A 5KO2A 4CGZA 3B13B 4GBMA 2IA5A 5JEDA 2O8EA 1IM2A 2QSZA 1SZPA 2IYLD 4Q47A 4WVFA 4NTZA 1U9IA 3ZDQA 4QBHA 4QM7A 1IN5A 3F3YA 4Q19A 4WA7A 1HV8A 3ZS9A 5DI3A 3ADKA 3MFYA 1P75A 2F3TA 1N5LA 1KKMA 3V00A 1ETUA 3UGLA 3VKWA 4TTRA 1DPFA 1XJ0A 1S3GA 3U7HB 3QJYA 2ZRBA 4BECA 4B74A 1IN7A 1YR6A 4G5RA 4PR0A 4IJMA 2FSHA 2ZANA 4MQBA 4UJ3A 5BN4A 3RWMB 2JJ1A 4NONA 1E94E 1S96A 5HCIA 2IUUA 3UATA 3HPQA 3EA0A 3W34A 1Z83A 2D62A 4FMBB 4IOLA 4QHSA 5IK2A 4DSOA 3AVPA 4KBGA 3IIKA 1WRBA 4NKRA 4Q7KA 4KHZA 2QM7A 4D80A 4JLAA 5F98A 5DYGA 2NPIA 1H8ED 3K0FB 2GEDA 3MSXA 4FCVA 4NCNA 3U60B 4NYJR 3EIHA 1XNJA 2PT7A 5SZJA 5JMTA 3ICEA 2ZE8A 1Q3HA 4PPGA 3PEVA 1YKSA 4JSTA 3QKSB 2B7BA 4NYMQ 2NPFA 1XMIA 421PA 3T34A 2R6DA 3C16C 2WJVA 3AVTA 3U4QA 1IXZA 1U2RA 4EFLA 1E2HA 1Q22A 2NO9A 2WJHA 3FWYA 1JQLB 1KI4A 3UWKA 4MRRA 1TUIA 5LD2B 1FNNA 1R8QA 1G1MA 3QI2A 4OQXA 2AKAB 2ZI7A 4Y0VA 4DLWA 2CXXA 5H1YA 2ZU0C 4PAOA 1WP9A 4AURA 1G16A 1VPLA 3KL4A 3MGCA 3K0CC 4YXWA 2GDJA 3LVRE 3AKCA 3MWKA 4XVQA 4ZO4A 3V4RA 1R0WA 4Q5IA 3QBVA 1AQUA 4ITRC 3TSOA 4KV9A 1Z0DA 4LCBA 4A0HA 3AVXA 2O8BA 2QN6A 1G5TA 4C2TA 2QMEA 2EU8A 5JRZA 4B3DA 4D6PA 1W4BA 3X1ZA 5FTLA 4KXFB 5KPJA 2P6UA 5B64A 3VR4A 4YMWA 1PLLA 3GP8A 1LS1A 2OBNA 3AGPA 1Z6AA 1II8A 3KQUA 4Q7MB 1E79D 5KPDA 1R5OA 1X86B 3TUZC 1BMFA 1P6XA 4B6DA 1MH1A 5G41A 2QRZA 1QRAA 2F9MA 1JEEA 1AZTA 2YJTD 4O0MA 1E69A 2EFCB 3WMEA 4HLCA 3K0AA 2NO7A 3LX8A 4GOXA 1JJVA 1ZMXA 3CF2A 5EUMA 1Y3AA 4RFVA 5FPYA 3E5HA 4NCJA 5FBRB 1E1QD 2BCJQ 2QQ0A 2A2ZA 4TT3A 3IEVA 2PBRA 1TBNA 1I2DA 2CMKA 4LZZA 2FG5A 1GFIA 3B1YA 2EFHB 1DAEA 2CCGA 2X19A 5A4JA 2PJRA 4YDHB 1DAGA 1WB9A 3CZPA 1PV4A 4XIGS 4MKGA 2BBWA 3DVLA 4OI4A 3GJ0A 2ZI4A 2MSCB 1M7GA 2DFKB 2GAAA 3NDBB 2WHXA 3PV0A 4LGMA 2CL7X 1QBKC 5EXPA 3R9XA 4B3GA 2CE2X 4QC2A 3QPVA 5L3VA 1CJVC 3X1WA 1NG1A 1F2TB 4JL5A 3HU1A 1ZM2A 1ZINA 2AD5A 3I72A 1H8HA 3TK1A 4A8JC 3UK6A 4II7A 3H86A 3K70C 3AVVA 4MITA 4JVNA 1RFHA 4CEJA 2NIPA 1ZRHA 5EXTA 4ZI3A 2WJIA 4JLPA 1W4RA 5F9HA 3JVUA 2QT0A 3VX4A 1U98A 2GBLA 4Z51A 4LHYA 4PO8A 4HAZA 2A7QA 2KWIA 1R79A 4PSVA 4OQFA 3K9NA 4PPNA 2X2FA 3MWJA 1TTTA 3OE7A 1F5NA 2GKSA 1VCNA 1NI3A 2Z4RA 3EWSA 1W47A 4TYQA 3JVVA 1BS1A 2YZ2A 4C4PA 4U02A 5JBQA 1IAQA 3QKUA 2XX3A 5FR1A 2A5GA 2X77A 3EARA 3KJEA 5KDLA 4FD2A 3PEUA 2XNDD 3EAQA 3DKPA 3IHLA 2CHGA 3OFNA 5UKDA 2VTKA 1YVDA 1IN8A 2FN4A 3DMNA 1G64A 3RHFA 1UPTA 3BS4A 3E70C 3OAAA 1G19A 4C0HA 2XAUA 4EQ6A 1E2GA 4AKIA 4IDOA 2R9VA 2XGJA 4MUBA 1SXJB 4AI6A 1SVWA 3AF0A 2ZJZA 2ZRKA 3QF4B 4DEYA 1N0WA 1OKKD 1G3MA 3IO3A 3BD9A 5AJVB 4Q4JA 4ASUD 2PZEA 2GXSA 2IHYA 4U5XA 5D3MB 4D4LA 2CK3A 4ERNA 2RGCA 2AFHE 3CH5A 5J5CA 4LK2A 3DHWC 2ZETA 1QDEA 2BEKA 3WP1B 2RAPA 5DIFA 5AUNB 1NBME 1QHGA 4GZMA 3O8RA 4HUTA 2FOLA 1E96A 1KI3A 2WAYA 5IF9A 4R7ZA 2W2VA 4U00A 3B5JA 3BOSA 2HUPA 2WSSA 1TU4A 3A4NA 1Q20A 1C9KA 3KB2A 3LH5A 1KJZA 4Q1BA 1KO5A 4HB4A 2KJQA 4IW3B 4TWZA 3TUJC 2DR3A 1XWIA 4JZKA 4CEIB 4BFXA 1EWRA 1RRFA 2BBTA 3K9HA 2AKYA 4NDZA 4US2R 2QROA 4Q00A 4AK9A 3P27A 4OQLA 2H18A 1AS3A 2REBA 4M8NE 4KLNA 3PJRA 1G4AE 1Z08A 4LSGA 2HYDA 2YNMA 4EPXA 1KBEA 5EP2A 3N2IA 1RJ9A 3AVWA 1HT2E 2CNWA 3OIYA 3UEYA 1CTQA 4EKDA 1NBMA 3U3JA 4B48A 1E2MA 1P9RA 3SYLA 1XEFA 1R4AA 4QHTA 3FMPB 1GRNA 2QTFA 2HF9A 1G21E 1XCMA 1EX7A 1XRJA 2RGNC 4WZBE 2GEVA 1EFHA 1Z47A 4I1UA 3U7EB 2W00A 4URYR 3DL0A 1PJRA 3Q8XB 1HTWA 1SKYB 1X8JA 3BAFA 1MRNA 5LB2A 2OXCA 1N5JA 4Z1MA 1M2OB 3CF6R 2QP3A 2A78A 3B1VA 2NZJA 3FKQA 2ZU6A 1QHIA 2DHRA 5HE9A 2ZVQX 3L82B 2GJKA 3GLFB 1OXVA 1T91A 3R9IA 1G7CA 2N46A 2W0MA 1W36C 1R7RA 2E87A 2GK6A 2ZRJA 3B82A 1RPZA 5E4FA 4MGYR 1ONBA 2YWGA 2IEZA 3H1TA 4UNRA 2R65A 1J90A 2XOKD 1WBDA 2VIIA 1SVOA 2JJ1D 1Z5ZA 3B8HA 2FZ4A 4IDQA 2Q3FA 3QPWA 1RVDA 1TX4B 4URVR 2C95A 1G4UR 1KIMA 5IK2D 3VKHA 2FPLA 4TYPA 4M21A 1SHZA 1FARA 3HYTA 2ODNA 3TQFA 2B8TA 4RCYA 1P60A 2DFNA 1VCMA 3VQTA 3TJZA 4EJSC 3I62A 4EPVA 1RZ3A 4HEJA 1YRBA 1I2MA 4Z8YA 5SZKB 3RRYA 1OSNA 2X1VA 3CO5A 4PAMA 2O8CB 3UANA 4QGAA 3PR1A 3P26A 4HDCA 1U0JA 4AC9A 3C14C 3SHFA 2VEDA 2JLXA 3NBFA 2YVUA 4NHOA 2EYQA 1P2TA 2VF8A 4LPSA 3K0SA 1PTQA 1YQTA 4P4SB 5EP1A 4CT5A 1Y8FA 2OLKA 2W6JA 1KAGA 1OH7A 1KTVA 2Q21A 2JASA 3DO6A 1ELOA 1E2QA 2NGRA 1OT3A 2Q9BA 2F1IA 2GCPA 3TW4A 4B2IA 2ZUCA 1XPUA 3I8SA 1X1SA 3LQQA 3ZIAA 3W3AA 2QY9A 4YXWD 4M1KA 1W7AA 3QXCA 4HSEA 3LX5A 1G3RA 1I4TD 1NVVR 3AP3A 2VSFA 5JJLA 1F60A 1F2UB 1XMSA 4DIDA 2GA8A 1FTSA 2I1VB 2CL6X 3U7GA 4POAA 5FPKA 4RKFA 3THYB 4JLNA 3OIWA 3ND8A 1UJ2A 1G6OA 3QIAA 2FFBA 3C5HA 2WWHA 1VG8A 4D4JA 3RVBA 3KKNA 4RFSB 3GEHA 1IJFA 3EZ2A 1NLFA 5CLLA 4D26A 2PEYA 3AV0B 3I8XA 2R6GA 1NIPA 1VKJA 3QG5A 4LHVA 4Q1EA 4XH9B 1KNQA 1BMFD 1Q0UA 4S2EA 3RLFA 3B60A 3BXZA 1UEIA 3HU3A 4KLZA 1KJWA 2BHRA 2QP9X 5J4KA 2D2FA 2IYVA 2N42A 2WJGA 2QGNA 5TXGA 1O87A 1ZUHA 3BK7A 5FUWA 4RD6A 4MH0R 1CJMA 4TLDA 4K46A 4KVAA 3ZVLA 4A9AA 2HT6A 4B2PA 1Z06A 5TMPA 3QEJA 1T3SA 1ZC3A 5IRCD 1H65A 2GXQA 3ZVNA 4C0BA 3WHLA 4X8OA 3GLGE 2NZ8A 4LI0A 3VKGA 5JJKA 2BMJA 4RZ3A 5FBQB 3WNBA 2VPPA 4LJ9A 2WJYA 4G3XA 1AGRA 3KXLA 3AF1A 4GMXA 3KKQA 4QOSA 3EPKA 2RGBA 1M7HA 1N6OA 1ZUNB 1QVAA 5TY0A 2F55A 1GITA 4IKEA 4FMCF 1HY3A 1KO4A 4XWAA 5H8WA 3T61A 1A2KC 4QBGB 4W9MC 5J40A 3WBJA 1Z0FA 3TAHA 2Q6TA 1T3LA 2RGGA 1G8FA 1U0LA 4V03A 2J87A 2F9LA 4RJLA 1H8HD 4N3NA 2RGDA 1GNRA 2VLIA 3V9PA 4XWOA 1E0KA 2ZJ8A 2UKDA 3A1SA 5EXSA 3EIEA 4P4UA 3D8BA 3O8BA 3RNLA 4B6EA 2GVIA 2GK7A 1II9A 3PENA 4A92A 3KJHA 4HUQB 3K09A 1KO1A 2ZXUA 5FUVA 1NMZA 1Q3TA 4HDQB 2QSYA 3GLGA 3A1WA 1LTQA 1GP2A 4L9SA 5CIWA 2FF7A 2BJVA 3OE7D 1E4YA 1GRRA 4JVSB 5FUXA 1SVMA 3DKVA 4TTQA 4Q9HA 3RANA 5KDOA 5FL7A 1WF3A 1EESA 4AKGA 1FUUA 1CLUA 4MGZR 2Q0HA 4UNPA 5JRJA 3Q85A 4F4JA 2D4HA 2QPAA 1RW4A 3MJHA 3LLUA 3KX2A 2QBYB 1NP6A 3F0TA 1MABA 3BFXA 4OQNA 3KUDA 1G8GA 2ZJ5A 1OFIA 4IOMA 3ZD6A 1XBTA 1S8FA 2BC9A 1RRCA 3LW7A 1GNQA 3GJ8A 1JQJC 4YMTA 4Q01A 2CHVA 4O2RA 2JEOA 1FTNA 1TF5A 2ZPTX 1TMKA 3AP1A 3SC3A 1FNMA 2FPKA 1AIPA 5DLQC 1U9IC 4GI7A 1ESNA 2KSQA 1E9BA 5DYIA 2GXAA 4LDJA 2CK3D 2EFEB 1R8SA 2AXNA 2VSXA 4URZR 2RGAA 2XNSA 4A0RA 3Q7PA 5HZKA 1MV5A 4IRUB 3DZ8A 3ZQ6A 5JI2E 1ZD9A 4EAQA 3T5DA 4CT4B 1XF9A 4PO9A 3QPUA 1JPNA 3QBTA 2O0KA 4QRHA 3CPEA 3MRSA 4I81A 3WRYC 5AUOB 1KJYA 3EC2A 4NYJQ 5FTMA 2WSSD 2V6IA 1UKEA 3O47A 2QAGB 4X8HA 2MMGA 4TL9A 4RD3A 1GAJA 1AKEA 2QE7D 3CRQA 4BGDA 5KSZA 5KSYA 2BOVA 4BLPA 1MT0A 1OYWA 3N5CA 4CVNA 5DH9A 1FQKA 3IDQA 4B35A 1CF4A 3MWYW 3PEYA 1T0JB 2AD1A 1DADA 2DPXA 1LF5A 3SNHA 1PUJA 3WRXC 3MJRA 1E9FA 3NH9A 1CKEA 1Z8FA 3K0FA 4IHQA 1E98A 4JJKA 4GP7A 4JBXA 2P6RA 2ZRGA 2PH1A 4IXMA 2ZSAA 2IS4A 4G5OA 3NBYC 4WBSA 4DCUA 4B47A 3GJ4A 4HAXA 3ZS8A 4BLOA 3UEJA 1YZGA 3QKSA 4LV5B 3AGQA 2VHTA 1ZP6A 2X2EA 3SFZA 2VQSA 4KYUA 1ZU5A 1KAOA 2ZRCA 2DFTA 3PG5A 3M6AA 1VCIA 1K8RA 1HQCA 5EJEA 2R44A 4KSCA 2XSZD 4KFRA 1D2NA 2RGEA 2BWJA 4V0MA 2OLJA 1G18A 3BB1A 4PSKA 5P21A 1TAGA 1V43A 2WIAA 3T1OA 3KKPA 1DAFA 2MSDB 1JR3A 3NBZC 2P5SA 4Z1MD 2XXAB 2AX4A 2ZE7A 1UFQA 1YHNA 2ZRIA 3SEAA 3UXMA 3EPJA 3C8UA 4TMXA 2PZGA 1QHNA 2Y8EA 2OFOA 2FWRA 3CUEF 3U2QA 4NZYA 2FNFX 4GZLA 4HB3A 3ZYCA 4Y0AA 4MDEA 2CHQA 2G83A 1W49A 2J0VA 3BE4A 1TBOA 1P4SA 3LW8A 5FOTA 1N6RA 1XTIA 4Q1CA 1P5ZB 2EFGA 4LHWA 3ZZ0A 2C98A 2JLSA 2RGXA 5H68A 3RS3A 2G0TA 4DLXA 1YJ5A 2FFHA 1D5CA 1R10A 2CEAA 4JIMA 3CONA 5JLJA 1DOAA 2G77B 1XJQA 2QUZA 1D2MA 2DY1A 1WMSA 3KXIA 4AIIA 3WBKA 1NL3A 4Q9IA 3QG1A 4PC7A 3BC1A 3RABA 3QE0A 1HURA 1NLZA 3E1SA 2G9NA 3ADDA 1KY2A 3P20A 1KMHB 2FNAA 4HZIA 4KU4A 5JS7A 1EK0A 2OEPA 3AEZA 2JCSA 5K8TA 4QBIA 3TAUA 4PC3A 1T6NA 1XZQA 1ZCBA 1N3BA 4LJ6A 1OFTA 2J7PD 5FL3A 2ZQ5A 1FUKA 3GLHB 4IVRA 4DLVA 4UXIA 1JJ7A 4B3BA 1DEKA 3FMIA 2ZYTX 1FAQA 5CM9C 4FMDF 1EWQA 3FE2A 1YR9A 4WW0A 3A1TA 5AJZA 3AUYA 4KFUA 5FBVB 3C5CA 2QNRA 5KHOC 2ZRPA 4PX9A 2IYZA 1YZLA 2R8RA 3C7KA 3SI7A 1W0KD 2OE2A 4JKYA 3ZIAD 4FIDA 1F2TA 1KK3A 3ZD7A 1RYFA 2WWGA 4X8MA 3SS8A 3VFDA 3RYTC 1J7KA 3U44B 3VNVA 3DDCA 4LJ8A 1D6JA 5KYKA 1FMJA 5SZIA 2P0EA 1M1YE 3VTKA 4F7WA 1XTRA 2ODWA 2PZFA 5HKKA 1JR6A 2GBLC 2ANCA 1SXJE 3L2OB 4PZLA 4UQOA 1UM8A 1PTRA 3BJIA 3GCGA 2KB0A 4JKIA 1VG0B 2VO1A 3OEHA 3KUCA 4P32A 3FKSD 1N6NA 3GFOA 4PZYA 1XCPA 2FA9A 1KSHA 3NEYA 4TLAA 2IUTA 1ZIOA 2FFAA 2GVZC 3H84A 3QXHA 2OM2A 5LBIA 2W0SA 3R8CA 5CM8B 1E6CA 4F4CA 5JS8A 2NTYC 3VAAA 1DBSA 4PHTA 4I1SA 2EQBA 3TUIC 1W36D 1P7CA 1E1RA 2ZSEA 2LWIA 2F1RA 3T5GA 3LNCA 1HEIA 2BBOA 2BIFA 2VHCA 3H4MA 3HR7A 2O0HA 1ZCAA 3ZZTA 3LRPA 4ZI2A 3WYFA 3AKYA 1OW3B 5G40A 4E09A 3KFVA 2QTVB 3GPLA 1FPMA 2D7CA 4XTRA 4BLRA 3T1QA 2ZI3A 1SVSA 4JJZA 1T8TA 2JJ2A 1NMXA 1U0HC 3LV8A 3RS0A 3CR7A 4RD0A 1OHHA 1XFAA 5B58C 2BV3A 5L3QB 2JJ8A 3NTUA 3JZMA 2W6ID 2W83A 3DM9B 1Z3IX 4L9MA 3BH6A 5HPYB 4OJQA 1XZPA 3A4LA 5LB4A 2BMEA 4OK6A 1SXJA 1TNDA 1W44A 2DFLA 2RKOA 3FHCB 3VR6A 1X8LA 5JWRA 3PQCA 4RD1A 3QF4A 2ZRMA 1EFTA 1OYYA 1IQPA 4E22A 3TMKA 2GJ9A 2VH5R 2Z0MA 2BMDA 4G5QA 3TIFA 1L7VC 3WYAA 5D3MA 1EFRA 4CEHB 1P73A 4HB0A 1UADA 3BB3A 5HE8A 5GJBA 5BXQC 2FFQA 4O25A 3ONWA 1L4UA 3VMFA 5BN3A 3TLXA 4B3XA 2QENA 1VHTA 1YZNA 3KFXA 4WXRA 4LBYA 2G6BA 2QP4A 4TZ0A 1Z0AA 3UMSA 1L8QA 4YMVA 4M1YA 1J70A 1E3MA 4ZCLA 1S9DA 1UKYA 5L3SB 4BEJA 2BDTA 2AWOA 3CRW1 4EPYA 2ZUDA 3NXSA 4KAXA 1CXZA 2GTPA 4ARZB 1SKYE 2I4IA 2ZE5A 1E9DA 1SKQA 4F93B 2JLYA 4M1OA 3IBGA 1KDRA 4CEIA 2HEIA 2BM1A 3UIEA 1FMLA 4ESVA 4A15A 1KBFA 4B71A 2J41A 1XMVA 3GLFE 1U81A 3NIBA 1T5LA 4YQFA 1QG2A 4LJ7A 1UBCA 4C7OB 4Q4HB 1Z2AA 4LHXA 1XXHE 5FL7D 3SJAA 2IF2A 3NG1A 2CE7A 3FYHA 1KDOA 4JLBA 4JT4A 3WHKA 4KFTA 2V4ZA 3IIMA 1W4AA 1E2LA 2OILA 1CJKC 2VHJA 1RRPA 2DYKA 1GM5A 4HATA 2WTUA 1CRPA 2ORIA 4EFMA 2ZEJA 4LV8B 2ZR7A 1U94A 2HJGA 2OCAA 3ECCA 1OFHA 1TU3A 1CS4C 2QZ4A 3ZGXA 3F8TA 5CK4A 1G7RA 4KI0A 1MO4A 1N0UA 4L16A 2GZHA 3GEIA 2C96A 4HLUA 1TEVA 2P65A 5J4YA 2QEQA 1FQJA 4Q1FA 3S1AB 5B2ZA 4B76A 2KBFA 2ASEA 3IIJA 2VA8A 3IILA 1TQ4A 2CJWA 3OF5A 3RS7A 1HT1E 3LXRA 3UGIA 3GLFA 1IN6A 2V55B 4PHGA 2WWXA 3SJBA 4B34A 1R2QA 4XOIA 1JECA 3A37A 1EXMA 2O52A 3OIVA 1YRAA 2JAQA 3CNNA 3IKJA 3NC0C 1ZJ6A 2FGJA 4LBVA 1VMAA 5G53C 2DCUA 4LJYA 4K81B 2KE5A 5JZVA 1E9EA 1Y63A 1M6NA 5AR1A 3FHOA 1N25A 3UWOA 1KI8A 3C15C 4GNKA 4DUGA 4KBFA 2EFDB 4N1AA 1KDTA 1Z0JA 3SQWA 3RDPA 3QEOA 4AYTA 4AKEA 2ECKA 1R0ZA 2J46A 4C0KA 1AS2A 4L5BA 4UNQA 4XD7A 1E2KA 1DO2A 4PPFA 3U7FB 1SULA 2QMHA 3T1VA 3B7GA 4DCVA 4QNMA 5DISB 3W6PA 3SQXA 3CPHA 2BEJA 3H2YA 1E32A 4LJ5A 2O8CA 5JFGA 2YYZA 2E9SA 1NVVQ 2H7VA 1XPRA 2FEOA 5TVKA 3P4YA 2R6CA 5E95A 2XITA 4B2LA 4DSNA 5CB6A 2RHDA 1S1CA 5C2JB 1FL9A 4P4SA 4PC6A 3D7MA 2IW3A 3W3ZB 5GJWC 4UXJA 3SN6A 3W8RA 2J5XA 2WWWA 3CX6A 3PIRA 4GP6A 5BYJA 3ADBA 4OKSA 4QL3A 721PA 2MMCA 2D74A 2CLSA 4A4DA 1JR3D 1XTSA 5BWMA 4JLKA 3THXB 3PUXA 4ON9A 4H9GA 1LB1B 1XDBA 2GZDA 3CR8A 4O3MA 1QHXA 5CJPA 4DT1B 1AQYA 4J0QA 2YWHA 1F2UA 4WAUA 4A2QA 2ZJAA 4JLMA 1DG3A 1W46A 2UZIR 3BWDD 4P33A 4W5HA 1KZGB 5KNCA 5HCNA 1VYVA 4GOKA 3THYA 1JBKA 1XD9A 4QFMA 2R6FA 2FSFA 1KZ7B 2ZS7A 3A1VA 3PCRB 1LY1A 3DEFA 4DB4A 3AKEA 4RFSA 2YOHA 1CU1A 2OUKA 1QHHB 4M9SA 3CZQA 1FW6A 4IXNA 2ZI5A 3SBEA 2AN9A 1XXHB 3IGFA 1Z63A 3IPXA 5JWHA 2WAXA 3RS4A 4JVLA 2YUUA 1M74A 4ACAA 4DIEA 3SHWA 1JXMA 4L4UA 5CB8A 2YWEA 1KSJA 2XTMA 2WPDA 4OQMA 1N2CE 3GJ3A 4YC7A 4A2WA 3ETLA 5AK0A 2IYSA 1E0SA 2J3EA 2VP5A 3FB4A 2JIZA 1NG9A 3MAAC 2B21A 4HZUB 4AG6A 5FTNA 2ZTSA 2QM8A 4U7DA 2QA5A 1US8B 2FGKA 3QNUA 1ANKA 4DCNA 2ZJYA 1NNEA 1XP8A 3EZ9A 1O3YA 3BBPA 2D3WA 2ZE6A 2O8FB 2WOJA 3WP0A 4M4SA 4RZUA 4AWXA 2LKDA 2C03A 1F6BA 2Z83A 2QGZA 2Q9AA 2J1LA 2W58A 4I1OA 3SU8A 1IONA 3T12A 2VRWB 3HDTA 2IHBA 2OXRA 2PLRA 4LWZA 4PTLA 3KTAB 4XVUA 1IY0A 4QXAA 2OCBA 3X1DA 2O5VA 4XJXA 4DLSA 1FP6A 1OIVA 1KO7A 4S35A 1KSGA 1Q1EA 2YOFA 3LDAA 4F4IA 3I1FA 4DLTA 2GILA 4JS0A 2BKUA 5DSZA 5AUPB 2H16A 3K09C 5HKKD 3TR0A 2YINC 3E2IA 4UXHA 3CIOA 4IDHA 2EVWX 1ZM7A 1KI6B 3OEHD 4HUQA 1VTKA 5EZ5A 2VP9A 2VP0A 1VYUA 2HXYA 1M8PA 4BFSA 1ZU4A 2BKEA 3CWZA 3V4FA 4A8JB 4V02A 4BEBA 3RRZA 3W90A 4ABYA 3PUZA 2FZLA 3K70B 1OXSC 1H8EA 4FI3C 4PZZA 5B57C 2DWOA 2JLWA 2DB6A 2ENNA 1W1WA 3TVDA 4BQSA 4BFVA 1UBGA 4OK3A 1RE0A 2IWHA 1KY3A 1E1RD 4QBFA 5EE1A 2J59A 2ZJ2A 4KVGA 4QGGA 4OI1A 3A1UA 1IHUA 2PCJA 1P61B 1XEWY 3UMRA 1XD2B 821PA 3HWSA 2FX3A 3NVAA 1TQ6A 4PC1A 2QBYA 2FEMA 1ZNWA 2ZR0A 3NKVA 4LPKA 4LYJA 2JJ2D 4AD8A 1OHHD 3VX3A 3FFBA 4TL7A 2GHIA 4MRSA 2O8DB 5A5GA 5JHHB 1GKUB 4HAVA 1A5TA 1G291 1GWNA 1A2BA 3LAWA 2WBLC 4MRVA 2Z43A 4XVRA 4R98A 2QAJA 1G20E 2G1JA 3KQKA 3FVQA 3MCAA 1G8YA 4EUNA 2IS6A 4TT3D 1S0UA 1SVIA 3WMFA 5JECA 1I4DD 4A2PA 1ZD8A 4A6PA 1KMQA 3VR5A 2LCFA 4TN1A 4M2LA 5IDVA 3U5ZB 2X8AA 2ORVA 1X6VA 3VR2A 2FH5B 1ZC4A 4NYIR 1GUAA 1XJCA 1WE2A 3QKRB 621PA 3L0IB 1CR1A 1VHLA 3B2EA 2OHFA 2P67A 5G3YA 1KGDA 4Q21A 1A1VA 1WA5A 4FMCB 4P3YA 1A82A 4D0GA 3ZJYA 1CR4A 3EW9A 5HZHA 3CRMA 2QAGA 3CRRA 4M53A 1XTJA 1GILA 3B85A 3WMGA 1JNYA 1N5KA 2C78A 2ZVPX 2WMNB 2Q3MA 4ZIRB 5EE5B 1DAKA 3R7WB 2XTZA 1UKZA 2ANBA 3GJ6A 1E2EA 1ZNYA 3OIUA 5J4LA 3VR3A 1TF2A 5KSPA 1Q21A 1K5GA 1Z22A 1E1QA 4BASA 5FH9A 4IDPA 3HR8A 1TADA 4OHVA 3FOZA 4B3FX 4TLCA 1X1RA 3T35A 1S4QA 2RB4A 1DG1G 3MMPA 4FWIB 4Q4AB 5J4VA 1E2JA 4QJ3A 1W5TA 3PUVA 2A5JA 1TUEA 1Q12A 3F5FA 1TEXA 5FR2A 1SVKA 1YZTA 5IT5A 1E4VA 4EIWA 1IXSB 2ATVA 2WM9B 3B1XA 1DAHA 3UPUA 5LD2C 1D9XA 4LJAA 4DDWA 3M0EA 4JLOA 2WMOB 1CIPA 3KJGA 4DKXA 4ZDJA 5EE9A 4D2IA 1P9WA 2OG2A 2XB4A 3BH7A 2IYWA 1W2HA 3EZ6A 4N0DA 2NO0A 4OI2A 4Q66C 3OFND 2YV5A 2XXAA 3FHTA 2WWFA 1N0VC 3OAAD 1GL7A 1OXXK 3ZVMA 2V7QA 2FPMA 1NJGA 1GRQA 3B9QA 3CXLA 4PPQA 4Q18A 1Z6TA 3GLHE 3FDIA 3B6EA 1AGPA 5CK5A 1DTSA 1FFHA 3KZ1E 121PA 4CZ2A 1QVRA 3TQCA 1LV7A 2WKRA 1PLKA 2A30A 3M1IA 2XEXA 4GFDA 4QGHA 3CPJB 5K8UA 3ZLJA 4Q48A 3EZFA 4XSHA 4DLYA 2RCNA 1FX0B 4CDGA 4DUGD 4A0GA 4FKDA 1E2NA 1W36B 3AH8A 3K8YA 2ZJBA 2IL1A 4BPBA 1ZYUA 2B7CA 2F43B 3QXJA 1J2JA 5EE3A 1Q44A 3ZQJA 3AP2A 4B32A 1JXOA 4F91B 3U61B 2G3YA 4DLRA 4LBZA 1KMHA 2JLRA 2HCBA 1UKVY 2JDIA 4H1UA 3RRMA 4BZQA 4TQ9A 1L2TA 3GEEA 3EXAA 4LYFA 2YKGA 2OBLA 4DDVA 4G1UC 1AJEA 1YU9A 2CVHA 3PEWA 3EX7C 3CBQA 4LBWA 3GLHA 4ZKEA 3A8TA 3TBKA 4ASUA 3BORA 2AWNA 3K9GA 4I99A 1EX6A 221PA 2AHOA 4EJSB 3THWB 2BM0A 3EASA 1OB5A 4ACBA 2NG1A 4WXPA 1A4RA 1CR2A 1QF9A 2CNWD 2OAP1 3Q72A 4GOJA 4JYBA 5BN5A 2NQ2C 3PVSA 3UG6A 2FMXA 1NBMD 2EYUA 3K1JA 5CDFE 1B0UA 3TR5A 2IYYA 5FI0B 5E7JA 4IFEA 5L8VA 1SVLA 3U44A 5FUYA 4PHFA 3SR0A 2E73A 3REGA 1NLYA 1FZQA 5KOYA 1WXQA 3LXXA 1G9XA 3BJIC 4YDSA 4EFNA 1LVGA 4B44A 1SGWA 1A7JA 1J8YF 3DZDA 1DO0A 4TTPA 2ZRFA 1PUIA 1P2VA 4XTCS 1G5RA 2BVNA 3OESA 2OZEA 4RVCA 2OCYC 4TL6A 2G0NA 4L8GA 1NN0A 3LFUA 3DPUA 2JLVA 2ZAOA 2C04A 5JSZB 3CW2A 4G01B 3OEEA 4BFYA 1Q57A 5FOVA 3KQNA 5TDHA 1OJLA 1LFDB 2Z6VA 1MO6A 3CRVA 2G1KA 4UNNA 2ZI9A 2GCOB 3KXKA 4O2LA 4FINA 4NU0A 5CDFA 5FTJA 3HPRA 4DDUA 4HYYA 4B43A 2JIZD 1F48A 1T4GA 1YR8A 4P4TA 4TLBA 4TMKA 5JJIA 2PEZA 4A6XA 3SOPA 4DSTA 3LLMA 1GNPA 3QXSA 2BCGY 3LO5A 4ZV4A 1SXJC 2IXEA 3GD7A 4CYMA 3MUFA 4EPRA 4Q1DA 4ZKDA 5L3QA 1P2SA 1XEWX 2EW1A 3CX7A 4PSAA 2WICA 2VP2A 3W6OA 2IYUA 3FGNA 4BZPA 3AVYA 2G88A 2C9YA 1NF3A 3U3KA 1KSFX 3L0OA 4MDFA 2JGNA 2H1LA 4R2HA 4PQFA 1QZXA 2GNOA 3WYGA 1P2UA 2ZAMA 4CEHA 4MA4A 3NH6A 2FE4A 2F7SA 2HXSA 4QNRA 5DO9A 1N6KA 1G3QA 1R5NA 4D4MA 2IS1A 1TF7A 4KITB 3AVQA 4DBLC 4LX0A 2PT5A 1LS6A 1W4CA 4DRZA 4RCZA 1G8HA 2AL7A 5EE0A 4GL2A 4FMDB 4UKDA 4B75A 2CCKA 3D6TB 3A58B 2W6JD 3K9LA 5G3ZA 1AA9A 3O8DA 3RC3A 2XOKA 3FTQA 4JLJA 1KI9A 3KY9A 2HDNB 2QL6A 4I4LA 4FN5A 2ZRHA 2IYTA 5KNDA 3SJCA 3LBHA 1AKYA 2W2XA 4JYCA 3FMFA 5L3SA 3QSYA 1X8KA 1OV4A 3MD0A 3TSZA 2C8VA 4DVGA 2IF0A 4DCSA 4ARZA 3EPLA 1P72A 4OHXA 1JB1A 1EFUA 2XB2A 4IOKA 3SJZA 5IHPA 1ZW6A 3AQ4A 3DM5A 3TSWA 2J0UB 3IPYA 4CF7A 3KQLA 4IVQA 4MYHA 2WSMA 1VDZA 4UJ5A 3EZ7A 3VHLB 1G3UA 3X1YA 4LOAA 3GLIB 4MKFA 2ONKA 4LRWA 1MKYA 3J81k 4C7OA 2ORWA 4Q4HA 1OB2A 4BUJA 4DXAA 3FPAA 4EPTA 5GVRA 4C3ZA 4DDTA 1D2EA 3CF0A 3THOA 1U99A 4Q1AA 2ZYWX 2PX0A 2FU5C 1Z6YA 1XMJA 3RSOA 1KO8A 2HLDA 1OIWA 1UEJA 2QRNA 3EG5A 1XEXB 1AK2A 1NY5A 3AB3A 3CB4A 3HJNA 1CRQA 1UBFA 4JT2A 4NMMA 5ELXA 2Z4SA 4QM6A 1OIXA 4AYWA 4P0TA 1NKSA 2R62A 4OI0A 4HLUC 5HR5A 1T8UA 4FWTA 3ZH9B 1E9AA 3RC8A 2CDNA 2OT3B 4UNSA 2V6JA 4QJ4A 1NN5A 5D3QA 5ANRB 2GZAA 2WIBA 2P6NA 3GFTA 3S1AA 4HAYA 1PZNA 4DB2A 3GFPA 2CVFA 2ZROA 5E3HA 2ZSBA 5EP4A 4LV6A 3VU9B 2VHUA 2J0SA 1E2DA 2NO1A 4BLTA 3G0HA 4FW9A 1G17A 1GDDA 2EWVA 3T15A 4ZDKA 1NN3A 2J0QA 4LY6A 4YLGA 4TYYA 1HH4A 3GMTA 5DGXA 3AVUA 3KJIA 4C0AC 2O8EB 5AWFC 5HTKA 4XSGA 2WWYA 1GZSA 5CLQA 4DJTA 4TZ6A 2ZS9A 4KSBA 4BLSA 3P4XA 1OXTA 4GPTA 3OZXA 5FOSA 5DI3B 1VG9B 4IFBA 3RAPR 1N6LA 4HLQB 2JATA 3AF3A 4MRNA 5EXXA 1WBBA 4DZZA 1RRGA 1RYHA 3KDSE 4Q9KA 1S2MA 2D7DA 2JA1A 1HE1C 1BO6A 2DWPA 2GEUA 4WZ6A 4TL8A 1OH5A 2V1UA 2N1BA 5FOUA 3ASYA 4P31A 4YMUA 1E99A 2PMDA 4C30A 1OPXA 2H8KA 1NVUQ 1U8ZA 1WCV1 3PUWA 1KK1A 4RY2A 4BRWA 3I5YA 2XJ4A 1W0JA 5K8LA 1Z28A 1GVNB 4CRWB 4Q4LA 1DS6A 4V0KA 3U3MA 1KOFA 3W9YA 5LDDC 4AY2A 5CITA 1W48A 4IEIA 4FCWA 4D25A 5A0FA 5JI3E 1XA6A 1OFUX 1RFLA 2C2HA 2GF0A 4Q7LA 2FSIA 1TL7C 2A5DA 3NEJA 4M9XA 2F6RA 2O0JA 2XZPA 2ZJOA 5KUTA 4WIAA 2HJVA 3G5UA 3PITA 2IEYA 5J47A 2B8WA 2YWFA 2W2TA 2Z5FA 5C18A 4Q7JB 3LY5A 2ELIA 4PQRA 4R2IA 1MO3A 4PHHA 3A6PC 3THXA 3U4QB 1RKBA 2F1JA 3CX8A 3OHMA 4C0SA 1BYUA 3Q3JB 5FOXA 4Q9LA 2QORA 1NJFA 4TQAA 1KK2A 3CNLA 5F9FA 3K0EA 5TARA 3QXXA 1N6HA 4RZ2A 4DT1A 2V7QD 3QY0A 4A0FA 4A82A 1E2FA 2GESA 3L0SA 2RMKA 3L43A 3ND9A 1M7BA 3LD9A 3HYRA 1Z2CA 1T9HA 3CH4B 1EFCA 4URUR 1X3SA 4N0EA 2ZYVX 5AUQA 2KBEA 2OV2A 3ADCA 1R0XA 4LUCA 1YZKA 2YHSA 4NYMR 4Q9JA 3A36A 3H0KA 4IVPA 5GADl 4RSGA 2BMFA 1QHHA 4JLDA 2O8BB 5DHAA 1TPZA 3K0CA 3W8NA 3U3RA 3TH5A 2CCJA 3KKOA 4NH0A 1VIAA 4GMDA 5BQ5A 3QQ5A 1NVXQ 5DI9A 2Q3HA 3SYNA 2GETA 1IJEA 1XXHA 2I1QA 4LHZA 4MYCA 3ZZUA 1VYTA 1U90A 4L9WA 2TMKA 3BH0A 2FJUA 1IOZA 4IEEA 5JCZA 3WNDA 4C0QC 1II8B 1IY1A 4V0NA 2HV8A 2H17A 3VHXA 2GWHA 4DHEA 3X1XA 2JDID 3NHBA 5JCPA 4HZUA 1MOZA 4IOJA 3M4YA 2ATXA 3TNFA 1US8A 3K0AB 2NMVA 1ZNZA 4BFTA 2FDCA 1Z6XA 2VP4A 4HB2A 1T5IA 5FTKA 3HU2A 3AM1A 2ZR9A 3GJ7A 2V1XA 3AKDA 4OJKA 1GL9B 3IBYA 3I92A 2O8FA 1KI2A 1DAIA 2A3RA 4TLEA 3I3SR 2YC2C 3KB1A 1OF1A 5FBWB 4K8OA 2VRWA 2WZQA 3SBDA 1ZM9A 1HA3A 1ZNXA 3C4JA 3KTAA 3WY9A 5JWOA 4OHWA 4DLZA 5CYOA 2HCJB 1KDPA 4MGKR 2SHKA 4GSYA 4BFZA 2IT1A 1Z29A 3WNCA 1CEEA 2PL3A 1NSTA 2QMUA 3DOEA 4B3CA 4D0NA 1E0AA 2IK8A 5KNBA 4B33A 1GTVA 5L3RA 3QKTA 4E07A 3NHAA 5AJWA 1QHYA 4URXR 1S1MA 2QE7A 3ZVRA 1IN4A 2OBMA 3NBXX 2YOGA 3W5IA 4F38A 5KSOA 1GKYA 3EIQA 1KI6A 4XWKA 1AS0A 4US1R 1G8PA 4B73A 4NPHA 4QHYA 3CM0A 2ODBA 5E7MA 3Q5EA 5M04A 4OHZA 2GRJA 3C41J 5EZ6B 2A5FA 4A8JA 1T3HA 5EQTA 4CEJB 4QG7A 1KK0A 4DCTA 4ZDIA 1G6HA 4MYTA 2GCNA 1ZUIA 3IEUA 3OEED 3REFA 3QVVA 2R6AA 2ONJA 4HLDA 2V8OA 1DE0A 1J8MF 1JAHA 4KFSA 5C1BA 2AXPA 4FXPA 2CLDX 1KI1A 4G0NA 2J45A 1XD2A 3TE6A 3N2EA 3D31A 1IXRC 4NL4H 4BZXA 5DN6A 1C1YA 3O8CA 2IYXA 4BRUA 2QTHA 2VBCA 2A5YB 4BWYA 1GIAA 3CLVA 5FPSA 1RIFA 2XSZA 4NYIQ 3FMOB 1ESMA 4D81A 2O8DA 1JEDA 1NSFA 3R9WA 4DSUA 2GJ8A 1JI0A 1NIJA 2OFWA 1TQ2A 2IYQA 4I1VA 1OH8A 1UDWA 1XTQA 1R0YA 4TSFA 2PX3A 1CJTC 2WJJA 3MLEA 3PFIA 4PQYA 4ZPXA 2ZRAA 2CL0X 2JLUA 2CJWB 4QJ5A 4DC9A 2IS2A 3PUYA 3BFVA 5E7IA 4NBSA 2RH5A 4EQ6B 2PCLA 1COWA 2VYFA 4M1MA 1VECA 1D8TA 5H70A 4Q4JB 2EWWA 3QKRA 2ERYA 3GJ5A 2QAGC 2PJZA 3AVOA 1KYIA 2P5TB 1V5WA 2ZSDA 1AZSC
chains in the Genus database with same CATH superfamily
3N5KA 2OA0A 1BGXT 1B43A 4AJ4A 5IH7A 3PE4A 4WLOA 3UK0A 4FX5A 1B8VA 1XDGA 3ITKA 4NE2A 4TKVA 2VCYA 2FN7A 3W1EA 3N8DA 4MHOA 3EY9A 1YJBA 4V2UA 4MUHA 5I01A 1GPBA 2OHHA 3T1TA 2RHRA 1GY8A 1ZA2A 2H3EA 4ZDWA 1U3VA 2DQ4A 4XB6B 4ZHQB 1DEAA 1GCUA 1E2IA 1PLJA 4E03A 3T06B 5JUWA 3TOAA 2X9LA 4FM9A 2BUSA 1AXGA 2BEVB 3EFBA 4DJFC 1YJQA 2ALJA 2BFBB 4KJXA 5B30A 2QUAA 1YE8A 4F9FA 4O4LA 1W2GA 2P2LA 3Q40A 2OFXA 1L7MA 4AW9A 3LQRA 4ZEOA 5BSVA 5ISMA 2PMKA 2ECPA 1AN0A 2TSYB 5ECWA 1M73E 2HLDD 1QYDA 4GOOD 3CUTA 1UMKA 2J7PA 1ODFA 2VTEA 4KGDA 1DVRA 3OG9A 3JATB 4RY9A 5I6DA 4HNQA 4HPXB 2ACEA 4TYNA 4REQB 1Z37A 4RJJA 2O7NA 1RLIA 1GQYA 2V03A 4QATA 1VIYA 3UH1A 5LLDA 2ZM5A 4W5WA 3DAGA 4KIWA 4EF6A 4DQUA 4KC0A 1HETA 4GECA 4UPEA 1TXGA 2HU5A 3A4MA 4O4IB 4OSEA 2WWIA 4LYHA 1EE9A 4WXMA 2GXUA 3D81A 2GAJA 3DJYA 5FWNA 3FDZB 1LEHA 1W0KA 4ZGGA 1JPJA 4MGIR 3G5LA 5JAUA 3H1PA 4ZRMA 3T5AA 4AXBA 3ZE0B 3ZJVA 1K6EA 4NG4A 2QRLA 1YQDA 3KAKA 4BY9E 4QVGA 1IY6A 1ZJJA 4TV9F 1GSHA 3VO2A 2YH2A 4HAWA 4BV3A 1WTCA 1P1FA 2BHNA 2JCVA 5KTYA 4YCMA 5HM8A 3AJ9A 5F1PA 5JC8A 3VDXA 1AUXA 3IDFA 2C77A 1PJBA 2ZUWA 4JBYA 2QAIA 2NO6A 1TLTA 2GVDC 4IJ5A 2I7DA 3QELA 3B6IA 4EUHA 1ZD1A 3IEKA 3RTCA 5JFOA 4O33A 4LMAA 1U11A 1M0TA 5SZHB 4QWMA 3PUHA 1S8OA 5CU7A 1S7GA 4F7DA 1H22A 1WP4A 3DDOA 4QEDA 2VNKA 1OX4A 3BGWA 2C2KA 1ISPA 2R8EA 3ZE6A 5HOQA 2VQEB 2YIMA 4AN0A 5E6RB 4YYZA 4KIUA 4D4KA 3S2ZA 3WLOA 1N6IA 3JYQA 2VP6A 1SBTA 3CNOA 3PEEA 1T6YA 4TN5A 3UMFA 5AVVA 2RHTA 4F0JA 5KU1A 4IDBA 3E1KA 3VJLA 3ROMA 2IC5A 3HO6A 1HUQA 1X7WB 4LSZA 5G2OA 1D9ZA 1UMDB 3R8FA 4NJEA 3P1JA 4WJZA 2EW2A 1XNRB 1CUGA 3LHKA 3B1KA 4XCVA 1ZK1A 4R16A 3TAXA 1C1XB 2CFSA 3H9EO 2GF9A 3U31A 3IOEA 5DX8A 3ZWPA 2HSGA 4HGZA 2BE7A 2FSGA 3I4LA 4C6SA 2PQ2A 4Y6RA 5A1TA 4MRPA 1H6DA 2P3SA 2R2AA 3OLVA 2BFEA 4WLFA 1LSOA 3L6CA 1M33A 5DN9A 3OKCA 5J4HA 1A98A 2X8JA 3OZGA 3PFFA 4UMDA 2ZYUX 4KIFA 1Z2IA 3PLNA 3IP3A 4ZZIA 2VUIB 3K31A 2V7WA 4QUKA 2G8NA 1QTRA 3QLTA 4G26A 1E0JA 3PXAA 4JB3A 4MW4A 3PQFA 1IBRA 3GPCA 4JLVA 4JR0A 1RC8A 1GYPA 3W1WA 5ALGA 4PXAA 4ID3A 5DTIA 4KR9A 5EHXA 4V0LA 1E5VA 2VDRB 4MPIA 4FSXA 3U1VA 5FI1B 1ZN9A 2FW6A 2ID4A 1NX6A 1JHQA 3H2BA 4QULA 5F12A 4FGLA 4KRXA 4LVCA 3E03A 1Q1ZA 2X0RA 4JODA 3DEJA 1DOHA 3LP5A 4OBBA 2A58A 5L3ZA 4FDTA 4E2FA 1YTPA 2O3UA 3D8HA 3JAWB 1VCOA 3EVBA 2C9OA 4MMYB 4CN9A 3V8NA 1SGPI 2B6HA 3T6KA 2BFNA 2JFUA 3I9NA 4C89A 4OJTA 1QO9A 3P5BA 4WERA 4QGSA 3SZMA 3E59A 1Q1QA 1PJTA 2WYIA 1EP9A 1H2HA 1JIQA 2ZOSA 1XB2A 3BERA 2V9CA 4HK4A 2KMPA 4EARA 3G8YA 5LJIA 2ZZNA 3NT2A 1F4LA 2CEKA 2YWXA 3L40A 3W78A 1H2EA 1RR6A 4H0NA 4BNLA 1AZWA 1XTTA 1K7CA 4I50B 1DX9A 7MDHA 3EC7A 3HVUA 1FRNA 1G60A 4Z99A 5ICCA 1VA4A 3F9CA 1HM5A 1C3JA 2WQ7A 5DCYA 1NDQA 1BX1A 2WG2A 3R24A 4MJLA 2CFTA 5H7XA 4PAGA 4JEHA 4FYPA 5EN4A 5EQDA 3SS7X 5GJVC 3ZD9A 2YCBA 1EFVB 1U7WA 1J2YA 1SK8A 3DMHA 3UJHA 3VV2A 4R71A 1QYXA 2BT4A 2XVMA 5FX2A 4HAUA 2O1EA 3PDUA 3REQA 4QKQA 1JALA 3SKVA 2E1RA 1CUCA 1K5DA 5A04A 3M7IA 4ND1A 2CXNA 4UZEA 4YP1A 1UMBB 5FFFA 5T3YA 3WLJA 3TYXA 4K87A 2ADOA 5ALPA 5SY4A 3EPHA 1LH0A 2VT7A 2ZSFA 5F2KA 2IHKA 4UBNA 5LPNA 2GJAA 3GT0A 3JQEA 3LWNA 4F72A 5IEBA 4AMBA 4RMHA 2ZRNA 1V8DA 3HUTA 5IXSA 1ZIYA 3D7KA 3UGDA 3BQMB 4P9NA 1ICIA 4PEVA 3ZE9A 5A3QA 1APBA 4HWPA 3K8ZA 4TGLA 5JHGB 1K68A 3ICVA 3QVUA 2PXCA 1NN1A 4CKCB 3FFXA 1F17A 3TVTA 3M34A 3WSVA 4GYJA 1Y3DE 4DA8A 5ED4A 3CZ4A 2A1UA 3EE6A 3T4UA 3R3UA 5AVUA 4JHLA 2REOA 5KTTA 3AM4A 1DDGA 4EY8A 5AICA 1DBQA 2YDXA 2APJA 3AUXA 4MV8A 3STXA 1II0A 4MI3A 3V4VB 1PFVA 2P9JA 4L57A 2DBYA 5FDFA 2YHBA 2J5KA 1ZCZA 3FVVA 3WL4A 2BGGA 3NC1C 4BNDA 1TIKA 1NMEA 4PFSA 4EA7A 5BSTA 2QX4A 2AK3A 1PFWA 2AB0A 3CLSD 3K92A 4YS6A 1YACA 5J2UF 4KRFA 1Z4KA 2EHDA 4MPRA 1CULC 3D0KA 4G8CA 2WU8A 1DXOA 3SJ7A 1B23P 3SGLA 4Z7QB 1L8LA 3AYZB 4G67A 1PJUA 3DOHA 5KQLA 5BYKA 4OLJA 2YWCA 4K40A 3HYLA 2JFPA 3LBIA 4LDAA 4JGGA 4AMGA 2JIRA 1LQUA 2Q3JA 4AY4A 4ZZ1A 2VTBA 4HVAA 3ZXSA 3UK7A 1FDRA 1M2KA 2OO7A 3LP8A 1UKAA 2EQAA 3I1JA 1KNXA 2BMVA 4G0UA 4QDUA 2XUQA 2LKCA 4DXDA 2H92A 4AJKA 1GKIA 2IDJA 2IXAA 3WGMA 5DN6D 3E9CA 3GVHA 4ENWA 3SDZA 1Q83A 3B53X 4XWGA 4QTZA 4CM9D 3X2SA 1PVOA 1KHTA 5ITZA 1RXYA 1ID1A 5CGQB 2QJTA 3SM3A 1EGMB 4E30A 1XKLA 1PFKA 1VG1A 2EJWA 2K2WA 2WAMA 3IXLA 1UR5A 2QG6A 1M6WA 3BIFA 3CKLA 5FBLB 4ZVRA 2NYAA 1YOVA 2TMGA 2AOWA 3IQXA 2HSEA 2NOAA 1SHKA 3N75A 1QE3A 3OZVA 1AM4D 3BVPA 3H9CA 5TVGA 1FYEA 1RAEA 1TQ8A 4G5SA 1Z75A 1QUEA 4NCIA 3TLAA 5JEEA 1IHPA 3CSDA 2OHOA 3L8ZA 3C87A 1EVEA 1GOTA 3OZAA 3WAGA 5K3OA 1N8KA 2DQSA 3GEPA 5BSWA 3GARA 4PVDA 3SHOA 2QLLA 1RM5A 4KXNA 5G1NA 4ZQIA 2CLLB 3E5RA 4FWBA 2ON6A 5K0CA 3OM1A 3B13B 1JHUA 4LOLA 4B09A 2JW6A 1NUAA 1IM2A 5AD1A 3IEXA 1SZPA 1EK6A 3PFGA 4FFLA 4Q47A 5DBOA 3AFIA 4R0VA 3FLBA 1U9IA 4V3BA 1R0RI 1OBVA 4BCDA 3GJQA 4NARA 4QM7A 3F3YA 2V0NA 4PYLA 1ORDA 1QYRA 3ESBA 3D7LA 3B6ZA 1N5LA 3MFYA 4IYRA 1D5WA 1P81A 4LISA 1KKMA 4RTSA 4L9AA 4YRSA 3JAMA 4A10A 3UGLA 1EBUA 4MO2A 3E7FA 1S3GA 3QJYA 5F5XA 4Z2YA 3HB7A 1AX9A 1W52X 3IP6A 4QU9A 4BECA 2PKWA 4MPTA 4Z3OA 4IJMA 1Y6GA 3QMVA 1CCWA 2ZANA 4MQBA 4WZAA 3TNJA 4Z7NB 2C7RA 1N78A 4EBFA 3CE9A 3ETEA 3QYFA 4GUAA 1J4AA 1E94E 3RYCA 4OBWA 4OX9Y 3EAGA 4RTLA 3HPQA 4GWGA 4RMGA 1C9MA 3HCPA 3IERA 1AZLA 3LZDA 4M7WA 1FJGB 3CLUC 4IXTA 2WM8A 1Z83A 2D62A 4RKYA 4QHSA 2P11A 4DSOA 1RYNA 3FSYA 3GW8A 5HK9A 4NKRA 1JQ5A 2NYVA 5FP0A 1MJAA 2Q6KA 1U3DA 4JLAA 3AFOA 1EINA 5F98A 1ZS9A 1WUYA 1ZEJA 2FRDA 3VTFA 2VPTA 5IM5A 3L6OO 5ALNA 1AUOA 5I7FA 2X4GA 2PT7A 4ZT4A 2Q9UA 5SZJA 3ICEA 2ZE8A 1L5VA 1T2EA 2X9QA 4BZWA 1NP7A 2VDPB 1YKSA 3EGIA 3PZBA 4M9RA 3S2SA 3KWLA 3ZOKA 2HW8A 1FSGA 3KLPX 3TR6A 2RC4A 3WWZA 3A2KA 4O2AB 4PYRA 2BM9A 3QK7A 1LNSA 3CR3C 3F7OA 4LMBA 1UXJA 3BXGA 4O6VA 1JJIA 4QUHA 4N5MA 4EG0A 3PFHA 2DY0A 2WJPA 1LRKA 2VAPA 2XB9A 3FWYA 5JS1A 1E1KA 3C43A 4ZT2A 2XEDA 4HVLA 1XSEA 1FNNA 3QI2A 4Y0VA 3OT5A 4DR7B 2W2LA 4WLUA 2ZU0C 5T57A 4AZ0A 3RAEC 3ZHYA 1CY7A 3TXYA 4NFSA 1NUSA 2ODPA 1M9NA 1X7ZA 4AURA 1VPLA 3NASA 3KL4A 3MGCA 3RBVA 3D7SA 2GDJA 4INOA 4YXWA 3GH3A 3ZEAA 2W9XA 2XDQB 4UW9A 3JRWA 3QBVA 3W77A 4ITRC 4KV9A 3AVXA 2O8BA 1ZRSA 3RVPA 4D9NA 2V7PA 4Q9DA 4C2TA 5DTRA 4DFDA 2QMEA 1EUQA 2EU8A 5I7VA 1KOLA 4B3DA 3N2GB 2K2QB 3X1ZA 1XRPA 1Z17A 1J07A 3FR7A 5FI5A 2QTBA 3R44A 5KPJA 4DA4A 4HTFA 5DNUA 3QRWA 1PLLA 2NU9B 1MIHA 1Z2PX 4A27A 3O95A 1NFQA 2FFRA 3AGPA 3G2MA 1JDBB 3GVIA 3KQWA 4FGSA 2VKTA 3HJGA 4F45A 2C07A 2RSLA 3QX7A 1Q50A 3TUZC 1HT0A 1BMFA 1P6XA 4EVQA 4FEGA 1RM4A 2C42A 2P5UA 4YAWA 4HDSA 3ZV3A 4DC1A 4UBOA 4ND5A 2QRZA 1QRAA 2F9MA 2P9ZA 2P62A 1ZAYA 1AZTA 4HS4A 2YJTD 4KSYA 4O0MA 3STTA 4CGYA 1PG0A 5BW5A 1BDHA 4ARIA 3AEXA 3LX8A 4BLWA 4EZBA 3ONFA 2OXTA 3FOBA 1ZMXA 3L41A 3RUAA 4C7JA 4RFVA 2OVOA 2NU2I 3SQLA 2VTVA 1GG8A 2PL5A 4WBXC 5FBRB 2EWMA 3IEVA 4PGMA 4XUDA 5DVZA 1TBNA 1ILEA 3PT9A 2AUNA 2XMDA 1Q92A 1CGII 2NUPB 3PGLA 1SMKA 5KVAA 5EIEA 5I7WA 4AT1A 2X19A 3P9SA 4P0PB 4YGXB 2A0FA 3KTDA 1BEEA 1AK9A 1W8IA 3S4YA 5JC1A 1HDEA 4XIGS 4D3FA 1E3SA 2BBWA 1XYYA 2QHXA 1WOYA 3DVLA 3ET4A 5BR8B 2W7TA 1SBHA 2I3ZA 2MJLA 5ETJA 2CT8A 3TOZA 4QYSA 2DBQA 2DETA 1HE3A 1I01A 4DA0A 5EWLA 1H42A 3NUGA 4LGMA 1KXJA 4EX6A 1K4KA 2QMZA 3QH4A 2O20A 3MJDA 1YR2A 4LXXA 2CE2X 4QQ8A 3R9XA 4B3GA 1Z7KB 3UC5A 4EGSA 4QDJA 4WOCA 4AQYB 4FZVA 5AK6A 1SC4A 2DHDA 4EUSA 1FEZA 4FR2A 3HU1A 5CA0A 1ZINA 2AD5A 1KS9A 3FPLA 1RLTA 4A8JC 4BHTA 1QKIA 4JXXA 5MGBA 3RGWS 1QC5A 3LO8A 1XV5A 1Z5OA 3H86A 5HDQA 1TPYA 3DD5A 2D6FA 4OJMX 3ILHA 1AURA 1RFHA 3GGGA 3CJTA 4FYVA 5EXTA 2B20A 2D1FA 4JLPA 2CMDA 5F9HA 4C3OB 4W5NA 3KYBA 4UTOA 5EZYF 3E1GA 1ZRMA 1PGOA 4DV6B 1U98A 3LUPA 5CCEA 1VPDA 1DTWA 3KWFA 1RWWA 4IIDA 4KRYA 1CE8B 5K0TA 2H2WA 3VYUB 1TM2A 2P9GA 2WUWE 4LJLA 1JT2A 5A62A 1JEYB 4FB4A 1IBLB 1EK1A 4PPNA 1C2TA 1PL8A 3MWJA 3OE7A 1PAUA 2GKSA 2AA3A 2N1MA 2R7MA 2OHIA 4GAEA 4FS3A 5DNDA 1VCNA 1NI3A 2C3YA 2OK7A 2Z4RA 4JD5A 4QDXA 1EHCA 4XUCA 5CG2A 4DG5A 5M29A 1SGYI 5HILA 4BNWA 2IE0A 1IAQA 4MW9A 4H7KA 4BO3A 5HQTA 1JVNA 2XX3A 4C76A 1Y9AA 2A5GA 2X77A 3EARA 5C1DA 4PG4A 3LOPA 2H2GA 3MLAA 4K9SA 2AHRA 4FCCA 1EM6A 1YJXA 2AXQA 2FXIA 3DFFA 3DKPA 1U2DC 1LV8A 2CD9A 3DE7X 3CEAA 3LGAA 4NFLA 1U2PA 4UCXA 4L8LA 4I66A 1FNCA 5BQXA 1KC3A 1W85B 1YVDA 3H5IA 5DF1A 3HHEA 2R7KA 3BS4A 3E70C 1KYXA 3EZLA 1CY4A 1YJ8A 4JKOA 4TYMA 1IPHA 4YJGA 4XQ9A 4AKIA 1Z68A 2JB9A 2R9VA 5DTQA 3MZ0A 3WVNA 4AI6A 4N0QA 1LLCA 3AF0A 1E3WB 1LTHR 1S20A 2ZULA 3CPSA 5KKNB 3IO3A 3KPJA 1GZ6A 3C8DA 4DV2B 2XWJI 2V7TA 3KB8A 2PZEA 2IHYA 3D3KA 4B80A 5I3CA 1YQQA 3E7XA 3HY4A 4ERNA 2AFHE 2J31A 4HNAA 5J5CA 1JW9B 2A9QA 3NANA 4KV7A 3DHWC 1XZEA 2WUGA 3VPHA 3IAXA 5DIFA 1D6MA 1RI1A 3TIGA 4DPKA 5AUNB 2UXBB 4K6CA 1MCZA 3NGXA 3UT5A 5BN3B 3NTXA 2FOLA 3E18A 5EIHA 1U28C 1KI3A 3ZDFA 1D0SA 2Z3WA 4TVBA 4BWVA 5K6AA 1JWLA 1IJKA 2Q45A 2W2VA 2Q3DA 3B5JA 4ZYTA 1ZR4A 1J22A 3NTVA 2JCGA 1B26A 4TWAA 3T3DA 4CR6A 5K05A 1HORA 3IRVA 1U0RA 3A26A 1Q0TA 4E2WA 1SPXA 2ASVA 4R4JA 1HYEA 1DBVO 1KO5A 3BMQB 1O96B 1DKPA 4RA6A 5KX5F 5JZSA 2B2NA 3TW0A 4ZOLB 1JLMA 3SCZA 2OCIA 4JXZA 4MYSA 3MJTA 1OFUA 4OQYA 5E2BA 4CEIB 4ZO7A 4CCYA 3OLCX 1V37A 1ZOIA 3K9HA 5H4HA 3HJFA 4KQIA 2QROA 1EUDB 3GLTA 4E13A 1GGHA 1ZMTA 2FVXA 3DO5A 2CD7A 1P0QA 1IAVA 1KP2A 2FR1A 4ZRNA 3ZXXA 1CDEA 4Y1RA 4YT8A 3L18A 1SR8A 2REBA 1CY8A 2I66A 3DOIA 2NXWA 1ORHA 3L7CA 4M38A 3ENWA 5C8YB 2YNMA 3AIMA 1BJKA 2V7XA 2WEKA 2XWQA 3AVWA 5CEJA 3U9SA 1HT2E 3D6FA 5BWOA 2CV0A 3UEYA 5ES4B 3ZNOA 1CVIA 1Z7WA 4EKDA 1E2MA 3SKXA 2A92A 3ZDXB 1NVEA 4CKEB 4DIUA 5K3FB 3WGKA 2VC2B 3FMPB 4MTLA 2QTFA 3NLLA 2HF9A 2E18A 1XCMA 1EX7A 2HDWA 1YH3A 1XVUA 3T5CA 1SA0B 2RGNC 3FSGA 1AUQA 4MKXA 1UK8A 2DKFA 5KAPA 3OQVA 3Q8XB 1PK7A 2YRXA 1HTWA 1SKYB 4G65A 4X6LA 4MR7A 1QFYA 3VZRA 5LB2A 1N5JA 2IITA 2IKQA 3H9UA 4DJJA 2IP2A 2QP3A 3SYMA 1EWTA 2WHYA 2Y99A 4PNHA 2DHRA 1BE1A 1YFZA 1FXUA 2PFKA 4DY6A 3GLFB 2QU7A 1OXVA 3FUUA 5EJ5A 4II3A 1NVAA 3DL2A 2D5AA 1R7RA 1E5TA 2H1HA 2OZLA 1RPZA 2X6RA 1LX6A 3AETA 3E3NA 3NP9A 1ONBA 3BMOB 1D2GA 1UZAA 5TPZD 4BMPB 3H1TA 1GGEA 1O03A 2VRCA 3ED1A 2AJLI 2R65A 5ALKA 5LA6F 4UNRA 1J97A 2JIPA 3CUVA 1PEDA 3ELBA 1IG0A 1VIDA 5E3RA 1SVOA 2VIIA 1I13A 5KC9A 3V8MA 2JJ1D 3NVKI 2IV2X 4BTVA 2R4QA 4M99A 1JQEA 2BLLA 4A26A 3RYHB 4IDQA 5KOJB 3C1UA 3DDHA 1TVEA 3K4PA 4D4GA 1RVDA 1TX4B 1KIMA 5IK2D 4ABTA 4TYPA 3P71T 1ONNA 3V1LA 1I2CA 2JHFA 2ZUTA 3G5MA 4WZBA 1FARA 3HYTA 4F3TA 3ADPA 3QY9A 2OMEA 4DIMA 3DLPX 4PRLA 4Y2VA 4E5KA 1P60A 3PF9A 3OZSA 5AKEA 3S5JA 3EGVA 3VQTA 5BVGB 1U3WA 1AV7A 1EA5A 2P6PA 1P2FA 4EJSC 2ZSJA 1K5PA 1JHAA 4REMA 1DEHA 1WVMA 1K2VN 1KYTA 1XZHA 4HEJA 4U0JA 5C37A 2B1RA 1TBQR 4RKWA 1P44A 3D8SA 1O0BA 1U3CA 3HCWA 5DHQA 4DGSA 4QGAA 5A9SA 3PR1A 3VMMA 3F96A 1LFAA 3LX4A 4W9RA 3SC4A 3C14C 3SHFA 4ZU6X 3IAUA 3NFYA 4BVBA 4NHOA 1QRSA 1P2TA 3PYXA 1PTQA 4H3HB 2Y6VA 3SQOA 4C2BA 3FWNA 1RHUA 1XVTA 4J1TC 1BQ3A 3CSUA 4HSGA 1EVIA 1Y33E 2W6JA 3RVJA 4G0WA 3E27A 5K1ZA 2Q21A 3BWXA 3JTMA 1DQRA 5AQ1A 5IBRA 2VZ0A 2F1IA 3HKDA 1W34A 3NHWA 4M0KA 5LOVF 2G5TA 3PJGA 2ZUCA 3L7OA 2C2BA 4I08A 3WAKA 1PS9A 2V98A 1X1SA 4RV4A 4JUFA 4OQ4A 1XE3A 2JZMA 1QONA 1UXKA 2QTGA 2ZYDA 3W3AA 2QY9A 2C2MA 2R68A 3DL4A 3ABZA 3U3DA 3U62A 1VCHA 2YN0A 5CCLA 1NU6A 1I4TD 3AP3A 3QEMA 2ZTMA 5HQ3B 4NAHA 2GA8A 1FTSA 1Z4JA 3OFVA 3DOJA 3ZZNA 4MS4A 2FW0A 1Y9JA 1Y4ZA 1R3DA 4DMHA 3THYB 3C3JA 5HIAA 3QIAA 2HHJA 3L4BC 2Q6VA 3FPSA 5JSYA 2WWHA 5LJLA 3K1ZA 4TZKA 1BSVA 4D44A 3C3MA 1IJFA 5A3SA 4E11A 4D26A 3ABOB 4JQSA 2PEYA 3AV0B 4TKLA 5G4KA 1KR2A 4MPDA 4FOLA 4U9HS 4EAAA 4R1SA 1I5RA 1CNMA 1CFZA 2MSKA 1KNQA 1IZZA 3CZRA 4GG1A 4XH9B 2UUCB 2OTCA 4HAIA 3L93A 5TT0A 2XD4A 5ITSA 1PN3A 3OWHA 2BKXA 1BWQA 4CE6A 2IYVA 5BXYA 2N42A 3GY0A 1YWGO 3K4QA 2Z1MA 3E48A 5T7BA 1C7ZA 1QTIA 4UCFA 3PX7A 4Q82A 4RD6A 1SCDA 2V45A 4MH0R 1YL5A 1XZDA 4CM4B 1JDUA 4YFYA 5U9CA 2ZWMA 4KVAA 4ZD6A 2HT6A 2UVPA 4K1XA 4AJ9A 4S12A 3THRA 4KQEA 4EJ2A 1Y8CA 3T5BA 2PBZA 3UPDA 3AESA 3A70A 4OHFA 4L8WB 1I6MA 5AOAA 5LQSA 3WQHA 4C0BA 2ET6A 3UJ7A 4E31A 5KWSA 3FFWA 5DNEA 4LI0A 3KETA 3GLGE 5JJKA 5FBQB 4MI1A 1Q7GA 1OFVA 2R6R1 2P2GA 4LJ9A 4MTCA 4C0WA 4D9GA 4Z9YA 1Z8HA 3AHGA 5JARA 3ZLVA 3KXLA 2OC9A 5MGNA 3EJ6A 3AF1A 4HNSA 4GMXA 3KKQA 3E3LA 3EPKA 4J4BA 2C20A 3WLFA 1CT4I 1XIVA 5TEWA 5TY0A 2F55A 4GPD1 4IKEA 3HFJA 4FMCF 1HY3A 3IXQA 3ZK7A 1O95A 3GT4A 3WBJA 3I9MA 2XRZA 4EA9A 3F71A 2VDJA 4YMGA 4BJ5A 3IMGA 3PCTA 4U7GA 2C97A 4TWJA 5JPCA 4QO8A 3LUCA 5F21A 3ELYA 3NNDA 2RGDA 3TB4A 3MA0A 5IG2A 2EP5A 1E0KA 5AJTA 1J8VA 2UKDA 3A1SA 2B82A 5D6OA 4MR8B 3WGJA 2W4MA 1TD9A 3QVGB 4YQEA 3U80A 3F5QA 2Q6IA 3RNLA 1N2CB 2YX1A 4BVLA 1FP4B 1LZKA 2GK7A 5D87A 2XDAA 4YRJA 4KAFA 3Q6MA 4A92A 4RPHA 4GYYA 4C5AA 2O23A 1T8YA 2ZDHA 4K88A 1F1BA 1TZCA 1L4FA 5T64A 4Z9FA 4E6PA 3O0TA 5AW5A 3ZPXA 2EX1A 4AJNA 4X97A 5CIWA 4R3UC 5E3JA 3LC2O 2BJVA 2VP3A 4EO7A 3I39X 1I7LA 4Y0NA 1GRRA 3ETCA 5FO0A 4TTQA 4XDYA 3DNPA 4Q9HA 2H4ZA 2DHEA 2I99A 5KDOA 3WL8A 4YJHA 2P35A 1A88A 2FKNA 1BDBA 1E5XA 1SCUA 2PJUA 3KIPA 3ZNQA 1IZ8A 4MGZR 3Q85A 2OV1A 4OCZA 2YWDA 4WA8A 1JPUA 5E4JA 1HQDA 2AW3A 4YGYA 2YZNA 3A31A 1Q0SA 3L8EA 3RU3A 5BW4A 4JI5B 5ERXA 3VO8A 3ZD6A 4B7CA 1XBTA 5AVOA 2FZKA 3GJ8A 3KRTA 1JQJC 3OOHA 4HZGA 4YMTA 5J23A 5ADVA 1E3TA 5TMEA 1UPUA 2XUFA 4D3XA 2ZPTX 3F5DA 2CXQA 1TMKA 3DE4X 1GU7A 3NTRA 3RIXA 1T5HX 1YVPA 1JHYA 3SC3A 1K88A 3PC3A 1KFBB 3AKZA 3K15A 1J9ZA 1OBHA 1UK9A 1RBZA 1AIPA 2NM0A 4U4AA 4PM4A 4EG8A 4KXVA 2FEPA 1HQKA 2CK3D 4NESA 4TSRA 4DF3A 2VSXA 2P6AC 3SXJA 2XNSA 4A0RA 3Q7PA 1RWPA 4FLEA 2NUAB 2X2PA 3ZGOA 5HZKA 1ZMBA 5EGNA 5F7ZA 2ACVA 2VNAA 1ZD9A 5JI2E 5J3JA 3MOIA 3G8DA 2J5BA 1I6WA 2EBHX 2H0QA 3LF1A 4MPJA 3OX1A 4DDMA 3QPUA 4XIFA 2OCLA 1JPNA 3QBTA 2KMQA 1R1DA 2UZ1A 2W6CX 1S2DA 3HLKA 3LSTA 3R77A 4QRHA 5AUOB 4OHBA 4NYJQ 1XLTA 1U1IA 2P5YA 2WSSD 1CSOI 1VZ3A 2QAGB 4X8HA 1E6UA 1T9BA 1JPVA 5SICE 5KSZA 3WK7A 1XXLA 2E55A 2I4TA 2HSWA 1MT0A 4BNNA 1PJ2A 1SXGA 2Z08A 3MRTA 3RKSA 1HPTA 1H9BA 2R86A 2VJMA 3FJOA 3KEGA 4M37A 1SBNE 1KQOA 2WD8A 4U2EA 3FYTA 2N9UA 4G89A 1LF5A 4DARA 2FHPA 1G20B 4K03A 4C43A 1WW3A 3SNHA 1HBJA 3EW7A 1FU7A 2HK7A 1JLLB 4TVOA 3K0FA 1QTNA 1Z8FA 1PJSA 1E98A 4JJKA 4FC7A 4GP7A 2P6RA 2IW1A 1KZ6A 3MELA 1UFKA 1ZITA 4UOEA 2A5LA 3NBYC 4G5OA 4HQOA 5KNDH 1GRVA 2QVGA 1IUNA 3NO4A 2WYHA 3QBEA 5LZ7A 5AW1A 3L8DA 1WLSA 3QKSA 2G8LA 4G4SO 4H3VA 4L9RA 1DIHA 2OXEA 3AGQA 3VR4A 2VQSA 2ZRCA 1KAOA 4G0OA 3IVCA 4LOKA 5IUNC 3U5TA 2OQIA 5I9LA 1HQCA 5EJEA 2R44A 4KSCA 1Z82A 1MFPA 5ALJA 2IV3A 4DNCA 1Y7LA 2BWJA 2OLJA 2YVQA 3FY4A 2ORED 4WX2B 2Q6LA 3DHVA 1YDHA 4JUBA 5LU9A 1KRHA 1LPMA 2WIAA 1DAFA 3VDUA 3IMCA 2P79A 1BMQA 3DMTA 3NBZC 3MINB 2P5SA 5ECYA 1B8UA 2J67A 2XXAB 3AZQA 2CDRA 3PKZA 2CXTA 2ISSD 1NBHA 2O05A 3BSWA 3QVXA 5LUBA 4KK4A 4N8DA 4JI8B 1UZUA 3P0IA 1TFUA 1XTBA 2Q3CA 4GR4A 4B6SA 2UYYA 4YRFA 2AC4A 2R3SA 3HYNA 3OMWA 1GYQA 4MV5A 4GZLA 4RH1A 2KM1A 5ED0A 2CHQA 5KYYB 2DIPA 1XVAA 1A9ZA 1JHMA 3BDAA 3E82A 4WT7A 3ZHXA 5JVDF 3S70A 3V8VA 1CJSA 2CWWA 3PDJA 1Y5RA 1C14A 1YFKA 4E5MA 1N6RA 2EGGA 1XTIA 2IU3A 4Q1CA 4BLUA 2EFGA 2QZJA 4OBXA 3G85A 2EARA 4U39A 1GFWA 3LPDA 2RCYA 3ZWWA 2OY0A 3UENA 1X7XB 1VB3A 1D5CA 4MW6A 1LI4A 1VDDA 5ABPA 3MCTA 5LYJB 5KVQA 2OVFA 2FX5A 3D8UA 3OSZA 1T1JA 2CWDA 1WMSA 5J4VA 3BJRA 4AIIA 3WK8A 3NFRA 2XYHA 1SHTX 3AOEA 1CUYA 3PR2B 4L3OA 2O0MA 4LMPA 4PC7A 2HK8A 1I4OA 1P8JA 3RABA 1HURA 1NLZA 3E1SA 4PIMA 1A9XA 3UJNA 1KY2A 2IDZA 2X23A 1K75A 3OC0A 2ZSIA 3AIIA 2FNAA 5JS7A 1PJCA 1UM9A 4V2IA 1T4BA 2ADFA 3OFJA 2PIDA 3JQ6A 5B3KA 2XVAA 5B3LA 3TNYA 1XZQA 2H3HA 1UC9A 1FFXB 4DLVA 1FUKA 1Z2OX 2R8BA 4IVRA 3RUHA 4UXIA 1JJ7A 1C3EA 2D0OB 3THSA 3LCRA 2ZYTX 5EMHA 1FAQA 3MUOA 4BX8A 3ZCVA 2O8NA 1G55A 4Z7JA 3IVAA 1OJ7A 1I2BA 2PSEA 3G3EA 4XD2A 3QV2A 1QO0D 4FLMA 5SY9A 3ZK8A 1L7PA 2ECFA 3A1EA 1Z6QA 2I6UA 2WF8A 4CIBA 2ZRPA 1VL1A 2A35A 2ZKLA 3PC6A 5AM3A 2K7FA 4FVTA 3SMVA 3OXGA 4FILA 4JKYA 3D6NB 4DPMA 3AUAA 2WWGA 1P6QA 1J7KA 3I42A 3U44B 3VNVA 3DDCA 3RPEA 3T1NA 4LJ8A 5KYKA 4UAUA 4MUIA 1VQ1A 1FMJA 3HCEA 4KVFA 2QI9F 5D1HA 2HSDA 3EEFA 2G82A 1ODCA 5K51A 2QL7A 4K5QA 3DWGA 2P0EA 4WQMA 3UWMA 1E3QA 1NT2A 2ODWA 4G23A 4EG6A 5HKKA 2PUVA 3BUSA 4PZLA 1SXJE 3R4VA 5EZYA 2Z9CA 4TMFA 1VG0B 5TX7A 1KEKA 1GPH1 2GX6A 3OEHA 1N6NA 3H5TA 2W6PA 2VUSA 4NHEA 4K6FA 4DWVA 3PXXA 3ZJTA 3RB8A 4HWSA 1ZJZA 3R0QA 4O63O 2QQDA 1OZAA 5LBIA 1XWWA 4UQLA 2CXRA 2NSYA 5CM8B 3E7WA 3SQMA 2N3ZA 4EYQA 2NTYC 1K5HA 3WGHA 3QPCA 4K3VA 3VAAA 4IDAA 1TCAA 1IOLA 3Q8LA 1EVZA 3RG8A 2ZSEA 1Y3IA 4GEGA 2EX0A 1WZEA 3OJFA 3MRVA 4RVNA 1I33A 2ZJ1A 3HABA 3HR7A 1ZCAA 3LRPA 5ESRA 2JGEA 4LZLA 4KQXA 2OD1A 2E2WA 2FG6C 4IIGA 1OW3B 4DY4A 2QTVB 3DBOB 1FPMA 3D54D 2HBZA 1H0RA 1ZO8A 3T1QA 3EMDA 1LBTA 1J00A 1T8TA 4IIFA 3RS9A 1U0HC 3LV8A 4BFCA 4RD0A 1OHHA 1XFAA 4UMVA 3ZIUA 3GJZA 2W83A 5IYZB 1VHDA 1UANA 2FUCA 3DM9B 1M1YA 4YUWA 5HPYB 4FXOA 3A4LA 4L5IA 2B78A 4Y6OA 4AS3A 3SQNA 5IMBA 3OH8A 5I51A 5JWRA 4J16A 5D7BA 4GR5A 3U7RA 4KH1A 1XL0A 3DAHA 1MQ8B 4XW2A 5JQGB 2VK2A 4MV0A 2VH5R 2VYVD 3RIYA 2H2AA 3DS8A 1P73A 4HB0A 1A8IA 2JD1A 1P0FA 2YJ4A 3EHEA 3L0ZA 4HH0A 1Y37A 3EFOB 4X44A 2DTDA 3V55A 4HPWA 1Q9BA 4EF4A 2WJWA 1RMQA 4PXSA 2PGDA 3ONWA 5TSDA 1L4GA 1Y42X 4H17A 3D6AA 3BXPA 4CKWA 3H6HA 1TUGA 1T6XA 5DFAA 3RIHA 3COYA 5EMNA 4ATNA 4B3XA 1VHTA 1YZNA 4MVJH 4WXRA 1XDSA 1MDFA 2WHRA 1NAIA 3KFLA 4M1EA 2SICE 3SF8A 3UMSA 2NP7A 1PVDA 2HHAA 4JP5A 1R3UA 3H0CA 4I14A 4JWTA 1E2UA 4YMVA 5AW4A 3LPCA 4KR7A 2XYQA 5LP6B 4XJVA 3R5AA 4LZNA 2AWOA 3CRW1 1SHUX 4RGYA 2ZUDA 3JVEA 3NXSA 5CA1B 4BPRA 5KX5A 4EW6A 1FMCA 1BGVA 1LLUA 4ZVOA 3FR8A 1A97A 4ENTA 4F96A 5A6SA 1E9DA 4DQVA 4PR3A 4F93B 4GWLA 1KDRA 2D2IA 3A1CA 3ZWCA 1FMLA 3L8GA 4FLFA 2NU3I 4ESVA 1KBFA 1V7CA 2X1MA 2ZWVA 3RH0A 3NIBA 4AF6A 3NW9A 4YQFA 5EHGA 2MCFA 3H4IA 5FL7D 5HKBA 2ZIXA 4M0UA 4FFDA 5I3ZA 3TTXA 1HNNA 1QMGA 1YQGA 3NKLA 4LMRA 3K5IA 3T7CA 3C3WA 4ZI7F 2YMQA 4JQZA 2CE7A 2WWTA 1KDOA 5AT1A 4JT4A 4UDNA 1HL3A 3WKCA