2QPOA

Thermotoga maritima thymidine kinase in the apo form
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
180
structure length
153
Chain Sequence
SGKLTVITGPMYSGKTTELLSFVEIYKLGKKKVAVFKPAHVIERPEEMRKYIEEDTRGVFIDEVQFFNPSLFEVVKDLLDRGIDVFCAGLDLTHKQNPFETTALLLSLADTVIKKKAVCHRCGEYNATLTLKVAGGEEEKYIAVCRDCYNTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidine kinase
publication title Quaternary structure change as a mechanism for the regulation of thymidine kinase 1-like enzymes.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 45
structure length 153
sequence length 180
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2007-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2qpoA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qpoA01
4B2PA 2ZUDA 4MGYR 2EYUA 1PLLA 2O8EA 1ESMA 4OL0A 1VMAA 2BMFA 1XMIA 2IYWA 2NGRA 1MABA 1NMYA 3BGWA 4JSTA 4DCTA 5JI2E 1G7RA 3ADCA 1D9XA 3LW7A 3PIRA 1IY0A 3NEJA 2C95A 2HT1A 1AKEA 1US8B 4R9UC 4A1FA 3LLUA 3EZFA 2H16A 4L9SA 1XCPA 1NN5A 5JWHA 3RRYA 4QBHA 2DFTA 5CM9C 5KNBA 4HLUA 4PC2A 2IYLD 3OEED 1G9XA 3QKTA 5AJWA 3EPJA 5JS8A 1GRQA 3GLGA 1EGAA 4GBMA 1A2BA 3EIHA 1OB5A 1FQJA 1Z28A 3LQQA 4HB0A 3K70B 3GJ7A 1YZUA 1XX6A 3EARA 1IHUA 1AKYA 2E9SA 2QL6A 3UWKA 1KO4A 1RYFA 4C4PA 5AUNB 4V0NA 2OT3B 4DBLC 3EIEA 2XNSA 1CBUA 2WKPA 3TAUA 2FPKA 2VRWB 3F8TA 4GMXA 4FN5A 4RCYA 3GCGA 1W44A 3C16C 4F91B 2PT5A 5FI0B 1EFCA 1HE8B 1IN6A 4A2PA 1R5OA 2J0QA 4I99A 3KFVA 1EWRA 1KI6A 3BH7A 4IFBA 2I3BA 2G0NA 2HJVA 4PQFA 1N5JA 4KFTA 3BJIC 3EIQA 2YWGA 3MWYW 1FP6A 2BBSA 3T35A 2IS2A 4M1OA 3K0SA 1WXQA 3KUCA 2FF7A 2YWHA 5CJ2A 1CR2A 3W6NA 4ZV4A 4AG5A 5JEDA 2NZ8A 3HP1A 2W0SA 121PA 3H86A 5KU1A 4DXAA 3AVVA 3B85A 5JEEA 1NN1A 5LD2B 5FUXA 4C2UA 2ZJAA 3C15C 1ZNYA 5C4GB 4S35A 1AZSC 4M9SA 3W3ZB 4WXPA 2J87A 1I4DD 2DCUA 1ZD9A 1R79A 3IEVA 1NN0A 4NYIR 3RC8A 2VP0A 1II8B 4TLEA 1LTQA 2ONJA 3LBHA 2C04A 3BIFA 2DFKB 3I1FA 1VHLA 3DOEA 1XFAA 2OFWA 4YMTA 1RC8A 3EPHA 5J4VA 4W9MC 3VKHA 1ZUIA 3IBYA 5FBRB 3DEFA 3JVUA 2IHYA 4PZZA 3V00A 2PCLA 2ZRFA 5EE9A 2CDNA 1GTVA 2JLYA 4DIDA 2OE2A 1W4BA 4DUGA 5IHPA 3BD9A 5L3QA 2GESA 3RYTC 3EZ6A 1G8GA 3KJIA 3V4RA 1XNJA 3TW8B 2JGNA 1M6NA 3VHLB 2KBFA 4OI0A 2AXNA 2W2XA 3MLEA 2IYQA 2Q9AA 3OHMA 4NYJR 3SYKA 1EFRA 4PFSA 1ZNXA 1IONA 4LHVA 2FU5C 4I1VA 1KAGA 2ZRGA 3B82A 1QHYA 4LX0A 4NYMQ 2F55A 4LHYA 2J0UB 1IN7A 1XD9A 1E0SA 4LBYA 1ZUNB 3BWDD 4OJKA 2PZFA 2V7QA 3Q3JB 3HU2A 3ETLA 5FR2A 2X77A 1OXXK 4V03A 5FUYA 1XXHA 4B6DA 1VECA 1K8RA 1UKYA 5DHAA 1XMSA 3CH5A 5H1YA 5DHFA 4BEBA 2O8BA 3BH0A 2Q9BA 1D2EA 5ELXA 3T1QA 1PUJA 1X86B 4OYHA 4AG6A 3ICQB 1QHIA 2XZLA 2ZI3A 2CL7X 4K81B 3PFIA 4WA7A 5KO2A 4OHVA 5EZ6B 3OIUA 2AD1A 4MRSA 3EXAA 1UF9A 1XD8A 1T8UA 2ZR9A 1TTTA 4TTQA 2R6CA 3MGCA 2XAUA 5TY0A 2VHJA 1HT1E 3CX6A 1FPMA 1LV7A 3HYRA 1OH8A 3L43A 2HYIC 4TT3A 1KMQA 4A0RA 4B3GA 1U0HC 2VEDA 3DMDA 4AYTA 1Y8FA 1L7VC 3X1YA 5E3HA 1IJFA 4WAUA 4X8OA 2MSDB 3BFVA 1LS1A 1NG1A 4Q9KA 1KO1A 4XIGS 5JJIA 3AKCA 3ICEA 2IBMA 4YXWD 3CNNA 2VP5A 3I61A 4I81A 4AKGA 4LYJA 1OFHA 2PBRA 3PUVA 1QVAA 4PHFA 5JECA 3RNLA 1DTSA 4M9XA 4US1R 4Z1MA 1MO6A 2GAAA 3KJHA 3NBXX 3CPHA 4C0AC 3TK1A 4JLPA 3W6PA 5IK2D 1E2KA 2W0MA 1V5WA 2DYKA 2ONKA 3AVTA 2D4HA 2W6IA 5FOUA 1XRJA 1E1RD 3Q72A 3R9IA 4YC7A 1Z3IX 4X8HA 5FBQB 4Z51A 2IYVA 3SFVA 4D4LA 2NO7A 1OHHD 1KI2A 3SOPA 4AYXA 4TSFD 4JS0A 1S8FA 4YLGA 1E0KA 2Z0MA 4LHZA 1W36C 2BEKA 2RGBA 3ZGXA 3OFND 2OFXA 4I4LA 4Q1CA 3U7EB 1TU3A 2EYQA 1UM8A 1R5NA 3HU1A 4L9WA 3TBKA 5AUQA 3GFOA 1BYIA 2EFEB 1H8EA 1JEDA 4ACBA 1CLUA 2ZU6A 4PX9A 3IPYA 1C4OA 1NKSA 3DO6A 3HPRA 3IEUA 4TLCA 3RDPA 1DAGA 3PEWA 4DB2A 2JJ2A 4L9MA 3NWJA 4X8MA 3AM1A 2F43B 2FWRA 3RAPR 4PAMA 3U7GA 1YZKA 2X2EA 5BN3A 3GLGE 1PV4A 4RKFA 4HDCA 5KYKA 2ZU0C 3NC0C 4Q1FA 4UNPA 3SHWA 2SHKA 1GSIA 1AA9A 3PITA 2QMHA 1VCMA 5AR1A 1BOFA 3RRMA 1XCMA 3B9PA 3OEHA 4CEHA 1GFIA 3P4YA 1E99A 3BFXA 1XMVA 1G17A 1R10A 3GMTA 3GQBA 4MKGA 3CH4B 3SS8A 2GJKA 2GCOB 2ZSDA 721PA 3GEEA 3TQFA 1AIPA 4P4TA 4TMTA 1ZC4A 4HAWA 4KITB 3L0PA 1DAKA 2KI5A 1KHTA 1E2DA 1S1CA 4PPNA 4M2LA 4DHEA 3LXXA 5G41A 3UANA 4QGAA 3FHCB 2OEPA 5FUVA 5E95A 2OXRA 2C2HA 3E5HA 2B8TA 1N5LA 4RZUA 2GAOA 5SZHB 3UMFA 1CRPA 2VLIA 2D7DA 2CE2X 1P2SA 2HF9A 3IQXA 4YDHB 5FTLA 3KKPA 1YZGA 2OFOA 2RKOA 3FE2A 1N6LA 3J81k 2BCGY 4FMDB 5C4MA 5DI9A 4PPQA 2HV8A 1OJLA 2WWXA 1UADA 2C98A 3CUEF 4TMVA 4QJ4A 4FCVA 2O0HA 2ZAOA 2ZQ5A 3NHBA 3WY9A 4O2RA 4LJ6A 1KSGA 4C0BA 1KMHB 3GLIB 2A2ZA 1P9RA 3O8DA 1AZTA 2G83A 2P2LA 3EASA 1GDDA 1UEIA 3VMFA 4M1MA 2WWHA 3LBNA 4MKHA 3PUZA 3GPLA 1E9FA 4HUQB 1RFLA 1NY5A 2A5DA 4JBWA 3CWQA 2XXAA 2CLSA 1G64A 2JEOA 2ZS9A 3AUXA 3Q5DA 4NCHA 1P4SA 5JCPA 1ZAKA 3AVPA 4TL7A 3AH8A 5FUWA 1TQ2A 4BZPA 1W4CA 1EXMA 2FFBA 1AJEA 1RJ9B 2B8WA 5C18A 4D0LB 1JALA 4FI3C 3I62A 1E4VA 3LXRA 4F4IA 2IUUA 1SXJB 2FE4A 3RVBA 4B3DA 4ERNA 4EPYA 5KNCA 3U4QB 3H84A 3LV8A 1US8A 1YR6A 4EAQA 4LYFA 5EXSA 2CHQA 4EJSB 4A9AA 4B48A 3Q7QA 3THYA 1NSTA 4HLUC 1KNXA 4F4CA 4M21A 3H1TA 1JR3D 4PPGA 1GILA 1Z8FA 5FPTA 3NKVA 4BFWA 1R0WA 1G1MA 3FMIA 4BQSA 1WA5A 1NIJA 2GF9A 2HYDA 2J46A 4NYMR 4WVFA 2JDID 3N70A 3GLHB 1W0KA 4CT4B 2UKDA 1XXHE 1YVDA 3ZDQA 1G7TA 3KQLA 2JLXA 2VYFA 1X1RA 3SBEA 1IM2A 1A2KC 3CM0A 4ZDIA 1XTQA 3RRZA 5CITA 2VRWA 2V6JA 1ZM2A 4RY2A 3CNLA 1IY2A 5KPDA 3DKPA 1RRFA 2C03A 4KU4A 2GJ8A 1E2QA 2QQ0A 3LRPA 3QXHA 4JJKA 3HDTA 2OSBA 4Z8YA 2YC4C 4F4JA 2ZRBA 5J4HA 4JKYA 1X8LA 2RGEA 4WW0A 4L16A 5A4JA 4R71A 1E9SA 3MMPA 4LOAA 1YZLA 4OI1A 3NBZC 3EW9A 1COWD 3SJCA 4AK9A 5P21A 4HB4A 4CEIB 4CIDA 5G40A 1KBEA 4IDHA 1KY2A 2WOJA 2ANCA 5IT5A 3SFZA 2ZJ5A 2QM7A 3UG6A 3C5CA 3THOA 1Z6TA 2BEJA 2XITA 4PPFA 4B2LA 2P6NA 2QGNA 4IOMA 5CYPA 1ZU4A 2WAXA 4AKHA 5J4YA 3LO5A 2CL6X 2QP4A 4TWZA 3QENA 2OCAA 2IF2A 5EUMA 3PQCA 4FINA 4OQMA 1II9A 4FXPA 2H18A 3X1WA 1M34E 1XD2B 2AK2A 2QGZA 3MWLA 1A7JA 3LQRA 4XWAA 4ZKDA 4CEJB 3ASZA 3WP1B 3DVLA 3VR1A 4IVRA 1UFQA 3VKGA 1IQPA 5A0FA 1KO5A 1R0XA 5FPYA 3CXLA 4G3XA 2ZITA 2WVJA 1F48A 4TLAA 2DR3A 1F2TB 1QHSA 5JCZA 4Q00A 5GJWC 4BASA 5G3YA 2YUUA 4F92B 1P2UA 4OQLA 3H2YA 1Z08A 1TF7A 3FFBA 3U3OA 2P5SA 2F3RA 1YR7A 3ZD7A 1VCNA 2V1XA 4PZYA 1I4LD 2W58A 2ATVA 4B74A 4LV6A 3BK7A 3AP3A 3B6EA 4XH9B 2ELIA 2J0UA 4JL5A 4ZKEA 4HZUB 4QGHA 1OF1A 3ZIAA 4DSNA 2ZUBA 1W2HA 1G8FA 4M4SA 3L0SA 5HE8A 4TQAA 4KYUA 4LJ7A 4LDJA 4JVLA 1VTKA 2AHOA 1E2HA 2FFQA 3SJZA 4P4UA 5F2EA 2IK8A 1ZRHA 4B3XA 1CJVC 2PH1A 1EWQA 4MYUA 3U3MA 1P72A 3PV0A 4N0DA 2BMJA 2MMGA 4Q1BA 3ZS8A 3KJEA 3E2IA 2J0VA 2I1VB 1G8YA 2CXXA 1OH7A 4Q4HB 5DI3B 1FZQA 2YOGA 5UKDA 5K8TA 5FR1A 4MDFA 4L15A 3ZQ6A 3CR7A 1TUIA 2AFHE 2GZDA 4BFZA 1E2PA 1E79A 4F38A 1U9IA 4G1UC 1X3SA 2ZETA 4TL8A 2ZI9A 4TLBA 1KI1A 1W47A 1XB2A 2Y8EA 5JRJA 4ZDJA 4NYIQ 1E9AA 4OI4A 4JIMA 1IY1A 1PLKA 4MYTA 4A8JB 2PLRA 4QHTA 4X8LA 4FCTA 3E70C 3NG1A 3RANA 3PXGA 1Q57A 2FJUA 1ZM9A 1TADA 2NTYC 1EK0A 1OKKA 2NPFA 4PAQA 3OE7A 1TF2A 2QA5A 3AVQA 3D3QA 4DCVA 5M04A 3PEUA 4D81A 1X6VA 4UQOA 1WF3A 3LDAA 3DDCA 4QHSA 3UEYA 2ERXA 3OESA 4B71A 1TL7C 2ZI4A 4LUCA 3TJZA 3D31A 3WP0A 1WB9A 3VTKA 2QM8A 1W0JA 1KDTA 4P33A 4NYJQ 1LB1B 3OAAD 3O8BA 1NVWQ 1AQUA 5EP2A 2CE7A 3U3RA 3R9XA 4BLRA 4HLQB 5DN6A 2WAYA 4FWIB 1Q3HA 1SGWA 2XJ9A 1LF5A 3U3KA 2GXAA 4FKDA 1ZM7A 1G3UA 2ODBA 3FVQA 1RRPA 3NH6A 4TMZA 2RGNA 1U0JA 2JLRA 3IGFA 4R2HA 4ABYA 2Q3HA 2IYUA 4C2TA 2WJVA 4KLZA 2A5FA 2HUPA 1E98A 1TF5A 2PX0A 1X8KA 2F43A 3R8CA 4ASUA 1W49A 3NBFA 4Q7MB 3THWB 4NCIA 1WCV1 4QGFA 1WRBA 1JBKA 4KV9A 4DLUA 4OQXA 3BRWD 1GKYA 1Y3AA 3QF4B 5CYOA 3WBKA 1P9NA 4D25A 1VIAA 2CNWD 1W48A 2QENA 4IFEA 1DARA 2XB2A 1OXVA 4OK6A 2WWWA 3WMFA 2OAQ1 5CIQA 4PSKA 2GCOA 1QBKC 821PA 2XJ4A 1IN5A 3QEOA 5F3WB 3U44B 4BFYA 1EFUA 1UKZA 4ZCMA 2QAGB 221PA 1P61B 4D26A 3CZQA 1AS2A 3F3YA 3U6KA 1Z6XA 1G3IA 1GL7A 1LS6A 4A6PA 4HI0E 4B43A 1NVVQ 4MGKR 2DB3A 1JJVA 1L4YA 1QHNA 1ESNA 1U81A 3U2QA 4JYBA 1B23P 1S9HA 4MUBA 4ESVA 3A4LA 2GEUA 5FL3A 3DMNA 3M1IA 3OIWA 1JB1A 2ZVPX 1LVGA 2REXB 3IIMA 2GDJA 4XWOA 4DRZA 4Q19A 1SKYE 2A5YB 3KXLA 1JXOA 1CULC 1KKLA 4MYCA 5DH9A 1Q12A 1KMHA 3ND8A 4QNRA 4DB4A 4QM7A 2CLDX 3SU8A 5CDFE 1M74A 4LYHA 2H92A 1DO2A 3BB4A 4P32A 1JAHA 3MD0A 2C9YA 3WYFA 4MRNA 4B34A 1E2IA 2GVZC 3ND9A 1XJ0A 2IYSA 5EE0A 2FPMA 4HUQA 5FOWA 5F9HA 5E4FA 1Q22A 1NY6A 5EP1A 3FOZA 4OQFA 1SVKA 5D3MB 2HDNB 2CHGA 4HDQB 3QKSB 4LC1A 3RWOA 3QOFA 4Z1MD 1SVOA 4LWZA 5CK4A 1RJ9A 4XVUA 2VP2A 3QPWA 2WJHA 1T5LA 1N6RA 1Q21A 8OHMA 1T3LA 3PUYA 2WJIA 3CRQA 3BFKA 5EP3A 4TQ9A 5BXQC 1GG2A 5IDVA 2W6ID 1JR6A 1JAIA 1HYQA 2ZRHA 5FOSA 4EJSA 2PCJA 2WWYA 3EZ7A 4GP6A 2REOA 3PVSA 2QP9X 3ECCA 5AUOB 2YJTD 3BERA 1JPNA 3GJ0A 5FTMA 4TMXA 1RIFA 1CR1A 4Q9IA 3CO5A 3K70C 4MA4A 1KK3A 4LYAA 4EPTA 3R7WB 1WQ1R 4Q7KA 4DLZA 2JJ1D 1G8HA 3GLHA 3NDBB 1KYIA 1XZQA 2ZIAA 1MH1A 1S1MA 4IOLA 4QGGA 4XTRA 3W9YA 2YKGA 2VSXA 1GITA 2CEAA 1H8ED 1J7KA 1NSFA 4LBWA 2C5LA 1MOZA 3IO5A 1Z47A 5E7MA 3SEAA 3PUWA 5C1BA 2F9LA 1OXTA 1KTVA 4EKDA 1M8PA 2QBYB 1Z0AA 3AVOA 2N42A 3IIKA 1T0JB 1U98A 2R6FA 2ZS8A 4C0QC 3KXKA 3KQUA 1TEVA 3CRMA 4D6PA 1TPZA 3NIBA 4B32A 3T12A 5FI1B 1GRNA 4Y0VA 4FMDF 3OEHD 1B0UA 3REGA 4J0QA 2PEYA 4LJ9A 1TQ4A 1Q1ZA 4DJTA 3QI2A 2G77B 3HWSA 1QVRA 1XTIA 2VL7A 4HLCA 2Z83A 3K09A 1RPZA 5FBVB 1OIWA 1SKYB 4CEIA 1OT3A 5CIWA 4V02A 2GWHA 3AVXA 2ZRPA 5LD2C 3VR6A 1KJWA 5JSZB 4ITRC 3LY5A 5J4KA 1CF4A 1MO3A 4JLDA 3QY0A 3I5XA 2L0XA 3IQWA 4PANA 3DZ8A 2V54A 4NTZA 1M1YE 1FW6A 2F1IA 1Z5ZA 2AN9A 3B78A 1XTKA 1YRBA 3RS5A 1KI9A 4D80A 2WZQA 4LGMA 1XD2A 4RZ2A 2WMNB 3SE0A 4IDNA 1A1VA 1Z63A 4CEJA 5E7JA 2RGXA 1RVDA 3LH5A 2ORWA 1OFTA 3CBQA 3K9HA 3D8BA 4U00A 3QPUA 1I4TD 5FPKA 2NPIA 1Q1BA 2W00A 4BEJA 2IUSA 2O8CB 1OYYA 4LPSA 4TYPA 3KZ1E 4U02A 3P27A 3UIEA 1TQDA 3RC3A 4EPRA 1F2TA 4Q01A 4ZCIA 2B7CA 2FMXA 4OBEA 1R0YA 2VHQA 3TRFA 5KUTA 5TXGA 5L3SB 5JHHB 1ZC3A 2ZE5A 3L8ZA 2RHMA 3TGPA 3PEYA 3K9GA 1T4GA 2TMKA 4NCJA 4H9GA 4QL3A 4AI6A 3TQCA 3ZD6A 1R4AA 4EPWA 1BMFD 4GOJA 3VNVA 1ONBA 1DS6A 2NO6A 1NLYA 4HZUA 4URUR 2PL3A 1P5ZB 4Q1AA 4D4KA 4BLSA 4DIEA 5CM8B 4C0HA 2LKDA 1UKVY 1NJFA 2OCBA 4IXMA 1Z0DA 1DO0A 1GKUB 4GSYA 4ARZB 4YMUA 4B75A 3QKUA 1YR9A 1BIFA 1FX0B 4EFMA 1E9DA 4D0NA 4U7DA 3SN6A 4KAXA 1H8HA 2ENNA 4DLXA 2BOVA 1KO8A 1CEEA 1EG7A 3TSOA 2P3SA 1W46A 1PTQA 3Q9LA 1SVSA 4OI2A 1Z22A 2EFHB 4ZIRB 1E9BA 1KZ7B 1ZIOA 1XDBA 1BH2A 5G53C 4JT2A 1G20E 3CX8A 5A5GA 3K70D 4Q4HA 5C46F 3SNHA 5DI3A 1FARA 3D6TB 1TU4A 2A9KA 3T61A 1W0KD 4A0HA 1K5DA 4QFMA 2IA5A 3I73A 1MO5A 2G6BA 2CVHA 2EQBA 1NLFA 3TR0A 2HXSA 4OK3A 4QJ3A 2GKSA 3CX7A 1U9IC 3G5UA 1D6JA 4BFSA 4YQFA 2D62A 4D4MA 1SULA 4MH0R 1OH5A 1GRRA 1NVVR 1T3SA 4PHTA 3OIYA 4AURA 4L8GA 4JYCA 2PMKA 3O47A 4PHGA 3I3SR 3T15A 2IEZA 1J2JA 2FSHA 4PO9A 4PZLA 1ZU5A 4TYNA 4HAUA 2VH5R 4PQYA 2OBMA 4FWTA 5J5CA 4YONB 5F98A 1KKMA 5FPHA 3GLIE 5KSYA 1DAIA 4BZQA 1AS0A 1FQKA 2RH5A 4LY6A 1N6IA 3QPVA 2ZREA 4E03A 1VIYA 2OLJA 3ZZUA 2ZSBA 4OHYA 1D9ZA 1HEIA 1N6HA 1RKBA 4URZR 2JA1A 1NLZA 2ZS7A 2OO7A 4POAA 3RS4A 3ADKA 2YINC 5AJZA 3B1XA 1VHTA 3IO3A 2XX3A 4PC1A 3RSLA 3IHLA 4V0KA 2OLKA 3I32A 4GMDA 2DBYA 2OUKA 3WNCA 2V6IA 5B2ZA 2ASEA 2VP4A 2QPOA 3CF2A 5FFMA 5DISB 5ANRB 4B6FA 2QZ4A 2O52A 4N0EA 2VBCA 4F93B 3QVVA 2AX4A 1ODFA 1SXJE 4Q1DA 2WJYA 4BFTA 1JNYA 2W2TA 1TNDA 4XVRA 2RGNC 1TAGA 4QNMA 3OEEA 2ZSAA 2QU8A 5LPNA 2LKCA 2BCJQ 1E2GA 3FPAA 4KSBA 2F3TA 2IYYA 4OQNA 4RD3A 3U5ZB 1WBDA 1CKEA 3Q7PA 1E4YA 5FOTA 1OFIA 4R2IA 3RS7A 3CRW1 3THWA 2VIIA 1XA6A 1XEFA 1ELOA 3K0FB 4M1YA 1NG9A 2MMCA 4DWJA 3C14C 3CIOA 3QF4A 1E0AA 2Q3FA 3TNFA 3BAFA 4HATA 1N2CE 2CL0X 3GLHE 4CZ2A 2WV9A 4UJ5A 1XPUA 1M7GA 4II7A 1GNPA 5CLLA 5KHOC 1XBTA 3GJ3A 5LBIA 4P4SB 3U44A 1OW3B 1SQ5A 1G19A 3UK6A 5CJPA 2BM1A 2FOLA 4ILEA 1J8YF 2QAGA 3QBVA 3T06B 2YV5A 4BFUA 3EZ9A 4Q4AB 4RD0A 4W5HA 4Q21A 3CNOA 2ZR0A 4D2IA 2ZJOA 4CYMA 4LHWA 2QQEA 2FEOA 2ZJ2A 5C2JB 1SKQA 5CB8A 2FZLA 3THXB 4LBVA 3ONWA 1IN4A 3K53A 4PC7A 4BLPA 2AK3A 1QRAA 1WBBA 5B57C 3A6PC 2ZSFA 3UMSA 2QRNA 4JVMA 1H65A 4DLVA 4XD7D 4LJ5A 4DCNA 1S96A 5EZ5A 4F7WA 2GVIA 4US2R 3QE0A 2QY9A 4GL2A 4HAYA 1M2OB 4A82A 4KVGA 2PZGA 4M53A 1E79D 4WXRA 3LD9A 4IJMA 4TL9A 2O8FB 2PZEA 2BBOA 2VSOA 4GPTA 4M9ZA 4MITA 2W6JA 4W5WA 4WIAA 2R2AA 4RZXA 4C0KA 4PR0A 1QHGA 1DAHA 4EDHA 4DCSA 3A37A 5D3MA 2K5UA 2ROWA 2BMDA 1N6PA 3QKSA 3HPQA 2IWHA 2WJGA 2D06A 3AQ4A 3GJ6A 4ZI2A 2KB0A 4KODA 3MWJA 2FSGA 1SXJC 3OE7D 2FFHA 3WRXC 4Y0AA 5KDLA 1D2NA 2IYZA 1MRSA 2A3RA 2HCJB 4Q4JB 3M4YA 4EJSC 4NPHA 2VHTA 1DAMA 4FIDA 4B6EA 5HKKA 1Z83A 1RE0A 5SZJA 1ZJ6A 3K0EA 4EFLA 2ORVA 2ZANA 3WHKA 2QTVB 1KK1A 1U94A 2VQSA 4CW7A 2H57A 1W36D 3R7WA 1W1WA 4CVNA 2F6RA 5DN6D 3GP8A 2ZPTX 1ZD1A 4MGZR 3K0CA 3U3JA 4BFXA 2GILA 3WYGA 4A4DA 2KE5A 3K8YA 3SQXA 1LF0A 1AK2A 621PA 3KKOA 2BHRA 3LBIA 5HCIA 2QBYA 2CJWB 4ASUD 4Z54A 5EQTA 2J7PD 2ZRKA 4EQ6B 4WZ6A 2ZM5A 1V43A 3AGPA 5DYIA 3VQTA 1HH4A 2XGJA 3LX5A 5H70A 2J1LA 5BWMA 1VDZA 3DKVA 3QJYA 5BYKA 1GP2A 4NCNA 1JXMA 1U0LA 3P1JA 3PG5A 1ZM3A 2BBWA 2XOKD 2EFCB 1PTRA 1PVOA 1Q0UA 2ZI5A 1MR3F 4KI0A 4C3ZA 4ZDWA 1E6CA 3K09C 4Q9HA 4NONA 1AGPA 2EFGA 2P6RA 1YKSA 4GT1A 2WWGA 1QF9A 2CCGA 4YXWA 4PQRA 3FMOB 4IKEA 5JSZA 5AWFC 1SVIA 5CDFA 1U90A 2J9RA 2Q3MA 2P67A 2WWFA 1AQYA 1WE2A 4AC9A 3KQNA 1OLOA 2KWIA 3AB3A 1XEXB 2HF8A 3ZVMA 1KBFA 2IS4A 4BLQA 1II8A 1Z6YA 1KI7A 1T5IA 4OHXA 1XTRA 4GRAA 4HAXA 3ZYCA 1NBMA 1BO6A 4PSVA 4TMWA 1HQYE 3QQ5A 3RS2A 4MRVA 2OESA 2RGAA 3NC1C 4G5OA 3DZDA 3ZLJA 2QE7A 1W2GA 2B21A 3DM5A 3I92A 1R5BA 2YOFA 3EC2A 3KFXA 4BE7B 5FTKA 4DVGA 4DEYA 2O8CA 3RWMB 4BRUA 3GEIA 3AF3A 5FL7A 4UXJA 5SZIA 2JIZD 3IDQA 3UMRA 1DE0A 1KJZA 5TB5A 1R6BX 4KO8A 5L3SA 3B13B 2NZJA 3L82B 1AN0A 2ZRAA 2BDTA 4CDGA 5D3QA 3C5HA 4KXFB 4EUNA 2HCBA 4CGZA 1EX6A 2VTKA 4BRWA 2P6UA 5JS7A 4AKIA 2GEDA 5KPJA 2AKAB 4XJXA 1S4QA 4JLAA 1GUAA 2WMOB 4QJ5A 3X1ZA 3CF6R 2PEZA 5L3QB 3AP1A 5CK5A 1N0VC 3SI7A 5EE5B 3UEJA 3BC1A 1IJEA 3GJ4A 2G3YA 4ARZA 3FKQA 4G5SA 2PX3A 4IHQA 1FX0A 1JQJC 3GJ5A 1P75A 4XTCS 2X2FA 2UVQA 3T1VA 2GJ9A 4NE2A 4ZIRA 3GJ8A 2JLZA 1E0JA 3S1AB 3I5YA 1YR8A 3ZZTA 5KSOA 3TIFA 2H1LA 2H8KA 4NZYA 3F5FA 1SHZA 3PR1A 1IXSB 2D7CA 2ZE8A 4LCBA 1ZUHA 4Q02A 2D2EA 5AK0A 4V0MA 1N0UA 1DOAA 1Z29A 4BUJA 2GA8A 4YMSA 2VHCA 1DEKA 2QTFA 4B2IA 1YE8A 3TVTA 3A36A 3EPKA 5JMTA 4NH0A 3W5JA 1XMJA 2GBLA 2D3WA 1XU4A 4HAZA 1F6BA 3IKJA 4C9BA 1YZNA 3SC3A 2IX3A 1AGRA 1TEXA 3KJGA 4ON9A 1S0UA 4KFUA 1I2MA 4A8JC 1CTQA 3TH5A 1QDEA 2GZHA 5LB4A 3QUSA 3WYAA 5KOYA 2QNRA 2V3CC 2CHVA 2Q6TA 3N2IA 1ANKA 4XVQA 1G291 2P0EA 2EWVA 2JJ8A 1YHNA 3JZMA 2F7SA 4HZIA 3SHFA 4JBYA 3EWAA 1ZBDA 1ZMXA 4C30A 4E09A 5TMPA 3QXJA 4KFRA 1E2FA 5TDHA 4PC6A 4GOKA 2N46A 2QMUA 2IXFA 4KLNA 1P73A 2BKUA 2HLDA 3KB1A 1P62B 4UNSA 1KI3A 1OE0A 3AF4A 1QG2A 1E2LA 1NL3A 2J45A 2RGCA 3TAHA 4BPBA 3NEYA 4PHHA 1E1QA 2XTZA 4A92A 2OV2A 1ZW6A 1CS4C 4DSUA 1N6OA 1QG4A 2AFIE 1KJYA 1GIAA 1A5TA 1UBEA 1G4AE 4OKSA 1J99A 2W83A 4RZ3A 4TMKA 3VX4A 3KB2A 2B7BA 1SVLA 4A0GA 4EPXA 3W6OA 2E1RA 4IOJA 1XZPA 1G6HA 4M22A 1JR3A 1GM5A 2GCPA 1Q1EA 4D4JA 4DUGD 2ZE6A 1P60A 2WSMA 4HAVA 2ZYWX 3BXZA 1TX4B 1FUUA 1NN3A 4G0NA 4JLBA 3NHAA 1FNMA 2YVUA 3K0FA 1G5PA 4JLOA 4ZPXA 3ZVLA 4G5GA 2B6HA 1P2TA 1LW7A 2OBNA 4C7OB 4KCGA 4OHWA 1EFRD 3W8NA 3T34A 1NKTA 4AKEA 1G18A 2BVNA 4GFDA 2ZJZA 4P4SA 2V7QD 4ZI3A 1NNEA 1N5IA 3OZXA 1NJGA 4DDTA 1NIPA 2ZJYA 1MT0A 3P20A 5J40A 2QAGC 3T1OA 1KIMA 6Q21A 4O25A 2WPDA 4Q4AA 4JKIA 1DG1G 5BN4A 5EP4A 1RRCA 3ADBA 4LSGA 4ZDKA 1KK2A 4DLYA 1U2RA 2GJSA 4OK5A 1KI4A 1Z07A 3CRVA 3EAQA 3FYHA 4UJ3A 4US0R 1H8HD 4B47A 5GJBA 5IRCD 3OF5A 3RS3A 3THXA 3A1VA 2FDCA 1XCGB 3UATA 3CWZA 1K6MA 3R9WA 4TYYA 1OPXA 3QEJA 4DT1B 2IS1A 4HB2A 1U8YA 3KY9A 4UNRA 1N0WA 4JVSB 5IF9A 3U6BA 3QSYA 3K0AB 2H7VA 1UBCA 4TT3D 1TMKA 2XTNA 3QXXA 3GLIA 3E1SA 4LBZA 3A4MA 3B7GA 1R8QA 2NO1A 4TYQA 2WTUA 3KDSE 1MV5A 4AD8A 4AYWA 1ZIPA 2O8FA 5FH9A 4IOKA 2ODNA 5HCNA 1BKDR 1G41A 3CF0A 1DG3A 2ZUCA 4Z8XA 3AKYA 3R8FA 1KI8A 1NBME 2W2VA 5J4LA 1P7CA 4MRPA 2GXUA 3LX8A 1TQ6A 5JJKA 4YDSA 4XWKA 3TUZC 4I1OA 3MCAA 3X1XA 3VX3A 1VCIA 2OCPA 1XJCA 2A78A 3BOSA 1XF9A 5FTJA 4HUTA 1E9CA 4IDOA 3UFFA 2CVFA 2PT7A 3DL0A 3P26A 4FW9A 1T3HA 1SXJA 1T6NA 4IDQA 2NO9A 2WM9B 3PEVA 4JT4A 3U4QA 1UBGA 1PUIA 5JFGA 2NO0A 4Q4JA 1G7CA 3QG5A 3RABA 4DSOA 2XXAB 1VG9B 1G21E 1JJ7A 1U99A 2IUTA 2GVDC 3NH9A 5HR5A 4IEEA 4RCZA 2C99A 2O8DB 4LK2A 3SJAA 5H8WA 4NU0A 1AM4D 2R62A 2ATXA 4S2EA 1N3BA 3CONA 1E3MA 4FMCB 3RRNA 2WKQA 2CLCX 3R20A 2ZXUA 3U60B 2FPLA 4JMPA 1W4AA 1ZYUA 2C77A 1F60A 2QRZA 5B30A 3K0CC 2ERYA 3KL4A 1KDOA 2WHXA 4Q9LA 2ENZA 2DFNA 5AJXA 2BIFA 4WZAE 1ZP6A 3THYB 5EE1A 3VR5A 2XEXA 3B1VA 3LWNA 1FNNA 3NTUA 2FNFX 4I1SA 1NP6A 2WJJA 3SR0A 3AVWA 4JSYA 3MFYA 2JJ2D 1KO7A 2CJWA 3MAAC 3ZZ0A 1W5TA 1E2EA 1UDXA 4M9QA 4EQ6A 2MSCB 2V9PA 1XTSA 4JLNA 4Q03A 2P5TB 3NDPA 3IBGA 3HYTA 4MKIA 2V8OA 2H17A 2ZI6A 2ZYUX 5GJCA 4KFSA 4IXNA 4V0ME 3D7MA 1G3MA 2G1KA 2QUZA 3FGNA 2ZROA 2G88A 3U61B 4GOXA 1OIVA 2A5JA 2OCYC 4PXAA 3RLFA 2CCJA 2GEVA 4QOSA 3GLFB 2V1UA 3W34A 3X2SA 2FSIA 1C1YA 2C96A 2FN4A 2REBA 3WHLA 3L8YA 5GVSA 1NF3A 2Q21A 3I8SA 3QNUA 1KOFA 3W8RA 5GADl 4ESHA 1NRJB 4JJZA 5DYGA 5JHGB 1XEXA 4NL4H 3AGQA 1YJ5A 4IVPA 1E9EA 1CJKC 1UDWA 4LJYA 4FD2A 2QG6A 2VF8A 4URYR 1FTNA 3VAAA 4DDVA 2WSSA 2QSYA 1XPRA 3UKDA 3KXIA 3UXMA 3FWYA 4XSHA 3VU9B 3MUFA 2AWNA 1E96A 3M6AA 1VYTA 3BB1A 3IIJA 3LAWA 4XOIA 3UGLA 4CF7A 2FGKA 2Q0HA 3OAAA 4D0GA 4P0TA 1Z0IA 2CK3A 1RRGA 2FSFA 2ZYVX 4BECA 2GRJA 2VHUA 1E94E 2W6JD 2AXPA 3EA5A 3VR3A 1NMZA 2CCKA 2YOHA 5DGXA 1R8SA 4P31A 2Z43A 1GNRA 5FTNA 2FNAA 3UGDA 1KZGB 5DIFA 2ZAMA 1GKIA 3FTQA 4RD4A 4LI0A 1N6NA 2QEQA 1OYWA 2WKRA 1JR3E 2G9NA 1D8TA 2ORIA 1YZTA 1FUKA 1VKJA 2HXYA 2LWIA 2VP9A 4GZMA 5JJLA 1T91A 1HTWA 1R2QA 1FL9A 1WMSA 4Q5IA 4IDPA 3BORA 1Q3TA 2CNWA 2XSZA 3IUYA 2HJGA 2EWWA 1O3YA 5HKKD 4TL6A 4DEXA 2ZRNA 3P4XA 5CB6A 3MSXA 4L5BA 2WIBA 2QORA 4Q1EA 5LDDC 1KAOA 3S1AA 2OZEA 3ZJYA 3WBJA 3EX7C 2DHRA 4KYIB 2J41A 3QVUA 5DO9A 4Q18A 2EW1A 2NOAA 3TSZA 4O3MA 3B60A 4NHOA 1Z0KA 1S3SA 3TSWA 2NQ2C 3CZPA 4MDEA 1CU1A 3TE6A 1Q44A 1UAAA 5EXXA 3V4FA 3U7HB 3A1UA 2QMOA 1YQTA 3LNCA 1Z0JA 1QHXA 2QTHA 1MRNA 2VF7A 3G82C 4OHZA 4HSEA 2ZJBA 2XNDA 2DFLA 2GBLC 2DWOA 3GFPA 3KX2A 4RD2A 3ZVNA 2KJQA 1EFHA 5BW8A 1GL6A 1NVXQ 2RCNA 2D74A 4R98A 1DVRA 4A8JA 1W7AA 3FKSA 5FOVA 5KTYA 2PMDA 2EVWX 5L8VA 4KBGA 4LJ8A 5K8UA 2IT1A 2VA8A 5DE3A 5EJEA 4V0LA 4GP7A 3CB4A 3UPUA 2UZ3A 1P6XA 3LVQE 3LLMA 4GI7A 3SDZA 4TQUS 1QHHB 4TZ6A 1T8TA 2FH5B 2G1JA 3B5JA 1VCOA 2ODWA 2N1BA 4W7SA 3ZH9B 1E9RA 1G8PA 3LW8A 2ZE7A 3WMEA 2JLSA 4NBSA 4QKQA 1DBSA 4E5UA 4RJLA 1IXRC 3GD7A 3BS4A 1Y63A 2GXQA 3WRYC 5HZKA 1CJUC 5FBWB 5JBQA 1UEJA 2ZI7A 5TV2A 2QN6A 1Q1QA 4LZZA 1ETUA 4G5QA 1XEWX 3WMGA 2ZTSA 3B2EA 3KTAB 2XZOA 1D5CA 4DZZA 3PJRA 1ZNWA 4DLSA 2IYRA 1NBMD 2ZRJA 5JI3E 3A4NA 1FOEB 2H5EA 3AP2A 3KKQA 5B64A 5HZHA 4UXIA 3ASYA 3GJXC 2FEMA 2QE7D 4H1VA 1DELA 2BC9A 3VNUA 2CMKA 2JCSA 4MYHA 2ODEA 2DWPA 4G5RA 3UWOA 2X19A 1OXSC 2ZVQX 3FHTA 2ZRMA 3EG5A 1JI0A 1A82A 2I4IA 5EE3A 1VYUA 4JLKA 4L4UA 5FL7D 4A2QA 2WIAA 2R65A 1D2MA 2IF0A 3C8UA 5HPYB 1W36B 4AIIA 4LRWA 2GNOA 2JJ1A 1IAQA 1ZD8A 3TUIC 4C7OA 1FP7A 1G3QA 4TLDA 1G5TA 2A7QA 3SJBA 2YC2C 3VR4A 2WWIA 3AUYA 4QG7A 2LCFA 1NVUQ 1SVMA 3RSOA 3CR8A 4LJ4A 3ZIAD 3LA6A 2J5XA 2O0JA 2ZRIA 3BH6A 5H68A 1N25A 1KGDA 1Z6GA 1AS3A 1E2MA 2J59A 3BE4A 4DCUA 1SHKA 2KSQA 4RFSB 2Q9CA 4B3FX 4E22A 1ZCAA 4JVNA 2GJAA 2BWJA 5BYJA 5KDDA 2IS6A 3WNDA 1F2UB 1VYVA 2C78A 3B1ZA 5FPSA 5FBLB 2VPPA 2QAJA 4M1SA 1HT2E 1IN8A 1WDTA 1JECA 2R6GA 3NXSA 1CP2A 2YZ2A 1FMLA 3CW2A 1KDPA 2BBTA 3MG9A 4K8OA 1A4RA 4BWYA 4DT1A 1KK0A 4O0MA 2VO1A 2R6AA 3QIAA 4DLWA 2ZRLA 4LPKA 5EUQB 2IWRA 1RZ3A 2A30A 2EU8A 3K0AA 4M1TA 4URXR 2BJVA 2QSZA 1DADA 4WZBE 2DPXA 4RD1A 1ZINA 3UGIA 1I2DA 2QMEA 4IRUB 4B3CA 2VSFA 5KNDA 4B3BA 1LNZA 3I8XA 3M0EA 3DHWC 4KBFA 4UNQA 4DKXA 1TBNA 3W5IA 1SZPA 1DAEA 2ZR7A 2MSEB 5L3RA 5DLQC 2I1QA 5TVKA 2OBLA 1N6KA 2CBZA 1PZNA 2ZSEA 1HURA 1HUQA 3W90A 3QKRB 4LC0A 2C8VA 2HT6A 2BV3A 2FZ4A 1E32A 5F9FA 3K1JA 3ZS9A 1OKKD 1G4UR 1XEWY 2OAP1 3B1YA 2IYXA 3LVRE 4KVAA 1PLJA 2RGGA 4N1AA 3AF0A 3O8RA 1R0ZA 3GFTA 1Z2AA 4LHXA 5DNYB 1OFUX 4JBXA 3TUJC 4DDWA 4GNKA 1GAJA 2IHBA 2O8DA 4Q4LA 2O8EB 2OILA 2GXSA 2HLDD 5G3ZA 1BMFA 2F1HA 1GWNA 4WBSA 1W0JD 3QG1A 1MABB 2IEYA 4CRWB 4QC2A 1XWIA 3AVYA 3VHXA 3KQHA 3N2EA 1E1QD 4I1UA 5BQ5A 4B76A 3N5CA 3U7FB 1F3OA 1X1SA 3CRRA 1G16A 3W3AA 1HQCA 2JLVA 1PJRA 3QF7A 2Z6VA 1Z6AA 3EA0A 3Q5EA 3AF2A 4WOPA 2GK6A 1OXUA 4QBFA 3ADDA 2P65A 3A1TA 4PO1A 4DC9A 3NBYC 2GZAA 4B73A 1C9KA 4Q7LA 2ZRDA 3GLGB 2GCNA 1CJTC 1EFTA 4B35A 1G3RA 3K9LA 1VG1A 1LFDB 2F1JA 4NDZA 1MKYA 2DWQA 1F5NA 1UKEA 3EPLA 5JWOA 3QXCA 1M7BA 3MWKA 3MRSA 1N5KA 2PJZA 4NKRA 4U5XA 4DDUA 2F1RA 4PO8A 4YMVA 2ZEJA 5L3VA 2ZYTX 1KNQA 3B9QA 2J0SA 3SYNA 3TW4A 3H0KA 3GLFA 2NMVA 3HJNA 1OB2A 5EXTA 2BM0A 3AVUA 2IYTA 2QT0A 3JVVA 4K46A 2O5VA 2WPDD 4G01B 4FMBB 1KI6B 4NMMA 4M0LA 3TR5A 1OSNA 2QPAA 3EWSA 5IK2A 3V9PA 3BJIA 5AJYA 4JL6A 3TVDA 3WXMA 4E07A 4M1KA 3SBDA 3O8CA 1P2VA 3CPEA 3EC1A 1E1RA 2XTMA 4QRHA 1Q20A 3L0OA 3L0IB 3VU9A 3PUXA 2AKYA 2B92A 1GNQA 1KDRA 3WNBA 3TKLA 1OHHA 1ZNZA 2JLUA 2JAQA 4KHZA 1HV8A 3FDIA 4TSFA 4HEJA 2X8AA 3SYLA 2J3EA 3I72A 1JQLB 1XJQA 4TTPA 1BS1A 3OFNA 4D82A 1J70A 5JLJA 1Z2CA 5K8LA 4QBIA 2PLFA 1M7HA 3JZAA 2ANBA 4FMCF 5JZVA 1T9HA 3QXSA 1JPJA 4DLTA 5JRZA 4JLMA 3HU3A 4B44A 5BN5A 2R6DA 1VG8A 2BJWA 2Z5FA 3KKMA 1TUEA 4A6XA 1HY3A 2Z4SA 3DOFA 3RS0A 4RFVA 1G6OA 5J47A 4HYYA 4PSAA 1SXJD 2WOOA 1W4RA 4UNNA 4N3NA 1GVNB 1X8JA 2ZRCA 1G5RA 4RVCA 4GDFA 2VP6A 1KSHA 2XB4A 4BFVA 5DSZA 4Q66C 3DM9B 3C41J 3PCRB 4W5JA 5JWRA 2UZIR 1WP9A 2WICA 4HB3A 3CKLA 3ZQJA 4ACAA 4EFNA 1CXZA 1MO4A 4PTLA 3CLVA 2JLWA 4EIWA 1TBOA 1YU9A 3FFAA 1S3GA 1GZSA 1KSFX 2DY1A 4IEIA 3FMPB 3SQWA 1L4UA 3EZ2A 3FB4A 4MUAA 1XPOA 1XXHB 1FFHA 2BMEA 3DPUA 5HTKA 421PA 1Z06A 4KSCA 2O8BB 2IC5A 2RMKA 2D2FA 3TLXA 4B33A 4KJZA 2FX3A 2GTPA 4RD6A 3K9NA 1EX7A 3RHFA 1OH6A 3P32A 4NP6A 4PAOA 3T5DA 3C4JA 4QHYA 2O0KA 1IOZA 1NI3A 3VFDA 2IXGA 4XD7A 4UKDA 4O2LA 4TTRA 1Z0FA 3LFUA 4BLTA 4RSGA 3REFA 1L8QA 2IXEA 1U8AA 2YNMA 2XZPA 3AV0B 1KY3A 4URVR 3TMKA 4GZLA 1QHHA 1E2JA 4AY2A 1UJ2A 3UG7A 4PC3A 3PENA 3I4LA 4TYWA 4LV5B 1IXZA 1GL9B 4MKFA 3C7KA 3VR2A 2E87A 1QZXA 2QP3A 3SZRA 1HA3A 2IW3A 1O87A 3X1DA 3B8HA 4A36A 3BBPA 4JZKA 2V55B 1FAQA 3FMFA 1CJMA 4M1WA 1VG0B 4XSGA 5KSZA 4TZ0A 2AWOA 1RYHA 2BKEA 2JATA 4QBGB 4C0JA 1GOTA 4HLDA 4A0FA 5AJVB 3KTAA 2HEIA 5GVRA 4MGIR 4FCWA 3A8TA 3MJHA 2IL1A 1CRQA 3OIVA 2WSSD 3A58B 3VKWA 4H1UA 5FOXA 2KBEA 4URWR 4ZO4A 4HDOB 4DLRA 3AKDA 2GK7A 2C9CA 2FA9A 4Q47A 4DSTA 4ZCLA 1E69A 3BB3A 4EPVA 1XP8A 4CT5A 1J90A 2EFDB 2RAPA 2GF0A 5TARA 2JLQA 2NIPA 1CR0A 2GETA 3QBTA 1VPLA 3IILA 4UXHA 2CK3D 4MQBA 5K8IA 2JDIA 2RB4A 2QT1A 2YHSA 3IPXA 5KSPA 3Q8XB 3KUDA 4R7ZA 2ECKA 2YYZA 4JLJA 1UPTA 2RHDA 5AUPB 3AF1A 5KDOA 4TN1A 1HE1C 1UBFA 1ZM4A 2NG1A 3L2OB 3KKNA 1LY1A 4RKEA 4C0LA 3G0HA 1JEEA 2FV8A 1P9WA 4A2WA 1E2NA 2J7PA 1YZQA 2ZJ8A 1W5SA 2F9MA 2AD5A 3MJRA 2PJRA 1FTSA 1ZCBA 4RFSA 1J8MF 2J7KA 4QM6A 3T5GA 3A1SA 2XSZD 5EXPA 4CEHB 1F2UA 2QPTA 4LV8B 4NCKA 1S9DA 3AEZA 4IVQA 2XOKA 1U8ZA 4JLVA 5SZKB 3HR8A 3ZVRA 2R8RA 2OM2A 4BGDA 1COWA 1IBRA 2X1VA 1T0HB 3H4MA 4YMWA 4Q9JA 521PA 2OG2A 2QI9C 1L2TA 2R9VA 5HE9A 2GHIA 4OJQA 4V0OA 3GLFE 2V4ZA 3NVAA 4Q7JB 4P3YA 2AL7A 2FGJA 1CIPA 1CR4A 3T1TA 2R44A 2FFAA 3HR7A 5CLQA 2C9OA 2Z4RA 3B1WA 3AKEA 5LB2A 2YWFA 4AWXA 1II0A 2G0TA 1R7RA 2QROA 4A15A 1KSJA 1P3JA 2OXCA 2YWEA 1XTJA 1RW4A 1RFHA 2RGDA 4MRRA 2XNDD 1SVWA 4C0SA 2FG5A 3CPJB 1DPFA 4M8NE 2DB6A 3IHWA 2JASA 2OHFA 4LJAA 1EESA 2E73A 1OV4A 4IW3B 4QXAA 1OIXA 1BYUA 5B58C 5E7IA 1S2MA 4Q48A 2AR7A 5GJVC 3FKSD 2A5GA 3QKRA 3F0TA 3GEHA 1NMXA 3KQKA 4BLOA 1DAFA 1K5GA 2JIZA 1ZVQA 1FMJA 1YRAA 3FHOA 4BZXA 3A1WA 1G7SA 4JL8A 2WBLC 3Q85A
chains in the Genus database with same CATH superfamily
1EA7A 2JYYA 5CLIA 2B3DA 4MGYR 4EG6A 1RAFA 3COJA 4ETNA 4UBIA 2O8EA 2RH4A 1P3DA 3WYDA 2COEA 3B20A 2VNAA 3ZDCA 3WWEA 4F84A 2O8NA 1XMIA 1Z35A 3ONEA 3ADCA 5DFAA 4DCCA 3EZXA 1MW8X 1D9XA 4GU5A 4GHWA 3PF8A 4HFRA 2JCBA 1B8UA 3SP1A 2C95A 2HT1A 3ZGVA 3EH1A 3FA2A 1UDRA 4GI1A 1A04A 4KV7A 2YY7A 2Y3IA 4LVNA 2RHOA 2FWBA 1NX6A 2QAIA 3LLUA 4R9UC 4A1FA 3IAS1 4L9SA 4CV0A 2YICA 1X2EA 4QBHA 1I9CA 1U3FA 3L0YA 1T1SA 3GP5A 3PHBE 2SGDI 2BLNA 2QN3A 1WD5A 3ML1A 5KHAA 3ESRA 3BXEA 4BFLA 4L22A 1M67A 4XWYA 2ADFA 1GRQA 3JRNA 4LF7B 4C6HA 4ZHQA 3E1KA 2QNBA 3TPFA 1FQJA 4F56A 4HNVA 4NU8X 2X5XA 4TGLA 5KINB 1QCZA 3EARA 3L02A 3G9XA 2G72A 2J5QA 3I34X 1ECPA 2CLHB 2E9SA 3KSZO 4MW9A 1RLOA 3RYFA 1KO4A 2B36A 4XM2A 4V0NA 1LVUA 4YYEA 1TLLA 5LN1A 1XDGA 2Y1WA 2XNSA 3H8SA 4L02A 3ZQKA 2YZNA 1OV6A 4C88A 3KWMA 3NU1A 3WB2A 2VAMA 3JZDA 1UMCA 1F5SA 3BIOA 4GMXA 4JBNA 2PH5A 4RCYA 3VVMA 2W2OA 2GNPA 2PT5A 3OPQA 1EFCA 4R81A 3WZ2A 1A95A 5GV7A 3HP4A 2F2TA 1C7RA 4RY8A 2W8ZA 4KPFC 4A2PA 4ARSA 1BDJA 4DQKA 1R12A 2FETA 1KI6A 4UU8A 4FFDA 3BH7A 2P3OA 5JO0A 3G2HA 3ZK7A 2I3BA 3CHYA 1Z5UA 1IHDA 3ZV4A 1N5JA 4KFTA 2G7ZA 4H08A 1DP4A 3BJIC 3ABOB 5IKOA 3R3HA 3MWYW 2BBSA 5CDTA 3UAWA 1A8UA 4FKBA 3V1KA 2QTLA 5CJ2A 1UVFA 4AG5A 1CUIA 4S0XA 1DBQA 4Y2VA 4G9GA 5KU1A 4DXAA 5LDDC 2I2AA 3OH8A 1UJBA 4KPEC 3UOGA 4Z4EA 1M2EA 1YC5A 1YK1A 2ZJAA 3L18A 3VYWA 4HT3B 5AW4A 2YZGA 4YJ3A 3TM4A 3W4JA 4GX1A 4S35A 3G8AA 1QFZA 1VRVA 3W3ZB 5BUQA 5A9RA 1PJUA 5FQNA 1ZD9A 2WQZA 3UT5B 4IF4A 3RADC 3PDUA 1NN0A 1KVTA 1C1XA 5MFZA 3A11A 3TEFA 4TRRA 3RC8A 2ONJA 1WVIA 3BIFA 5FV7A 4J9VA 3LDFA 2GX6A 5H3CA 4UDXX 3VE5A 1T9CA 3MD9A 4QULA 1T0IA 4WKCA 3SMQA 1XFAA 3L4JA 2XUGA 3RKSA 2R7KA 1TA9A 4D9IA 2YIVX 4W9MC 3EPHA 1L7MA 4ZVTA 3MWDB 1ZUIA 2O5RA 3DVQX 4K3UA 4Y9TA 3COSA 4OJNA 5F1KA 2Z9CA 3DEFA 3VH3A 2GAFA 3NP9A 4GI3C 3EFHA 3OETA 2ZRFA 4S24A 3HCPA 4M0CA 3DZFA 1QFSA 1ZITA 5A62A 4K28A 4BJ6A 1GUBA 1HYEA 2HJSA 3RYTC 2Z3ZA 5AKGA 4CU2A 2YWXA 1NJ8A 4PX5A 3KJIA 1F2DA 3WB9A 3AONB 3MINB 4EF5A 1K6XA 4UMDA 3VHLB 2WE8A 2AXNA 3TW0A 1B3BA 1DXQA 1OX4B 3W2TA 1ZO8A 3AYZB 4ZOLF 2X23A 4AMYA 1JU9A 2PAFA 3SF8A 1NTOA 2A35A 3FH0A 3PRJA 3LY9A 4LHVA 2FU5C 2NTEA 4I1VA 4P80A 3BMOB 3B82A 3FSGA 3GB9A 4LX0A 3VSCA 2F55A 4MVWA 4IV8A 2J0UB 4TN5A 1IN7A 1H2WA 1XD9A 1E0SA 2J6BA 2JVJA 2B7LA 1ZUNB 2HO4A 1Z56C 2P0AA 2WF7A 2YWBA 1X1CA 3Q3JB 3O8OA 4OYLA 2X77A 4MYRA 3N75A 3HE3A 4B6DA 4DM3A 1DRWA 1K8RA 1UKYA 3Q11A 3VNAA 3AL3A 2HPVA 4IJ5A 3U1VA 4N3BA 3ROZA 2O8BA 4RMHA 3MT8A 3B1KA 2Q9BA 3SD7A 4FIZA 1QGAA 1QHEA 1QHIA 5JS1A 1SKMA 2ZI3A 7GPBA 1P2DA 3F2IA 3H5RA 4L7QA 3D1JA 2V0NA 3PFIA 4OHVA 5BR7A 1HM5A 2R4QA 2BFCB 1ZH0A 5JTTA 4G4GA 2AG8A 4JLUA 1T8UA 2ZR9A 2O7RA 5TJ9A 4QSHA 2BSQA 4CM8A 4AKSA 1UOQA 1UKBA 4CKYA 3KPWA 5TY0A 2IXAA 1LV7A 1CUJA 2JRCA 1XG5A 4M0FA 3BRCA 4KZPA 3FC3A 2VEDA 5B3AA 4B3GA 1MEEA 2C57A 2W6QA 2YNMC 3CE9A 5LDGA 1IJFA 1Y4SA 3BFVA 4PG8A 2H9IA 1Y81A 4K7JA 3TZKA 3RR2A 2O59A 3TNLA 1KO1A 5JJIA 3OOEA 4YRTA 3D5TA 1QYVA 1TBQR 3GU3A 3UK7A 1B8OA 3GFQA 2PBRA 3PUVA 3RI3A 1XYGA 4KH1A 3G1TA 1A9ZA 4HN9A 4J6EA 5JECA 3RM3A 2HREA 2WUEA 3A27A 4US1R 1L5SA 1M1YB 4J16C 2BZGA 3KT0A 5A7HA 3GNSA 1RKVA 4HTFA 1PQYA 4PLFA 5DM60 3V97A 4ZV7A 5JDCA 3GELA 1V5WA 2JFBA 3FLAA 3G8CA 4MPJA 4Y1GA 2WCYA 1L7OA 2GN9A 1AA6A 5JNSA 5HBGA 1JIQA 4LCJA 5HSGA 2ZTVA 3Q7EA 4IEFB 2XQIA 3OM9A 4OATA 4B82A 4MVJF 4FLMA 5E6RA 3IE1A 1EUCA 1B0AA 3HY3A 4X8HA 4HNAB 5FBQB 2E4UA 4CFSA 4Z51A 5LKAA 1JIKA 4D4LA 4YJ2A 3ZU2A 1Y8RB 1KI2A 2ZUVA 4HPJB 3SOPA 4TSFD 4H17A 3Q2OA 1RRKA 3WIBA 5KX5B 3TLBA 1WKCA 3EIWA 4U2KA 4LHZA 3R75A 3QU9A 4HXYA 1OBFO 2YFHA 3BGDA 3QMWA 5COAA 5ALNA 2DKOA 5CA1A 1CUYA 2OFXA 4MTCA 2Y0MA 2HAEA 4L9WA 5HQJA 3TBKA 1XLTA 3HEAA 3NUGA 4XX1A 3R6WA 1A9TA 1DX4A 5DTJA 3W5BA 2VAXA 4MULA 4YR7A 4JEUA 1CLUA 4R8SA 1F1JA 3VUFA 4UBOA 3PEWA 2O5CA 2R60A 4K6FA 4G09A 4OXQA 1WXHA 1XZAA 4PGFA 4L9MA 1XSEA 2FZWA 2Q1YA 4KLAA 4PAMA 5A06A 4ZVUA 5BT8A 5BN3A 3U7GA 3GLGE 5ENDA 5KYKA 2ZU0C 3NC0C 4RF5A 2YWCA 3IXQA 1RAIA 4U9IS 1AA9A 1E58A 3PITA 3DDZX 5AT1A 1NM5A 3HXOA 3W77A 4C76A 3B9PA 3AHGA 2AI1A 1OCEA 3EVBA 3P4YA 1XMVA 1G17A 4RVGA 4WECA 3SS8A 5EX3A 4JB3A 2GSDA 2ZSDA 3OCJA 2H2IA 1V5IA 1E5DA 3P9PA 3ZV6A 1AIPA 2PA3A 4P4TA 5HUHA 4TMTA 1ZC4A 2WDZA 4XGRA 1GV0A 3RIHA 4CCAA 3FYDA 1J09A 4D9KA 4YXFA 2TECE 4LZLA 4PPNA 5KWJA 2EZTA 1SXGA 3WFZA 1RLJA 4PQGA 2C84A 2AR0A 2AFHA 2OEPA 2PFSA 3OZBA 4HP8A 2LB7A 1RZRA 1PYOA 2WHYA 1ZK3A 3EW7A 2BFEA 3WGTA 2VLIA 3OZWA 2N1MA 3KR2A 1UHAA 3KC2A 5HFNA 1EKXA 2JEZA 1JN0A 1KFKB 3CZ9A 3ESCA 2G5TA 3KKPA 3MJCA 4RM2A 5IZ4A 2OD7A 5E1BA 4PPQA 3FJOA 2HY7A 3EOAI 1V9CA 3M4ZA 1Q7EA 4HJXA 4TKUB 3KSMA 5IN5A 3QE3A 1VGRA 4QU0A 3TM5A 3N8DA 2XNHA 4ID3A 2O0HA 5FA8A 3OTIA 2ZQ5A 3NHBA 3WY9A 2EKZA 3AF5A 4C0BA 1P9RA 2QD1A 4BOYA 4DF3A 1AZTA 1SQGA 1KEWA 4PIMA 5B6PA 4JP8A 1WZIA 1WHTA 4TWRA 3S8YA 2NSDA 2OVBA 3NAGA 3IBFA 3TTTA 1VL6A 3GPLA 3PUZA 4U1RA 1NZDA 4JBWA 2JI9A 4UFPA 2GN1A 3BT7A 2XXAA 3JQEA 1G64A 1PV2A 1UC5B 3HCFA 3AUXA 4IIVA 5BSFA 3JQFC 1WMBA 1RYBA 4UFOA 3AVPA 4AQ7A 5C7YA 1EJBA 3K6RA 4TL7A 4MJ3A 4X66B 3EISA 1TQ2A 3MM4A 1QQAA 3CCBA 4EEKA 1H9AA 4BZPA 4PCLA 5EGSA 1JALA 3I8OA 3IALA 3SXJA 3ZCXA 3I62A 1E4VA 4JB0A 3F49S 3GCXA 4PNHA 1PG2A 3DWEX 3GCZA 1EHIA 1RHMA 4ERNA 3ETCA 4A27A 2MINB 2ZULA 2ZR8A 1BD4A 1SU6A 1ZOIA 3RASA 1JYEA 4IJ6A 4DREA 5KTKA 3MTJA 2CHQA 1JDPA 3B3JA 2WIJA 4IS2A 3K4QA 3Q7QA 2JB9A 3G7SA 2KMRA 3T4EA 5JY1A 3THYA 3QUCA 4XX0B 5K3DA 2IJGX 2QXYA 3H1TA 1NNSA 1JR3D 4PPGA 1DQZA 1V45E 3QMPA 3ICOA 1Z8FA 5AVZA 1I80A 3KZOA 3MEQA 1VJ0A 4H6PA 2AZMA 3ZE6A 4BFWA 1G1MA 4JMLA 4AWBA 1J9ZA 4BQSA 5JNTA 4ISCA 5TX7A 2BISA 1NIJA 3PNMA 3T7AA 3TQOA 2GDZA 1NXOA 3JD0A 4G8DA 1AOXA 4KZKA 4ZVOA 2V7XA 1E3TA 4YYZA 1Z82A 2JDID 1U8CB 2QIOA 3KPYA 1PDWA 1XXHE 4WXHA 1ULUA 4L8LA 3T5TA 3IIIA 1JA1A 2KS6A 1X1RA 5AW5A 5CD1A 1M0SA 1A2KC 3CM0A 4O6VA 1E66A 4LYGA 1OAOC 2SCUB 3UMCA 1I7NA 3TLEA 1HI9A 2RAFA 5BWNA 3HZOA 3A6FA 1SG0A 1GTG1 1V1HA 2O50A 1AKNA 1RRFA 1JPVA 1V8ZA 3ANYB 1U2TA 3DXFA 3UCEA 1E2QA 2PX5A 3QXHA 2HJHA 3KQTA 3RTCA 2ISCA 3AB7A 4Z8YA 4EA9A 4F4JA 4I1PA 2I71A 2QVZX 1DIHA 2RGWA 3FLEA 4HKTA 4L16A 4UULA 4LOAA 3FUWA 2NYAA 5CLHA 3ZW7A 1QIMA 2MIIA 4DXDA 4DV7B 3I6QA 4IIEA 2JVKA 2UYGA 3FBWA 1EFKA 3NBZC 3ESXA 1F7UA 1XTTA 1PDVA 5DGTA 5P21A 4AK9A 1L7RA 2NXJA 3CISA 3QEAZ 4CEIB 1KBEA 1O94A 2J85A 2VF5X 1ZIDA 4IDHA 1KY2A 5KMGB 3R5TA 5IT5A 2A20A 1IATA 3VPBA 1ECFA 2QM7A 1EI9A 2GQ0A 3KT8A 3NALA 1CNEA 4PPFA 3ZHVA 4F8EA 4B3MB 3J7TA 1JXAA 4WY8A 3UT5A 4AKHA 1A77A 2EHJA 3DYBA 4FB5A 4ZYLA 2IXDA 1C3JA 3IAS6 4FINA 3K32A 3D6NB 3RQSA 4FOTA 1XD2B 2AK2A 3C3DA 1FXSA 1GCAA 2KCXA 3WP1B 1VSBA 3V2GA 4MWTA 3HXLA 1H3FA 4HBGA 4UHFA 3MWDA 3VR1A 5KCZA 1XZKA 3ESBA 2X4IA 2VK1A 1KO5A 1UJ5A 2PY6A 3QVJA 3NWEA 4S1OA 4DNPA 1IN1A 3GXOA 2GAJA 1V5FA 2A57A 4MUMA 3Q0IA 3CVVA 2YV4A 2JANA 1DKOA 3L7JA 4PE5B 1QHSA 1K8XB 3OWOA 2EATA 2Q3BA 3EOZA 3MINA 4RPHA 5G3YA 4BASA 3L1IA 3T4PA 5CLJA 3T1YB 1B8PA 1Z7WA 3JYOA 5LA6F 1OX4A 3H2YA 1GHTA 1TF7A 1WDWB 3HJUA 3OPNA 1ESCA 1K8ZB 2F3RA 1XC7A 4HHEA 1Z5WA 3U3OA 1NQWA 4XWGA 4BKOA 5DMXA 2W58A 4IGEA 4QLBA 3E23A 1LDMA 4KR6A 3WLHA 5LP6B 3AP3A 3NT5A 2ELIA 2J0UA 2E3JA 4JL5A 1RYMA 2ZIWB 3H75A 3VJKA 1IC6A 1TIKA 1ZUNA 4HZUB 2H2FA 2G08A 1KAMA 3ZDFA 1I1NA 1N2EA 1U2DC 2RI6A 1ZUWA 2J6CA 5DP1A 2AN4A 4GOOD 4BBPA 1RPTA 4TQAA 4F2GA 2WM3A 4IDEA 4KYUA 4LDJA 2H65A 2Q45A 2HW8A 5MFPA 3RSQA 4E5PA 1XQXA 1ABFA 3O4GA 3OJLA 2DKFA 2D8AA 2PH1A 5A4KA 4MYUA 1R8JA 3ROFA 4D9HA 5KNBD 1IDN1 1RMTA 1RYDA 1VLJA 2E37A 3PV0A 2XADA 1NFFA 3OY2A 5EWJB 4IQ4A 5JO9A 3R41A 3VPCA 3D8HA 2AH5A 5K8JB 1LR9A 2BFCA 3H16A 2ODQA 1L7AA 4OSOA 3R4VA 1ISRA 1E63A 1S2OA 4CMJA 2XXJA 3ORQA 2XUFA 1USVA 4NBRA 4MDFA 2JIMA 4HDSB 4QICA 3SF0A 2JGIA 3PNBA 2FW0A 2XDAA 4UUAA 1IDOA 3ISTA 1E79A 1JXQA 2MHCA 5JSUA 1PYDA 1CDZA 3WDSA 4CFYA 1ZNQO 2NV6A 2H5LA 4TLBA 3FPJA 1W47A 2VK8A 5JRJA 4J0FA 3M7IA 3KD3A 4TXJA 2GFHA 5K5EA 4DJ5X 4F72A 1RLIA 1DKUA 4U7TB 1E6LA 3BEOA 1PLKA 2OECA 3EFBA 2PLRA 1W94A 2F9FA 4V3CA 4I6EA 1M1YA 4X8LA 1T8PA 3HUDA 3OOWA 2VPWA 3PXGA 4KO1S 2YN0A 3DXXA 3TMYA 3TXAA 1L9XA 2CD7A 2NTYC 4WI1A 3RFVA 1DC3A 1OKKA 1GSAA 1YS4A 1T3TA 2C0QA 4NG4A 4Z9XA 2P3QA 2QA5A 5GQSA 1CF9A 2H7XA 1IQUA 3WSTA 2WW8A 3ECAA 4CQMB 3CLHA 3P52A 4CTMA 4RJ2A 2KPOA 3TIGA 3FOEC 3ZHQA 4RS3A 1FP1D 1SIBE 1HFKA 1ZEMA 1OMTA 2UXCB 2B6NA 1R6AA 1TL7C 4HNAA 1ORDA 3H83A 4U6QA 1JHZA 1Y8RA 3PD1A 5L9AA 2DXIA 3PPYA 1ADGA 3PXCX 2QM8A 1N78A 4NYJQ 5KX5A 1NMQA 4CE6A 4YJDA 3O8BA 2FUEA 3K1YA 1U7ZA 4D79A 4GP9A 2PZKA 3KJQA 3QOYA 2HV9A 4DFDA 2QTTA 3HS3A 1SGWA 2VZ9A 2GXAA 4FKDA 1ZM7A 4JC0A 3I09A 1NUHA 4R1LA 1VKZA 3IPCA 4J75A 5KVSA 3CEHA 5DOVA 3T5AA 1FY2A 3IGFA 4R2HA 2JIQA 4UD2A 4W4TA 3F7TA 3T4XA 2M6SA 1ID1A 2IRWA 3E4DA 4MW6A 5TMEA 1JI3A 4LOLA 2AQKA 3E3LA 1T26A 4R9NA 4R1UA 3UKOA 3ZDDA 4MVJD 4CN9A 4PXSA 2H7YA 5GIOE 3D6MA 1LPNA 4GLLA 5CU7A 2Y27A 1TVCA 5CYGA 5I7VA 4NCIA 4ZJUA 1HDEA 1WTAA 2E6KA 1WRBA 4QGFA 4RC9A 4W8GA 5ELLA 3BRWD 4TMYA 4W99A 4MPDA 1B4DA 3CZ4A 3UICA 1AMUA 2ZKLA 1P9NA 5HRAA 2QPLA 1VIAA 4D25A 1HZZA 1B26A 1QGUB 2ETVA 1OXVA 4OK6A 2B4QA 5BWCA 1UBRS 2J30A 2WWWA 3I6MA 4I55B 3BF8A 4BVLA 1YONA 2DFPA 4PFJA 1UT5A 3DKKA 3RV4A 2JFPA 1D4AA 1EFUA 3KKZA 1FLAA 4EFKA 4V1CB 2HM7A 221PA 2CB0A 3CZQA 1BROA 1N5DA 3AJAA 2DB3A 2VUSA 4B43A 4MGKR 4DWWA 3H42B 3H5NA 1L4YA 3VISA 4AU1A 3ZE7A 1QHNA 1Y82A 2X5NA 3R0JA 3U2QA 4R1SA 1KZ6A 2ZJFA 3O1IC 4ESVA 3ESZA 5CFZA 4I14A 2GEUA 1AKTA 5FL3A 2ES4A 2PL9A 1UUCA 1YA8A 3D6HA 3AJ9A 3FAKA 3I4FA 1JB1A 3OIWA 1YUMA 2REXB 3IIMA 4XWOA 5ARCA 3WSVA 4BVEA 4TKUA 1AB6A 3EF1A 4AL4A 5BURA 1E7RA 1MZVA 3PGVA 1TPYA 1XZCA 2A5YB 1NUBA 4KXWA 1K75A 1EHCA 4PYOA 4TLMB 3VPAA 1NOIA 3DMHA 4WVLA 2DOKA 2HRCA 2ZTUA 2GPBA 4L9AA 1NQOA 1Q17A 3ULKA 3LBFA 4LYHA 3BB4A 1JAHA 1CV2A 2C9YA 3OSZA 5EMLA 5IXJA 3KQOA 1JRLA 2GVZC 3WGOA 5ALHA 5EE0A 2FPMA 4OQPA 4P7FA 4H35A 3E9YA 4XQCA 1XE3A 4CM3A 3RO7A 1ECCA 2H0RA 4N8EA 1GVHA 5A3QA 4OQFA 1AY0A 1JG3A 1NBAA 1QIDA 3LFHA 5D3MB 5DCWA 4HDQB 4YAKA 5NLLA 3QKSB 2DF8A 4ALLA 4B6RA 1AO0A 1NFRA 1KJJA 1F8GA 1QE3A 4OFXA 4XVUA 2PS9A 1T2NA 3S2EA 3BMQB 3H2HA 1X39A 4YASA 1GTZA 2WJHA 4HY3A 1T5LA 3VPDA 3BA1A 3P2YA 3RUEA 1E64A 3W5HA 3CRQA 3NORA 2AF3C 4EG7A 5F78A 5FD8A 3VHQA 2MINA 2W6ID 3NUZA 2XMDA 4R1PA 3TVYA 3UZUA 3WGMA 3MTAA 4F3NA 2Y68A 2Q27A 2ZRHA 2W70A 1KEVA 3BM5A 3O1JC 1O1YA 4IIUA 3VO2A 4MV0A 3WI7A 1CVRA 2J9ZB 3ILYA 3SR4A 1JG1A 4GSLA 2QYHA 2FEWB 3BERA 1F2VA 3PQ6A 3ROEA 3L7DA 5DULA 3ZU3A 4UTOA 2P6AC 2NLOA 2CXRA 3A26A 4Q9IA 3CEMA 1WV0A 1NU6A 3L41A 5FUBA 1KK3A 3ZR4B 4LYAA 1KYWA 4M99A 3VNSA 3HZRA 3IVAA 3CMCO 1RP7A 1QYCA 3LYLA 2PXAA 1W0CA 3NDBB 4X5OA 2K9HA 1XZQA 3KE9A 3E4CA 4XWWA 1MH1A 1S1MA 2TS1A 1IFXA 3MS7A 3T7IA 3IT2A 3W9YA 1LNQA 5LQNA 1L4MA 1LLCA 1GRVA 2P7HA 3MCWA 4MSUA 1R9JA 4PLHA 5AKEA 1BD3A 5C1BA 3DJYA 1WDMA 5U4XA 1OXTA 3PZBA 2V97A 4A6DA 3GRZA 1EH5A 2FXIA 2AW5A 3W78A 2N42A 3CLTC 1U98A 1UZUA 3RTGA 4C0QC 3H2KA 4RH0A 1H5NA 1N57A 3KQUA 4QU5A 1TPZA 3NIBA 3E81A 5L40A 4LDPA 4FW8A 1A3CA 5FI1B 3HTXA 4J2TA 4LRSB 3N9IA 3REGA 1ZGHA 2XB9A 1DCKA 1NURA 4J0QA 4EJ2A 2IBSA 1TQ4A 2G5PA 2C2GA 2FY8A 3QI2A 2XCOA 4LQCA 3GDFA 4O4IB 1QVRA 3ZNPA 2VL7A 4HLCA 5IG2A 3QXGA 3GRUA 1ZKDA 3KQPA 1ZX1A 1RPZA 5FBVB 1OIWA 1WY5A 4CEIA 2MT9A 1ZHHA 3JQDA 2BR3A 4HG2A 2AEEA 2IYPA 3BJRA 5KMGA 3AVXA 5JSZB 4ZT3A 4U7WA 3QUQA 3O4RA 5IPFA 1CF4A 3ZWYA 3BBLA 1UZNA 3WHPA 3GJSA 5FA5A 3G2QA 1Y7TA 2V54A 3UOWA 2DCMA 1ZPDA 2AVDA 3P94A 1HSOA 1T5BA 3D5QA 5DW0A 3CX3A 5F23A 1FW6A 2RBEA 1Z5ZA 5IXYA 3DE0X 4DR5B 3HCRA 1RADA 2PS1A 4MQ6A 2PUTA 3HUFA 5C5IA 2J3IA 1U1CA 1YRBA 2PS0A 4LVOA 3RS5A 4P7JA 4LGMA 1XD2A 1K7EB 1LEHA 2GNAA 3OWHA 1M9NA 1SR8A 3SE0A 4AJEA 1A1VA 3FROA 1DEHA 2P4UA 3DO8A 1Q1NA 3S4YA 3ZWXA 4GAEA 2W37A 3CBQA 3FOWA 2VFAA 1I4TD 1SOMA 4EJ0A 5FPKA 2NPIA 1Q1BA 1U0OC 2E85A 1L7EA 2EJBA 2W00A 2RHGB 4W9NC 3L7IA 5K1ZA 4C2BA 2CHEA 3E5NA 1OYYA 2QGFA 4CG0A 3FSYA 1NF9A 3A32A 3OPYI 3GGDA 2CNDA 3HKBB 3QELB 2C9ZA 5IUKC 4LDNA 3WFJA 4X84A 1R0YA 3W5CA 2X1HA 4QXPA 5TXGA 2PMBA 3F8SA 1C14A 1XCOA 1GGEA 4OSEA 1A5AB 3VC3A 1NVTA 3NAZA 2HHAA 4LFCB 2D5IA 3TGPA 3PEYA 2TMKA 4NCJA 4H9GA 5ENZA 1EGVB 5LP6A 3DHVA 4RKQA 3TQCA 4KFCA 3U17A 1R4AA 4QLAA 3GJZA 1BMFD 1U5BB 1CF2O 3L9XA 4HGPA 1JQEA 4HZUA 1NLYA 5EJ2A 1BWRA 1JU4A 3ZE9A 4M0UA 4P58A 4AJKA 2AKEA 4E5KA 1N3LA 1JX6A 4KQFA 3I9V1 1NAHA 1UKVY 2LKDA 2PIAA 2OCBA 4NFHA 1Z0DA 2B8EA 1DO0A 3GYGA 2V5AA 4L9RA 4WZAB 4YMUA 2OXTA 3LOUA 3HSSA 3QKUA 5MN6A 3QHPA 2ZSIA 4I19A 1C9YA 4EA8A 2QQFA 2FJ0A 4IXWA 4KAXA 4K05A 4J3JA 2PNJA 2P8SA 4EWLA 3UBTA 4DLXA 3ZG6A 3G02A 1WETA 1BEUB 1EG7A 1OXBB 3CUYA 3Q9LA 4KXYA 4HVAA 4GWKA 4OI2A 4Y1RB 3OU6A 5EWJA 3STYA 2OO5C 3RJ5A 5I8ZA 1ZH6A 3W5DA 5G53C 4Y1EA 2AOWA 2PUFA 3FZGA 5A5GA 3K70D 4IINA 1GPLA 3ZUGA 1N5MA 2X9QA 1FARA 4J7XA 5H81A 4C6SA 4DILA 1S89A 3VNRA 5HRUA 2WM8A 1LVHA 2EGUA 4MPRA 2M32A 1GGNA 4HDSA 2R97A 2CVHA 1DBVO 1G2OA 5GTDA 5IWAB 2GKSA 3CX7A 4C5AA 1U6JA 2JIRA 3QITA 1ZOLA 4BFSA 5K0LA 4MVCA 3MOIA 4FEYA 4DZTA 4M8LA 1KQ3A 1AN9A 3ETDA 1ZR4A 2VLBA 4U7GA 2GZ3A 4RV5A 3T0GA 5FUMA 1TURA 5KOJB 4LE1A 3T15A 2AJCA 4G0MA 2PRKA 4PO9A 3NWBA 5K51A 2NT3A 2BFMA 1VJDA 3OICA 1MJNA 2Z1DA 2MU1A 5D85A 2IZ1A 4PQYA 2ST1A 4II2A 3GR6A 3GY0A 4P86A 1P77A 5J5CA 4H0NA 5AP9A 1Z7BA 1BU5A 3GLIE 3QKWA 2FW9A 2OCLA 3V8RA 4BZQA 4B9EA 5H3HA 3RIXA 4G0PA 1N6IA 3EQ9A 1LR7A 2ZREA 1VIYA 2CUZA 2KM1A 1DKPA 2OLJA 4I3GA 4AO8A 4BCBA 2ZSBA 1TGSI 1IQ0A 3RUAA 1HEIA 4CQMA 4URZR 4X95A 3DXYA 4R7TA 1KJIA 4C0XA 1SGNI 4G4IA 3ADKA 2YINC 3G88A 3BL6A 1W76A 2IGBA 3QMMA 3ZZNA 5KNBH 3F5MA 5FDFA 1B15A 3GGPA 3IHLA 4MP3A 3A05A 1NULA 4ZAZA 2DBYA 3LLCA 3QFSA 4DMLA 4F06A 2D13A 1H2EA 1USWA 3W4IA 3T52A 1T9ZA 2HB6A 3K8QA 1CT2I 3EH2A 3H9JA 4I4CA 3OM1A 3T7KA 5DISB 3P19A 5ANRB 3BCHA 5LUAA 2FZ5A 1PVVA 1UJ6A 1V0JA 3LQ4A 4F93B 1B6SA 4EB0A 1DJOA 1ODFA 1SXJE 4F04A 1TNDA 2CB9A 1DDOA 3I76A 3NCHA 5JAQA 3V8QA 2IY7A 1V1JA 2NSLA 4DG9A 1C30B 1THZA 4NX2A 3TL2A 3IP8A 3QW2A 3RPEA 1V3QE 5BNTA 1U0RA 3OEEA 9ABPA 3VKVA 4E33A 4ND6A 2BCJQ 1W35A 3MTEA 4KSBA 1WBDA 2F3TA 2IYYA 2QZZA 4RD3A 2WEKA 1DO8A 1OFIA 2EEPA 4TVBA 4R54A 3T5MA 2RKWA 3CRW1 4K6GA 4ZP1A 1FBNA 1IB6A 1XEFA 3SZUA 3TIXB 4NG5A 3DTNA 3USZA 5MGNA 5L7WA 3C14C 3I52A 3GFVA 1N5RA 3KHTA 3QM1A 3BAFA 4MVYA 1N2CE 1QGUA 1F0YA 1JKMA 5EKUA 1M7GA 1F06A 1UT6A 3DZIA 4II7A 4MB2A 3SX0A 1QPZA 4I55A 5KHOC 4C07A 1XBTA 3LPCA 4P2BA 3OU7A 5IJ9B 3A70A 1TJPB 4P4SB 2Q1TA 1Z18A 3ZUPA 1NV9A 1Y5MA 4R05A 2FOLA 4N5HX 4BEWA 1YU6C 4V1CA 1V3TA 2XVZA 2OGZA 3LUAA 4NDAA 4F4DA 4FB4A 2FQWA 3EZ9A 2FE1A 4RD0A 5AK4A 2NU2I 1U3GA 3DE5X 3GZJA 5JYCA 2IDZA 5A4MS 1U0NA 4PBRA 4QUKA 9WGAA 1PTJA 4D2IA 2ZJOA 3OCWA 1VI6A 2R6JA 4CYMA 4QJBA 1SKQA 2FMIA 3G8BA 3GUVA 3HVIA 3THXB 4P0PB 1IN4A 4Y30A 4MI3A 3IS3A 5EA2A 3GX1A 1BAPA 3CG0A 1L4NA 4NZNA 5B57C 1G9TA 4RQAA 1L8OA 4JI6B 4KXVA 3LP6A 1YDHA 3HV0A 3G0IA 5EZ5A 4WK4B 1VE7A 2X3UA 2GVIA 5KTOA 4FR2A 3S2IA 4IXTA 3QE0A 1EJ2A 3T3IA 5AQEA 5LZ7A 3AOGA 1XU7A 4YROA 1FFWA 1EZ4A 2GEJA 3EVGA 3W8EA 2PZGA 4AQDA 4U2BA 1TM3E 4HNUA 3JATB 2GN0A 2PVSA 5EQJB 5A05A 3X0DA 4F4FA 4HDMB 4REOA 4IIYA 1XHEA 2PYDA 5EERA 3H17A 1IY8A 1MEJA 4YJ2F 3OVOA 4MITA 2J08A 2CGEA 2VPTA 4PR0A 3EGCA 2VQ6A 1YOVB 2G1UA 1WXDA 3DNPA 1DZIA 1TZJA 2WB4A 2EX4A 3N0RA 3CRNA 5D3MA 4D3FA 1I24A 1GLNA 1JKIA 2H6EA 3FOBA 1XGKA 2PSDA 3CU5A 3FYSA 3QKSA 4FOPA 5C7OO 5CA1F 1LRKA 3HHPA 4BV2A 2IIQA 1FEZA 3N87A 3BMQA 4FK8A 5PNTA 4L6AA 2OXIA 4HEA1 2HN9A 3SJ7A 1ZGGA 2PR7A 4XCVA 3IMFA 3M8KA 4WP4A 1D2NA 4D74A 4L76A 1RLMA 5FP0A 3TGLA 4JCOA 3PGLA 3ANNA 5J2TB 5IM4F 4GMHA 3DBVO 3HADA 1GQQA 2AJBA 3C48A 4JJAA 2Y6UA 1H9BA 4CHGA 4WFQA 2P4QA 1RE0A 8ADHA 1ZJ6A 3K0EA 1XEAA 2ZAYA 4IJVA 4PLWA 4M7WA 3CB2A 3OKAA 3VGJA 3OLXA 3NHPA 3ZJ5A 5JAPA 2GZRA 3UJ3X 2OTCA 4MQ4A 3WZMA 2D1FA 5E6UB 3CE6A 3IP3A 3SR3A 4CVNA 4P81A 1ISSA 1NT4A 1NXVA 2DR0A 3HLTA 2B20A 4LG1A 5DN6D 1H4SA 5C7LO 3GP8A 1NV8A 3NBAA 1UANA 13PKA 1JWBB 1KH1A 1LRLA 3NJRA 3H4VA 4MGZR 1AQIA 5BO5A 5T8KC 3WHIA 4ER5A 4YRBA 4DDMA 1HFJA 4A4DA 2IHUA 3KVRA 5CVDA 1EG2A 4KE6A 3PQ2A 4MIOA 2RJ3A 4DKJA 1K9SA 3GZ4A 3BIJA 3A2NA 3IVCA 4XB1A 2CJWB 3RAFC 4R4JA 4QWMA 5EQTA 4AZSA 5EIXA 2J7PD 2ZRKA 2JFFA 2QUJA 1V43A 1WB5A 3VQTA 2BFWA 2XGJA 2DPYA 3QV1A 5I47A 4RTMA 1IUOA 1K0UA 5BWMA 3VZDA 4CV2A 3C3KA 3QJYA 2F8SA 4L50A 1GP2A 4NCNA 1C9JA 1JXMA 2FRDC 3WJ1A 1ZM3A 1GPNA 2EKQA 2WTNA 3KR9A 3GDGA 2VDJA 4O4IA 3DAOA 3N74A 1KEEB 1HDYA 4C3ZA 2PZMA 2Q50A 1G8AA 3K09C 2FZEA 4K9QA 4YO8A 4NONA 5AVKA 3UPDA 3AZQA 4F71A 4KO3S 1YKSA 3P5SA 4YRDA 4F3KA 2WWGA 1JE1A 2A9PA 4YXWA 3A6EA 2LW7A 1VGQA 2B5OA 2BGJA 1R3UA 4PZEA 5LVAA 4WZBB 3V1YA 5JSZA 3IQHX 1DFGA 3WLOA 5K4HA 1U90A 2DUWA 2P67A 1NXUA 2BDUA 4MEJA 1YQUA 3C4VA 2VHEA 4R0VA 2AE1A 3QSGA 2IS4A 1RQRA 1H1TA 1KI7A 4OHXA 3G68A 2L69A 3N7UA 1NBMA 2XVMA 4HAXA 5JJ5A 1DLJA 3G5TA 2OV1A 4KPGA 4R2MA 2OESA 2OB1A 4L8WB 2R6ZA 4FZRA 3ZLJA 4ETIA 1U2EA 4N48A 2I2XB 3I92A 4RULA 3EC2A 2Y0EA 4M76B 3DBOB 4DN6A 4UTNA 1E8DA 5KKNB 5EJ5A 4E5MA 3GBPA 4M9UA 1GFZA 1XHFA 1K5PA 1X14A 3KKLA 3ER8A 2JIZD 3ITNA 3HKBA 2BFAA 2VJDA 3A2MA 3JQAB 1KJ9A 3QELA 5AQ1A 5BSHA 2AYYA 4JBGA 2NZJA 3P97A 4XYMA 1HYBA 1X13A 2BDTA 4Q3NA 4CDGA 3IKLA 2V53A 3C5HA 1R6VA 4KXFB 1J2TA 4X1IB 4EUNA 4YRGA 2R11A 4CGZA 1LK5A 3CJTA 3L8GA 4RH1A 3I04A 4K88A 4OVOA 3SSMA 3ZDEA 2RK6A 3UK0A 1U5BA 3NVKI 1DKLA 3GL9A 4JLAA 3VDXA 4I1YA 5F51A 3LLSA 3PNSA 2AG1A 3MCVA 3OCXA 3CZCA 3X1ZA 3CF6R 1YQGA 2HRQA 2PEZA 3KZXA 4TV9F 1CQWA 5L3QB 2PKWA 4KXQA 4Y6LA 3TSCA 1EAYA 4HN2A 4MA5A 1WXIA 4C2AA 1EXWA 1IJEA 2QMYA 2G3YA 1NR7A 3OUTA 4J0HA 3FKQA 2ZB7A 4K40A 4RELA 4WFIA 4WZAA 4YMIA 3HVJA 4IHQA 2CLMB 3SPXA 3E82A 4Z0TA 2X7JA 2AOXA 3I9KA 4K3VA 2GPTA 2NYUA 1LH0A 4YRQA 3BTOA 5I4CA 5JNLA 4NE2A 3TJRA 4YCJA 1WSBA 2Y92A 2IFTA 3E59A 1E0JA 3M6FA 4QPJC 3AR3A 4Y1RA 4BYGA 4D99A 1P4JA 3FCUB