2B8TA

Crystal structure of thymidine kinase from u.urealyticum in complex with thymidine
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
206
structure length
206
Chain Sequence
IGWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDTRSIRNIQSRTGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFGPIAKLFTYADKITKLTAICNECGAEATHSLRKIDGKHADYNDDIVKIGCQEFYSAVCRHHHKVPNRPYLNSNSEEFIKFFKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidine kinase
publication title Structure of the substrate complex of thymidine kinase from Ureaplasma urealyticum and investigations of possible drug targets for the enzyme
pubmed doi rcsb
source organism Ureaplasma parvum
molecule tags Transferase
total genus 54
structure length 206
sequence length 206
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2005-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2b8tA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2b8tA01
1TBNA 2W6IA 3I4LA 3UEYA 3CF2A 3THOA 4NCHA 1M7BA 1O3YA 2K5UA 2OCPA 2C9CA 2BMJA 3U61B 3FVQA 1G8HA 1MABB 4M1WA 4JYCA 4PC1A 2OILA 2ZJZA 2ZS8A 4A2PA 4Q1BA 1R0WA 2CVHA 4DEYA 2QP9X 2IK8A 3TNFA 2XEXA 2V7QD 3UPUA 1KI6B 1XPUA 2Z4SA 2YC4C 4OHZA 1MO6A 2OFWA 4M0LA 4QM7A 1AM4D 3GJ8A 3Q7QA 1E9EA 3TSWA 2HF9A 2HJVA 4KJZA 1F2UA 4N1AA 1KDPA 2F6RA 4H1VA 5HE8A 5EE3A 4A9AA 1E1QD 5FFMA 1SVKA 1WXQA 2ZRJA 1Q21A 4AKGA 3EPLA 2P0EA 3Q9LA 2O8FB 4A8JC 1D8TA 2GWHA 4ASUA 1GG2A 3V00A 2IEYA 3Q5EA 1TU4A 5FBRB 5FL7D 2ZE7A 4G1UC 2FZ4A 3LX5A 4PZZA 3ZVNA 3RRYA 5KOYA 3DMNA 2VH5R 2HT6A 1C9KA 2WJJA 5C4GB 2GEUA 2P65A 3CPEA 2NZJA 1XCPA 2WIBA 2WPDA 1XRJA 5JRJA 3CR7A 1E79A 1J90A 2W6JA 4BZPA 4ZKDA 5B64A 3GFPA 4Q7JB 2GJSA 3ADKA 2QAGA 2EFHB 4RD4A 4YMTA 4F4CA 2CJWB 2IYYA 5CJ2A 1CXZA 4TL9A 1Z08A 3ZZUA 1XU4A 1G7CA 4UNSA 4AC9A 2QNRA 4U02A 3SS8A 3WMEA 3X1XA 4B2LA 2W6ID 3NIBA 4L15A 4OQNA 2G77B 3BK7A 1K5DA 1KSGA 1S3SA 3TLXA 5B57C 5CM9C 5AUQA 1U8ZA 4M9QA 3ICQB 3PIRA 3ZVLA 4DLUA 5EP1A 5DNYB 1M8PA 3TVDA 2QU8A 4ZPXA 1DBSA 3PEVA 3UANA 2PLRA 2JGNA 4GOXA 4UXIA 2W0MA 4DVGA 4MRPA 3U3OA 5FR2A 4R98A 4ZI3A 3DKVA 4F91B 3TE6A 2ENNA 3TQCA 4DLYA 2CXXA 1IY1A 2AK3A 1GL9B 3CIOA 2ZU6A 1UDWA 4AURA 2Q6TA 2XJ4A 2DFKB 1I2DA 3CX6A 3RWOA 5D3QA 1ONBA 3QXJA 5JS8A 2EWVA 3DM9B 4Q5IA 2YUUA 421PA 3NDBB 4ABYA 1G9XA 1N5KA 4NYJR 4PO1A 1GNQA 2VEDA 4PQRA 2O8BB 2J0QA 4XJXA 3K0AB 4B73A 2FEMA 4JLAA 3MRSA 3OIUA 4B71A 1KBFA 5KO2A 2ZYWX 2AWOA 1JQJC 2D06A 1IJFA 3O8RA 1ZM9A 1JJ7A 2WPDD 2WAXA 1SVIA 1E79D 2W6JD 1T0JB 2DR3A 2D2FA 4AY2A 2PZFA 4EQ6B 3KB2A 521PA 1TF2A 3SNHA 4C9BA 3LLMA 1HTWA 3OE7A 4LV6A 4F93B 1A82A 2J0VA 4ARZA 2WWGA 1J7KA 4DCVA 1XFAA 1GAJA 2RGNA 1R6BX 3I5YA 1VCMA 1XEFA 1KSHA 1UJ2A 2ZAMA 2OCYC 1CJMA 2XZPA 2ZSDA 1IXSB 4M9ZA 1UBCA 1ZM3A 2MMGA 2BCJQ 1E9FA 3H0KA 1KSFX 1E0SA 1KO4A 3KXKA 1CRPA 2NG1A 2PMKA 3P26A 1OE0A 4B75A 2F7SA 3NXSA 2RH5A 1E9AA 3THWA 2BM1A 2YWGA 1EFTA 2O8EB 3GEHA 3MGCA 4HAWA 5JSZA 1Z2AA 1SVSA 3NH9A 3KJIA 3UG7A 2FSIA 1KI2A 5JMTA 1PVOA 2QA5A 2RCNA 1OFIA 4XOIA 1VMAA 2NQ2C 4W5HA 2B6HA 1XWIA 1D9ZA 4IEIA 1YZGA 3KX2A 3K9NA 4LJYA 1G21E 1VYVA 3C14C 4N0EA 4QBGB 2YWFA 3CNNA 3U3MA 4FWIB 3U60B 1RYFA 2GK7A 5FUXA 3NVAA 1HE8B 1WF3A 1J2JA 2XOKA 2FH5B 1M2OB 2J0SA 4TMTA 1E69A 4XTCS 4KXFB 4CEIB 4LGMA 3TAHA 4KFRA 2P5SA 2QMOA 4NCNA 2OFOA 1Z8FA 1LF0A 3EPJA 3WNDA 2WICA 3HPRA 1XD2A 4XD7D 4LX0A 1X8LA 3CX7A 1N0UA 1WCV1 1YZTA 3AVTA 4M1TA 1T3LA 3VTKA 1XTKA 4KU4A 2ZRBA 1J99A 5EP4A 1ZP6A 3EWAA 2CHQA 2AX4A 3H86A 1OF1A 2QEQA 2AFHE 4KFTA 4ZIRB 2J0UA 2LCFA 5HPYB 4KSBA 2RHDA 4PO9A 2ZYVX 4YMVA 1BKDR 1M7HA 2IA5A 1W49A 4U5XA 2ZRKA 4NKRA 3B2EA 3WRYC 1CRQA 1YKSA 5C46F 1Z29A 1L8QA 3QY0A 2QAJA 2EVWX 1I4TD 3PITA 1X86B 1NNEA 4DCSA 2WSSA 3F8TA 3L8ZA 3LH5A 3LQRA 1WDTA 3ND9A 4M22A 4Q4AA 3PEWA 4D81A 3AKYA 3CKLA 4M53A 3AVYA 1L4UA 3MG9A 4F38A 2CK3A 3PUYA 4TT3A 1YZQA 3TAUA 1JECA 4FMDB 4DSOA 1WBDA 3TH5A 1Z07A 3BERA 3T5GA 5DHFA 2FFBA 3QNUA 4QBIA 3WNCA 1U2RA 4DB4A 2Z5FA 5DH9A 2F1RA 3D31A 4V0NA 2AXNA 4YMWA 3VX3A 3UEJA 1G3IA 3W6NA 3ZZTA 2QQEA 1QHHA 1S0UA 3QXCA 3KTAA 5UKDA 1FP7A 2GZHA 2XOKD 5FBQB 4DDTA 5J5CA 3D7MA 4ZO4A 4WVFA 4CEHA 1A7JA 2NPIA 4M4SA 1FMLA 1YRBA 1ZU4A 2JLQA 5E95A 3UG6A 1W44A 1KJZA 5K8IA 1G7SA 1GKUB 2ZJBA 2Z43A 5AUPB 4MYCA 2X8AA 3NHAA 4W5WA 1U90A 4TZ6A 4BUJA 1DAEA 1U8YA 1SXJE 2BOVA 5CK4A 1W0KA 3W3ZB 8OHMA 2D2EA 2WVJA 2PT5A 1OXSC 1E9DA 5EP3A 2PZEA 1JQLB 3CH4B 1D2EA 2JDID 1SKYB 3KQNA 2ELIA 3OIYA 3MSXA 1LS6A 1XEWY 3TGPA 1MH1A 3AGQA 4NE2A 3SQXA 1C4OA 1Z0DA 2GCPA 4M1KA 4IJMA 1WMSA 3ZVMA 3X1ZA 2ZROA 1OJLA 4CIDA 3AP2A 1Q1EA 3K0FB 1G4UR 3B9PA 4HZUB 2BBTA 2VTKA 2QMEA 4M1SA 4TT3D 3B78A 3NC0C 2WTUA 4M9SA 4QC2A 2D62A 1LTQA 1UKYA 3LXXA 5C4MA 3NEJA 2FU5C 3AUXA 3HYRA 4OHWA 4PC7A 5KSPA 5HZKA 4CGZA 3FMOB 3QKRB 1QZXA 1E96A 4TL8A 4LBVA 4WBSA 1MOZA 4DJTA 4JL8A 1JAIA 1JB1A 2OM2A 2IUUA 2WHXA 2ZITA 3LVRE 2CMKA 5D3MB 3SZRA 5CIWA 5BWMA 4MITA 1KKMA 4HATA 4P4SA 4V0KA 4P31A 3TR5A 4DLTA 1FX0A 2REBA 4BLTA 4EJSC 4JSTA 1SVWA 5JZVA 3RS3A 2FZLA 2UZIR 1II0A 2J41A 1YE8A 4FKDA 2VP0A 3J81k 3RYTC 2W2XA 5E7IA 4RFSB 1D2MA 3EZ6A 1OW3B 3BB3A 5F98A 4QM6A 5BYJA 2GF0A 4TQ9A 3MWKA 1NVUQ 2YZ2A 3K09A 6Q21A 3ASYA 4OK6A 1JXMA 3IQXA 5FI1B 2HT1A 2VPPA 3F3YA 3GLFB 4OYHA 4B33A 1BO6A 4JLBA 1JNYA 3EW9A 5JCZA 2F1JA 3KFXA 2O8CA 1CR0A 2ZI6A 3THYA 1RKBA 1M74A 3CBQA 3EIQA 4QNMA 2DB3A 1NMYA 3RSOA 3IQWA 3K0EA 1VIAA 4TTPA 4LK2A 3RRMA 4TLEA 1S1MA 4C7OB 5SZHB 2WKPA 4BFZA 1XZPA 3VX4A 2ZQ5A 2A3RA 3QI2A 4LBYA 4HZIA 4FCVA 2AR7A 2QE7A 1KMHA 3EPKA 2ZE5A 3NDPA 4NH0A 3ZH9B 1U8AA 2C03A 4L9MA 2ZR0A 2ODWA 2ZS7A 1HE1C 2FMXA 1GP2A 5FPTA 1RRGA 2PJRA 3AF4A 1DELA 2ZJ2A 1E99A 2FG5A 3CH5A 2JJ2D 3QPVA 2ZE6A 3B5JA 1JPJA 1Z6XA 3RAPR 2XSZA 4PQYA 4IHQA 3G82C 2A5DA 2KI5A 4FMDF 4HB0A 3O8BA 5E7MA 3DEFA 1EESA 4URUR 4FMCF 3L0IB 2GCOB 1XDBA 2CBZA 4M1YA 1Z3IX 2IYVA 2JCSA 3K9LA 2RHMA 1HV8A 2IXEA 1E2IA 2VHUA 4PPFA 2MSEB 1YR7A 2IYUA 5HTKA 1LV7A 3D8BA 3EA5A 4P33A 2HYDA 1W1WA 1Q1QA 1R10A 4HI0E 2DWPA 5AJYA 1XPRA 3NKVA 3D6TB 1VG9B 4Z1MD 1EWQA 4QJ4A 2ZRIA 3KUDA 4LPSA 3QIAA 1OXXK 1XJCA 1OH6A 3CRRA 2GETA 1ZINA 4US0R 4XSGA 2LKDA 1ZBDA 2J87A 2P67A 3DL0A 4UNQA 3AVQA 2ZIAA 3F0TA 1X1RA 4JLMA 2J59A 2ZPTX 2AFIE 4LBZA 4A0GA 1YVDA 3VAAA 4DLRA 1Q44A 4QXAA 5C1BA 2C5LA 1P61B 1X3SA 2G88A 1HY3A 2HJGA 4Q21A 4ZV4A 1DAMA 3ASZA 4TMWA 4WAUA 1Z63A 4GOJA 4LJ9A 5FBWB 1AS0A 1G41A 2H8KA 2L0XA 4A0HA 5CYOA 3CZPA 1US8A 1F48A 1QDEA 1QHSA 2EFEB 2JJ1A 4MRNA 5LB2A 4IRUB 3R8FA 4B3DA 2O0HA 4BLOA 4C30A 3EZ9A 1SVMA 1ZNZA 2IXFA 1OFUX 3PCRB 3PEYA 5EXTA 4OL0A 4OKSA 2X2FA 2ZYUX 1JALA 3U6KA 3V9PA 1NN3A 1U81A 4CRWB 3O8CA 3H84A 4Q1EA 2D7DA 1KYIA 2GBLA 3T1QA 4NL4H 5IK2D 4C2UA 3NBZC 1IAQA 2GKSA 4M21A 3QPWA 1S8FA 2XTZA 2J5XA 2ORWA 2BJVA 5DYGA 5FR1A 4DCUA 4PHHA 4IVPA 2ZUCA 1F5NA 2ZUBA 1FMJA 1AQYA 2ZAOA 1ZNYA 2CVFA 3SBEA 4NTZA 3EIHA 3AH8A 4EFMA 1K5GA 2OCBA 4JKYA 2Q3HA 4DSTA 1S9DA 1NRJB 2ANCA 1E0KA 1Z22A 1G20E 2BEJA 3BB1A 3O8DA 5JLJA 3BFXA 2FJUA 2QZ4A 2CE7A 3BAFA 2ZRMA 3U5ZB 4FD2A 1W2HA 4M1MA 4Q4HA 5KDDA 3K70C 1Z83A 2QMHA 4A6XA 2ONKA 5CM8B 4OQMA 5J40A 1OT3A 5TDHA 3QENA 3LBHA 2OBNA 4V0LA 5LPNA 4TQUS 3K70D 4ZDKA 3T1VA 3KQUA 1O87A 4JJZA 4NCKA 1KTVA 2B92A 2ZVQX 4EUNA 4X8HA 1EG7A 3A36A 5FTMA 3WBKA 4Z51A 5JWRA 3AF1A 4AKIA 4UNNA 4ON9A 3IO5A 2GNOA 2JJ1D 4C3ZA 4ZKEA 3TUJC 3U44A 1NVXQ 2FNAA 2QORA 1E4YA 1T8TA 5FTJA 4NYMQ 2RGCA 4CDGA 3SJZA 2CCKA 4CEJB 1VECA 5FPKA 1MKYA 2BBOA 4LJ4A 5SZJA 2VP6A 1NIPA 4HUQB 3BWDD 2W2VA 3LBIA 4BZQA 1OV4A 3K0CA 1G5TA 1OPXA 1G3UA 5TY0A 3W8NA 4RJLA 1ZU5A 4RD2A 2Y8EA 1UAAA 2ATXA 2OLKA 3ND8A 1QVAA 2PX3A 1XEXB 2R62A 2WOJA 3C15C 3EZ7A 3RRZA 3V4FA 4KITB 2J7PA 4ZDJA 2AD5A 3U7FB 1IY2A 4OK5A 1GVNB 2HCBA 2RGXA 4L4UA 2XXAA 1VYUA 5G3ZA 5J4HA 3TQFA 4YMSA 2IYXA 2OG2A 5AJVB 4DHEA 2OE2A 2Q21A 4D4JA 3KQKA 1IXRC 2G1JA 821PA 2YOGA 2D4HA 3GMTA 4GZLA 1CJVC 3UIEA 4KYUA 4O0MA 4Z8YA 4TTRA 2IYZA 3TW4A 4A36A 1W5SA 2C96A 5DSZA 4CYMA 5HKKA 5K8UA 1TTTA 1CJKC 1G8YA 4I4LA 1R79A 2OEPA 2JEOA 1ZIPA 2H17A 5BW8A 4J0QA 1YHNA 3RRNA 1COWD 2IYLD 1HQYE 5JI3E 4UKDA 1II8A 5A4JA 1E2NA 3FHOA 1Z5ZA 3OFNA 5FOXA 5AJZA 1KMQA 4GL2A 3ZGXA 3CNOA 2ZR9A 3S1AA 3U6BA 2QBYA 2JLUA 1XP8A 1G5PA 1UPTA 2CL6X 2PEZA 1UBGA 5L3QA 2Q0HA 3LFUA 3GLIB 2QSZA 2E87A 4TWZA 4IFBA 1E9BA 1L4YA 1W36C 2VSXA 1OIWA 1F2UB 2QY9A 3AVWA 1E3MA 4D82A 1U0JA 1G19A 3K0CC 2DHRA 1FZQA 3B1WA 3BJIC 2XJ9A 4LDJA 3UMFA 1E1RD 2OHFA 1XBTA 2WWIA 1A4RA 2ZM5A 1Z47A 5JRZA 2IW3A 2V1UA 3SC3A 1OB2A 4R71A 4EPTA 4Z54A 4NONA 3PEUA 4HAXA 5AK0A 3DPUA 1HQCA 3VU9A 3WNBA 4EDHA 1W0JA 4OI1A 1RRPA 3WBJA 1D2NA 1ZD9A 1XTSA 3FKSA 1E2EA 3UWOA 1TMKA 3CW2A 3U7EB 1LB1B 3RNLA 1GL6A 5C2JB 3PUWA 3RS7A 5J4VA 3QKUA 1GKYA 4E03A 4LC1A 1PJRA 3VFDA 5G41A 1SHZA 2P6RA 3HU2A 1KIMA 3LX8A 1YZUA 3CO5A 3GJ4A 2ZI5A 1SKQA 1DADA 3SBDA 2Q9CA 3EIEA 4PHTA 4TYWA 3D3QA 4MRVA 1N25A 2ZU0C 4BE7B 4DCNA 1JR3D 2C9OA 2DY1A 3PUZA 3QUSA 1G4AE 5HKKD 4G01B 1QVRA 4Y0VA 4HAZA 1TADA 1CP2A 2XTNA 3T15A 1N5IA 2GXSA 3CLVA 1IN8A 2PH1A 1Z6AA 3M4YA 4QJ3A 2VP9A 1PLLA 4MRSA 2GVZC 4PSAA 1XB2A 4Q03A 3R8CA 4D0GA 2XNDA 4EPWA 1OH8A 5FH9A 1NF3A 4DDVA 2FGKA 3UMSA 1E2GA 5L3VA 4HB3A 1LS1A 1H8HA 4MYUA 4BFSA 4G5OA 4KODA 1SVLA 4QRHA 4URVR 4PC3A 4U7DA 2WV9A 1XD9A 4LHYA 2P5TB 3QXXA 4KAXA 3OAAA 1D9XA 1MABA 2WAYA 4NZYA 3Q72A 5E4FA 5L8VA 2QT1A 2GEVA 2BC9A 3JVVA 4E09A 2AWNA 2IYRA 4GDFA 4QHTA 3IEVA 3T12A 1KY2A 2E9SA 4G5RA 1P3JA 1KI6A 1QHYA 2GILA 1P2TA 1SKYE 3A37A 2EFCB 1W0JD 1ZC4A 4MRRA 4B6DA 3MWYW 5FBVB 4JMPA 5H68A 2PMDA 2IHBA 1KK3A 4RD6A 1JI0A 1KJWA 4M8NE 3WYFA 4QKQA 2R6AA 1G6OA 1GKIA 1NMZA 3FMPB 2CCJA 2RMKA 4LV5B 2JLZA 4FXPA 2G83A 5FTLA 1N6NA 3AF0A 3Q8XB 3SHWA 1NBME 4AYTA 2FE4A 3VR6A 3K8YA 2UKDA 3PQCA 4HEJA 2IUSA 2FSHA 3HYTA 4IW3B 4JT4A 3I5XA 1DG3A 4EFLA 1VHLA 1T5LA 4LHZA 3IPYA 3QF4A 3M0EA 2ZREA 3DZ8A 4PFSA 4EIWA 3MJRA 2LWIA 5SZKB 1DAKA 4ASUD 3IPXA 2J45A 4RD3A 4LHWA 1CJUC 1XMJA 3TIFA 4DLSA 3I1FA 1MO3A 4WXRA 2IYWA 3IKJA 3QKTA 4P0TA 1U98A 2NTYC 4MYHA 3NWJA 2VSOA 3THWB 2BWJA 1TPZA 1A1VA 2B7CA 4JJKA 1OXVA 3W5JA 5JSZB 1L7VC 3SJAA 2QAGC 5CLQA 3IGFA 4JLPA 5DHAA 3HDTA 3T06B 5JWOA 4IDOA 2OT3B 4UXHA 2FSGA 3GFOA 3GJ7A 3RS0A 1E0AA 2R6GA 3N5CA 5CDFE 4ZI2A 3H1TA 2WJHA 1FOEB 4DIEA 5GVSA 1EFCA 4RY2A 5FPYA 3GLFE 1TQ6A 3B7GA 1EFUA 2JAQA 2YNMA 4RCZA 4BEBA 2B7BA 3SJCA 5K8TA 2A5GA 2QMUA 4XIGS 2IX3A 1WBBA 1WA5A 2WBLC 1DE0A 2QSYA 3I8XA 1FQKA 2OAQ1 3WHLA 4URXR 4POAA 5LBIA 5FOVA 3X2SA 3DOFA 1BIFA 4QG7A 4TN1A 2WWHA 2F55A 4IXMA 1BS1A 4HLUA 2R6DA 1XJ0A 1XD2B 1ZCBA 3X1WA 3OEHA 621PA 1OHHA 3FPAA 3A4MA 1FQJA 2YOHA 4Q4JA 5JHGB 3U7HB 4D26A 3O47A 5BYKA 1Q1BA 4XWOA 2GDJA 3CPJB 4B47A 2IF2A 3DMDA 4TYYA 1ZJ6A 1LNZA 4JIMA 2X1VA 2WJVA 4A4DA 1KDOA 3B82A 2D74A 2NO9A 1SHKA 2J0UB 4H9GA 4MQBA 3RANA 3I72A 1Z0IA 4Q9LA 5GJVC 4IOJA 2EFDB 1CULC 4GPTA 3K1JA 4L16A 4JLNA 1IY0A 1RYHA 1HYQA 1P9RA 1Z2CA 4IEEA 3KKQA 3IDQA 4URWR 4D4LA 4EQ6A 4GFDA 3CRVA 1RFLA 1A2KC 4Q4AB 2A7QA 4UJ5A 2ZSEA 4R2IA 1AKYA 1DVRA 4YDHB 3MLEA 1NJFA 4BRUA 4MA4A 2HLDA 3LDAA 2RGNC 3PUVA 4II7A 2YWHA 2BCGY 2FFHA 2ZJYA 3I73A 1KDRA 2OV2A 2WOOA 3OE7D 5FL3A 1VPLA 4C0BA 4R9UC 3UATA 3TK1A 1ZD8A 5F9HA 3B1XA 1WRBA 4BWYA 3U4QA 2B8TA 1QHHB 4JYBA 4B76A 4DUGA 4LYFA 1H8EA 3KTAB 4BLRA 3KJHA 4HLDA 2QGNA 4HLUC 2HV8A 1XD8A 2XTMA 4CEHB 4JL6A 2RGEA 2EYUA 2Z4RA 2CLCX 2I1VB 4KLNA 2GZDA 5DN6A 1XCMA 1ANKA 4BFVA 1OHHD 4BLPA 3ZJYA 4EJSB 1G8FA 1EX6A 3PG5A 1ESMA 1I2MA 2Z0MA 1F2TA 2WMNB 5KSZA 4NCJA 4WOPA 4BFUA 2B21A 4LJ7A 4FMCB 1N6PA 2VSFA 2BBWA 4QL3A 1WB9A 5JCPA 4Q4LA 2PT7A 4EPYA 4O2LA 3QVUA 2JA1A 1DARA 221PA 3RS4A 2GAAA 4CF7A 4TL6A 1A2BA 4Q7LA 1TL7C 3B13B 1E2KA 1YZNA 4KSCA 2H92A 1T5IA 3EXAA 4IXNA 2DYKA 3Q5DA 3MAAC 4HAYA 4Q19A 3X1YA 4HB4A 2NIPA 1VG0B 5AJWA 3A1SA 4IDHA 4GP6A 4DSUA 4XSHA 2GHIA 3T34A 1RPZA 3IIMA 1OYWA 2FFQA 4TSFA 1V43A 1XX6A 1TBOA 1Z0FA 3MWLA 5JEEA 4HDOB 4TQAA 3E5HA 1OH5A 3UGDA 3FDIA 4MGZR 4BGDA 1KZGB 2ZRNA 4ZIRA 5DISB 3JZAA 4JVLA 3VMFA 721PA 3VKGA 4FW9A 1E9RA 2EFGA 4O3MA 3SDZA 3BRWD 3CWQA 1XJQA 3QXSA 1ZW6A 1D5CA 5CB6A 1PZNA 1TEXA 2J7KA 1MV5A 2MMCA 1VCIA 1SVOA 2R6FA 2IHYA 2R8RA 2C95A 2ODBA 3DZDA 1VYTA 1UEIA 3M1IA 1U9IA 4BFWA 2QTVB 4MYTA 4DSNA 1G7TA 2GA8A 3AKEA 2GXUA 2PX0A 3NH6A 4ACAA 5LD2C 2LKCA 4F92B 4M1OA 4B6EA 4Q7KA 3ZYCA 2V9PA 5LB4A 4LJAA 1RIFA 4P4SB 1V5WA 4UNPA 3ZIAA 1CF4A 1FX0B 2WSSD 3EZFA 4YONB 1GM5A 4DIDA 1B23P 1IBRA 4H1UA 2N42A 2QPAA 4LJ8A 2A5YB 5ELXA 5E3HA 1TUIA 4GSYA 5FTNA 5BN5A 2E1RA 1KI8A 1G291 1P2VA 1KO7A 1II9A 2CK3D 3ECCA 2XNSA 2O8DA 1TEVA 4WW0A 1KI1A 1U94A 3SQWA 4K8OA 5L3SA 3B8HA 1UADA 1L2TA 1FUUA 2F1IA 3LW8A 4V02A 4CZ2A 4ERNA 5BN3A 2VF8A 5AUOB 5G40A 2VF7A 4MKHA 3U2QA 2ZSFA 3KKOA 2GXAA 3C16C 4E5UA 4XWKA 1RJ9B 3GJ5A 3THYB 2KWIA 5KDOA 4HB2A 3AM1A 1VDZA 2Q9AA 5DGXA 5EXSA 3EA0A 4NYIQ 1G3RA 3RS2A 2OFXA 3QEOA 5AUNB 3L0OA 1DTSA 2GJKA 4PAQA 4LOAA 3SYNA 2IS6A 4A0RA 2FX3A 2R9VA 1EK0A 2ZRPA 1KMHB 3G5UA 1XMIA 3LWNA 4LY6A 3I8SA 4DLWA 1JAHA 1JEDA 5J4LA 1HH4A 1KAOA 2G0NA 3DVLA 3RLFA 3SOPA 1FTNA 1FARA 1OXTA 4I81A 1T0HB 3MUFA 3W34A 4YDSA 121PA 1DPFA 3HR8A 4KVAA 5TVKA 5IHPA 3PUXA 1W0KD 2CEAA 3L8YA 3IUYA 2BHRA 5AWFC 1PV4A 1KY3A 4PQFA 3ZVRA 1X1SA 1FNNA 1RC8A 3WMGA 1IONA 1MO4A 2Q3FA 4KO8A 1JXOA 2VRWA 3B1YA 4NYMR 1E2QA 1NBMA 1ZM7A 2ATVA 2NZ8A 3DM5A 3AVOA 3GLHE 2WJIA 4HZUA 1XMSA 2YOFA 2VL7A 3GFTA 4OJQA 5JECA 1G1MA 1JEEA 1QRAA 4PR0A 3MWJA 4Q1AA 5FOTA 4B2IA 1GTVA 2H7VA 3SJBA 4X8LA 4D6PA 2QM7A 5H8WA 3FOZA 1G8PA 4A1FA 1Q57A 2CE2X 3MD0A 4QHSA 1Z6TA 3P4YA 4ILEA 3GLIE 2GESA 2CLDX 4AG5A 1P4SA 4FMBB 4TLAA 4Q9JA 3CNLA 2FV8A 4F4JA 3FMIA 1GSIA 1Z0JA 2WWXA 4PTLA 2OXRA 3R7WA 3TUIC 1OKKA 2GXQA 5IF9A 2AKAB 4LC0A 1NSTA 3FE2A 2IS1A 1XTIA 2O0JA 4RFSA 3K70B 4HLQB 2GF9A 5AJXA 3EARA 3AVVA 2GRJA 2VP5A 1Z0AA 4RD1A 4PANA 3QVVA 1KI3A 5CDFA 4C0SA 3Q85A 3KB1A 3U3KA 3WHKA 5H1YA 1US8B 4YXWA 3CR8A 1N6IA 3VR2A 4AK9A 1W4AA 5DLQC 3K09C 3R20A 3SU8A 2YHSA 4PAMA 5FPSA 3KL4A 3VNUA 2HUPA 5KPDA 3BGWA 2H16A 2W2TA 4PPQA 1OXUA 4EFNA 5CK5A 2ODEA 3VKHA 3B6EA 4B3GA 3E1SA 4NHOA 1U99A 3X1DA 1EFRA 1KK1A 4CT5A 4K46A 1CIPA 1YZLA 2JLSA 1AS3A 1P9WA 4IDPA 4AYWA 4QHYA 1XTJA 1ZMXA 3GJXC 4BLQA 4HYYA 3CM0A 1R5OA 3LBNA 5TV2A 4EKDA 1RFHA 1LW7A 3NHBA 1I4LD 4AG6A 1RVDA 2V55B 2QE7D 2IUTA 5JJKA 1AGRA 3CONA 2G3YA 4TMKA 1DG1G 4HDQB 4KHZA 4TTQA 2OUKA 2MSCB 3THXA 1N6KA 2VO1A 2ZUDA 1KO8A 1YZKA 5IDVA 2I4IA 1QHGA 3T5DA 4AI6A 3CB4A 4FN5A 1UBFA 4DC9A 1MR3F 3QJYA 4I99A 3KY9A 2V1XA 2FGJA 2J3EA 1YU9A 4IVRA 2XSZD 5L3RA 5JI2E 3CUEF 2IYQA 2F3TA 1G64A 4MKGA 1Z6GA 2XB4A 1TQDA 2ZRAA 3LY5A 4OBEA 1JPNA 1NI3A 1OYYA 1XXHB 1YRAA 1CU1A 3CF0A 1T91A 3DDCA 5FBLB 3UKDA 4TLDA 5KSOA 1XTQA 3QKSB 4OHXA 3BH6A 4GZMA 4JLVA 4LRWA 3BFVA 1EFHA 4C0KA 4U00A 5GJBA 2VP4A 5DI3A 2QGZA 2WWFA 4BFTA 2ZANA 4IFEA 4Q48A 1Q1ZA 4PPNA 3LLUA 4BFXA 4RSGA 1LVGA 2GTPA 3U44B 1YJ5A 3GCGA 4JBYA 3QG5A 4WIAA 3PV0A 4ZCIA 4GMXA 3I61A 3AUYA 1NMXA 3JZMA 3A6PC 1W36B 1ZUIA 2DB6A 5EE9A 1P60A 1XF9A 3ETLA 1ZUHA 2XITA 1TX4B 3SN6A 4DT1A 3U3RA 4OHYA 3TVTA 5J47A 4ACBA 4Q00A 2IYTA 3NC1C 2ROWA 2QTHA 3RSLA 3AEZA 1PUJA 4BFYA 5JS7A 2FDCA 1EFRD 2C98A 2NO0A 4G5GA 2RGGA 1VHTA 5DO9A 3HU1A 1R5BA 1F60A 3MMPA 3CWZA 1DOAA 4QJ5A 3BXZA 1NKTA 1TU3A 2WKRA 4TMZA 4JT2A 3KUCA 3EG5A 3BFKA 4GT1A 4LI0A 3HU3A 1GITA 1BOFA 1XPOA 1SGWA 4PZLA 2IF0A 3FMFA 2P3SA 3R9XA 4QGHA 4LYJA 2GBLC 4HDCA 1AZTA 1KI7A 3KKPA 4PXAA 1Q0UA 4LJ6A 4PHFA 4DCTA 2XB2A 3CF6R 2V8OA 1XZQA 2F43A 3NEYA 3QBTA 3W3AA 4BEJA 4CT4B 5JJLA 3WYGA 4JZKA 1G8GA 3PXGA 1IHUA 1SXJA 4KBFA 1II8B 2QP3A 2DWOA 1P7CA 1GUAA 3P1JA 2KJQA 3U3JA 2E73A 3E70C 2QBYB 3S1AB 1NLZA 3ONWA 2QRNA 1DAIA 3JVUA 5L3QB 3SFVA 1ZRHA 5EJEA 1AGPA 3ZZ0A 3GLGB 2RGBA 1ZM2A 4B32A 4KCGA 2FOLA 3LNCA 1IM2A 2AKYA 3K0SA 2P2LA 3LA6A 4Q47A 2QL6A 3L82B 5K8LA 1XEWX 2WJYA 4CVNA 2OESA 1ESNA 5DI9A 5KYKA 5J4YA 4IKEA 2V7QA 5A5GA 4GBMA 1N5LA 1FFHA 3VR3A 3T35A 1CR4A 3VU9B 3ZD6A 1BH2A 1E2FA 3T1OA 3WY9A 1Q3TA 3RVBA 1Z6YA 2X19A 4B3FX 5ANRB 4MH0R 2ZI3A 3ADDA 1E1QA 1G5RA 2GVIA 3ZLJA 2CL7X 4RZXA 4PZYA 3TW8B 2NO1A 2W83A 4RZ2A 3QEJA 2WKQA 5A0FA 3GPLA 3BH7A 1W4CA 4NP6A 1ZUNB 3FGNA 3PENA 1EWRA 4C2TA 3SR0A 1XEXA 5FL7A 1W36D 1QG2A 3A8TA 4MDEA 1CBUA 1W48A 1KK0A 1NVVQ 1UFQA 4OI0A 4A8JA 3OEEA 1M1YE 1A5TA 4G5SA 3RWMB 3ZQ6A 2D7CA 2HEIA 2YINC 1SXJC 3LV8A 4DKXA 2BIFA 4B6FA 1OH7A 4G0NA 3ZD7A 4K81B 4MUBA 3CRMA 4OI2A 5J4KA 1GNRA 1LF5A 3TMKA 2IEZA 5EZ6B 1R0YA 1G6HA 4L9WA 4MGYR 4TLBA 2GZAA 3QPUA 2J7PD 1SXJD 1ZIOA 3BIFA 5G3YA 3RABA 1CTQA 4AIIA 1F3OA 2VHQA 1PLJA 3B1VA 3BS4A 3C8UA 3LXRA 1AZSC 1LY1A 1G18A 4TMXA 1GRRA 1P2UA 1CR1A 4OHVA 1FL9A 5KNDA 2HXSA 1TAGA 2YWEA 1I4DD 3BBPA 3HPQA 2ZJAA 4KLZA 5IT5A 5TXGA 5H70A 4B2PA 2QAGB 1P9NA 3GLHA 4BECA 1CEEA 1ODFA 3G0HA 2YJTD 3I62A 4QOSA 4Q1FA 2HYIC 2ZXUA 5FUWA 1E4VA 1QHXA 4WA7A 2ZTSA 1VCNA 2V54A 4XWAA 4G3XA 3PR1A 1XMVA 2IL1A 3ZQJA 1KZ7B 2ZJ5A 4V03A 2RAPA 2FFAA 3GLIA 1ZYUA 1NLYA 2VYFA 3LVQE 4C0JA 3OFND 1E0JA 1VIYA 2DCUA 4RVCA 2HXYA 1R4AA 2KE5A 1KO1A 1UBEA 4LYAA 4DDWA 1FAQA 1G7RA 1NIJA 2J1LA 4PC6A 3SE0A 2XGJA 2GJ9A 3VQTA 3EC2A 3LRPA 3PJRA 3BORA 4QGAA 2VBCA 3K9HA 5GJCA 4YLGA 2QPTA 1R7RA 1W5TA 4G5QA 3R9IA 2Z6VA 2ZJ8A 2P6NA 5KNBA 2ZI4A 3OEED 1RZ3A 3QF4B 4O25A 4YQFA 2GK6A 1MT0A 5JWHA 5F3WB 2ECKA 4X8OA 5KU1A 2IS4A 1NP6A 1DAGA 1NKSA 3AP3A 4F4IA 1AK2A 4N0DA 1UDXA 3WP1B 4PAOA 4UQOA 2ENZA 4KVGA 4B35A 1EX7A 3RS5A 2V6JA 3EASA 3FKSD 4D2IA 1E94E 4E07A 1PLKA 4HLCA 1NL3A 4EPRA 2F3RA 3TBKA 1J8YF 1N5JA 1UF9A 2FWRA 2RGDA 1UKVY 2OAP1 1Q12A 1ETUA 3W9YA 3OESA 4GRAA 1AN0A 1TF7A 4DB2A 3LW7A 1X8KA 4V0OA 2JIZA 4DDUA 2FN4A 2O8FA 2BEKA 1DAHA 4ARZB 4ZCLA 3ADBA 2BKEA 1OFTA 4B44A 3DOEA 4WZBE 2G6BA 1W7AA 1ELOA 1U0HC 2V6IA 3NBYC 4D0NA 1FW6A 4RKEA 4FCWA 2JJ8A 3AV0B 1KO5A 2PEYA 4M2LA 2QI9C 3DKPA 4O2RA 1N0VC 5EXPA 2IBMA 4GNKA 4BRWA 2XNDD 4MGIR 1W4BA 3LD9A 1T3HA 2ASEA 2CJWA 3OF5A 5FOUA 2ZR7A 1XTRA 1ZNWA 2ZRFA 4Q4JB 1QF9A 3A1WA 2DFLA 1SQ5A 3FHCB 2H57A 1H8HD 4URZR 4L8GA 1CJTC 1OIVA 3LO5A 4OQXA 4WZ6A 1TQ2A 2ZRDA 3IHLA 3WRXC 3GEEA 4C0HA 3N70A 4RFVA 2OCAA 1P75A 4C0AC 1K6MA 4M9XA 3OAAD 5EE1A 5KDLA 1IXZA 4JLJA 2VHCA 1ZC3A 2NMVA 2R44A 1IOZA 2WZQA 3OHMA 4XD7A 2WWWA 2X2EA 3BE4A 4LV8B 1TUEA 4RCYA 3SEAA 4ESVA 5EQTA 1AS2A 1UKZA 2C78A 1YQTA 3REGA 4D0LB 1Z0KA 1E32A 5SZIA 2XX3A 4RD0A 2H5EA 1P5ZB 4IOKA 3QXHA 2ZYTX 1K8RA 2VLIA 5BXQC 3IEUA 3KDSE 1KDTA 1IN4A 2CCGA 3C41J 5FOWA 1NJGA 4I1SA 2ZE8A 4NYIR 1OIXA 5B58C 2O8BA 4B34A 1RRCA 2DFNA 2JIZD 2OXCA 2JLWA 2ONJA 4QBHA 1KNQA 4UNRA 2P6UA 4OK3A 5P21A 3K0AA 2AXPA 2EWWA 4JBWA 1KKLA 1VTKA 4PPGA 3U4QB 3H2YA 2QROA 4DWJA 2ZS9A 2QN6A 1E2DA 1E2MA 4P32A 2BDTA 1T8UA 3V4RA 2RGAA 4RKFA 5LD2B 5FUYA 2AL7A 4RZUA 1CS4C 3UFFA 2B8WA 2EU8A 1FUKA 2YC2C 3B1ZA 3HR7A 3U7GA 4P4TA 3SHFA 1RRFA 3NBFA 2GJ8A 4JBXA 4V0ME 2G1KA 1UM8A 4A82A 2IS2A 3H4MA 1NG1A 1YR6A 2ZRLA 4IDQA 3EPHA 1GL7A 4TL7A 1S2MA 1MO5A 3A4NA 1F2TB 1E2PA 5FI0B 1NN1A 3A4LA 5G53C 3KFVA 1MRSA 2CHGA 4KFSA 4HSEA 3SFZA 2R6CA 1SZPA 1VG8A 3RC8A 3AF2A 5HZHA 2C2HA 4GP7A 3KQLA 1AKEA 2PL3A 2Z83A 2ZETA 3TUZC 4OI4A 2O8EA 4A6PA 2GEDA 5GJWC 2OZEA 3MJHA 3REFA 1T4GA 4W7SA 1HT1E 2IT1A 4AYXA 2HCJB 4A92A 2NPFA 2KBFA 4LYHA 4YMUA 3L2OB 3OEHD 1M34E 1SULA 5CLLA 2W58A 4TMVA 4D25A 4R7ZA 1PTRA 2IXGA 5BN4A 3WXMA 2JDIA 4B74A 2WWYA 2V4ZA 3CRW1 3NBXX 4KBGA 5DIFA 5B30A 3QSYA 4A15A 4CEIA 4ZDIA 1IQPA 1Q3HA 4I1VA 4DBLC 2REOA 1J70A 4LHVA 2QT0A 2R65A 5AR1A 2XZOA 4IVQA 5FTKA 2IWRA 4W9MC 2I1QA 2FPKA 4A2QA 4PO8A 1P72A 1Q20A 4ZDWA 3Q7PA 4XTRA 3I92A 1IN5A 3RDPA 2OLJA 1QHIA 1KBEA 3TKLA 4IOMA 4ESHA 1XXHE 3L0SA 2ZSBA 3OZXA 2ANBA 2O52A 3A58B 3BD9A 1G17A 1UKEA 4TLCA 2QPOA 3I3SR 3P4XA 1C1YA 3IHWA 2EW1A 4Q18A 1LFDB 5CIQA 1MRNA 3FB4A 3AVXA 2O8DB 5CITA 2HLDD 2PCLA 1KI9A 5L3SB 3TRFA 1RW4A 1CR2A 3QF7A 3B9QA 2C77A 1IN7A 3KKMA 3AKDA 2IC5A 1HURA 4IDNA 3AVPA 4D4MA 1QHNA 3AP1A 4MKFA 4Q66C 2HDNB 2FSFA 2GJAA 2R2AA 3EAQA 5HCIA 4DUGD 1OSNA 1H8ED 3L0PA 1M7GA 3FYHA 4KV9A 4CW7A 2D3WA 4EJSA 2JLVA 3R9WA 5M04A 4FWTA 1QG4A 1ZCAA 4NYJQ 3QG1A 2UZ3A 1GRQA 1AIPA 2GAOA 1AA9A 4LZZA 2TMKA 4URYR 5DN6D 3FTQA 4KYIB 4C0QC 2QENA 3QOFA 2GCNA 2OO7A 1R8QA 4FIDA 4GOKA 2ERYA 4JLOA 3A1VA 4PHGA 3W6PA 1NN5A 2NO7A 5EE5B 2FPLA 1GFIA 3A1UA 1TNDA 3GQBA 2JLXA 4Q9KA 1QBKC 1KSJA 2UVQA 3IIJA 1P62B 3KJGA 3AB3A 1S4QA 4DEXA 1ZD1A 3CXLA 1JR3E 2N46A 2VA8A 3UXMA 3DO6A 4DRZA 2IYSA 2O8CB 1NY6A 1F6BA 2VRWB 1P6XA 2JASA 2DFTA 4TYNA 2CDNA 3EC1A 5HE9A 4MGKR 2CHVA 3BOSA 5C18A 1NLFA 2WM9B 2A78A 3T1TA 2GVDC 4TSFD 4B48A 4NCIA 2FEOA 4DLZA 3PFIA 4D80A 1ZM4A 2JJ2A 3VKWA 3QE0A 1G16A 2KSQA 5FPHA 2G9NA 1GRNA 4QGFA 4BLSA 2XAUA 5KUTA 3GLGE 5EE0A 1U9IC 5KPJA 3GD7A 4QBFA 1E98A 1EXMA 1BYUA 1X8JA 5HR5A 2OBLA 4PSVA 1HUQA 1E6CA 3AF3A 5EP2A 3M6AA 3C5CA 3W8RA 4BZXA 2ORVA 4MKIA 3R7WB 1DAFA 2QUZA 2AD1A 5JJIA 1TF5A 2C04A 2JLRA 5TMPA 5CYPA 2OSBA 4NU0A 3K0FA 4PC2A 2ZSAA 4JS0A 3FKQA 1GOTA 1JJVA 2C99A 4LPKA 4QGGA 3ZIAD 3C4JA 2IWHA 3TSZA 2CL0X 4Z1MA 1J8MF 3OIWA 3K53A 4Q9IA 3UGLA 3AKCA 4LWZA 3ZS8A 4P4UA 5E7JA 3AGPA 1ZAKA 3QKRA 1R2QA 4RZ3A 5F9FA 1FPMA 2QQ0A 2BV3A 2A5FA 2YVUA 3KJEA 1KOFA 2EQBA 5JHHB 1D6JA 1DS6A 5D3MA 1RJ9A 1W2GA 3RC3A 1DO0A 1ZNXA 3PVSA 3VR4A 4L5BA 3P27A 1PUIA 1OFHA 4LJ5A 4PX9A 3UMRA 1FP6A 2RKOA 1DEKA 3F5FA 4AKEA 1N6LA 5EUQB 3GJ0A 1KGDA 2AK2A 3C7KA 2YKGA 4LHXA 4Z8XA 4A2WA 2J9RA 3W5IA 4Y0AA 4L9SA 1YR9A 3KKNA 5BQ5A 3ZS9A 3GLFA 3IILA 4FINA 3NG1A 2V3CC 4KFUA 2C9YA 4OQLA 1T9HA 3BH0A 4LUCA 5IK2A 3BB4A 2PLFA 3IBYA 2F1HA 1W46A 4Q1CA 3THXB 1N6RA 1E2HA 2BMFA 2REXB 1HA3A 4EPVA 4EPXA 1N6HA 4Q9HA 4X8MA 3LAWA 4DZZA 1N3BA 4R2HA 4WZAE 2FNFX 2BMDA 4C7OA 1T3SA 1NSFA 3AVUA 3GP8A 5TARA 3WP0A 3KQHA 5EXXA 3L43A 3HP1A 2NGRA 1W47A 2VP2A 3IIKA 1IN6A 4MUAA 1NBMD 2PCJA 4JVSB 1DO2A 4OJKA 1NVVR 2I3BA 2WIAA 1NN0A 3DHWC 5DI3B 1AQUA 4QFMA 4B43A 2H18A 1B0UA 4C0LA 1U0LA 2ZJOA 1E9SA 4DXAA 1FTSA 2H1LA 2W0SA 3ICEA 1KAGA 3NTUA 4S35A 3UWKA 2DWQA 4Q02A 2GCOA 3BC1A 1WQ1R 3B60A 3VHXA 3TJZA 1RE0A 3QQ5A 4XVRA 1VG1A 1KK2A 1YR8A 4DT1B 1XA6A 3FWYA 1WP9A 4V0MA 2KBEA 2ZRGA 4P3YA 4Q4HB 1XNJA 1Y8FA 1OKKD 2FA9A 4FI3C 5KTYA 2VHJA 4HUTA 2DPXA 3VNVA 1XCGB 3IBGA 1OB5A 5CB8A 2VQSA 4TYQA 3SYKA 1M6NA 1R0XA 4W5JA 2J46A 1Q22A 3FHTA 4N3NA 1Y3AA 2A30A 1FNMA 2O5VA 5FUVA 2A9KA 1R5NA 2N1BA 3EWSA 4YXWD 5CJPA 3N2IA 2O0KA 1S96A 1KHTA 4LBWA 4DLXA 4JVNA 1S9HA 1S3GA 2VHTA 4NDZA 2F9MA 1R8SA 3KXLA 1Y63A 2WJGA 3CZQA 1BYIA 1KNXA 5GVRA 4MDFA 3P20A 5TB5A 3WMFA 1NG9A 2XZLA 3LQQA 5IRCD 4ITRC 2JATA 2ZI7A 2KB0A 4Q7MB 1Z06A 2F43B 3KXIA 1JBKA 3TR0A 3C5HA 2Q3MA 4S2EA 3QBVA 2NO6A 3W6OA 2Q9BA 4B3BA 4F7WA 1SXJB 4PSKA 3GJ6A 3A1TA 2QG6A 2XXAB 1JR6A 5GADl 2PJZA 3GJ3A 2C8VA 3MCAA 1GIAA 3B85A 4XVUA 2AHOA 4AD8A 2CNWA 2YYZA 4GI7A 2FPMA 1UEJA 2QRZA 4Q01A 2QP4A 2BBSA 2BM0A 2ODNA 1KJYA 5F2EA 1VCOA 3HWSA 3P32A 4JLKA 4Q1DA 4EAQA 1N0WA 4DLVA 1COWA 1XXHA 4US1R 2BJWA 1R0ZA 4ZCMA 3N2EA 1HEIA 1P2SA 1G3QA 4YC7A 2CLSA 2EYQA 3E2IA 1WE2A 2PBRA 2JLYA 3QKSA 4UXJA 1CLUA 1N6OA 3WYAA 5HCNA 4BASA 2X77A 3RHFA 4D4KA 4US2R 1BMFA 2A2ZA 1X6VA 4NPHA 1TQ4A 2MSDB 4HAUA 3CX8A 1GILA 4TZ0A 1G3MA 4NMMA 1GZSA 1VKJA 2ZI9A 5JBQA 2A5JA 1HT2E 2BVNA 3EX7C 2BKUA 3IO3A 3EZ2A 1E1RA 4HAVA 1E2LA 2W00A 2DBYA 5B2ZA 4QNRA 3TSOA 1ZVQA 3SYLA 4B3CA 4JL5A 3MFYA 1IJEA 3BJIA 3HJNA 1T6NA 5FOSA 4XVQA 1GWNA 3ADCA 3CRQA 3ZDQA 4A8JB 4OQFA 3UGIA 4WXPA 3VHLB 1GDDA 2BMEA 3VR5A 4E22A 2AN9A 1P73A 5DYIA 2G0TA 4I1UA 5KSYA 3AQ4A 1KI4A 4JKIA 4TYPA 4GMDA 2ZVPX 2F9LA 2QTFA 2NOAA 2YV5A 4XH9B 4AKHA 2ZEJA 4C4PA 4JSYA 3SI7A 3T61A 3FFBA 4BQSA 4CEJA 2RB4A 1JR3A 5LDDC 4HUQA 2CNWD 3K9GA 1GNPA 2ZRHA 1NY5A 5JFGA 1W4RA 4JLDA 1PTQA 1EGAA 5EUMA 2WSMA 2HF8A 2VIIA 1S1CA 3GLHB 3VR1A 2PZGA 4IOLA 1CKEA 3OIVA 3CPHA 1E2JA 4KI0A 4A0FA 1AJEA 2SHKA 1NVWQ 4LCBA 5KNCA 3GEIA 3UK6A 5EZ5A 1OLOA 3W90A 2QM8A 3FFAA 3Q3JB 1BMFD 4JVMA 4LSGA 2FF7A 5DE3A 2OBMA 5KHOC 3GLGA 2ERXA 1N2CE 3KZ1E 1H65A 5JEDA 2ORIA 4I1OA 4AWXA 2ZRCA 4FCTA 1E9CA 4NBSA 2WMOB 4B3XA 3I32A 4UJ3A 1Z28A 4BPBA
chains in the Genus database with same CATH superfamily
4OYRA 3FSGD 4MUEA 5KYUA 2SKCA 4OMCA 5D51S 1OAAA 1BRMA 1TRHA 2VXYA 2XOXA 2K5UA 3P0EA 4P7JA 2PPLA 2Q4OA 4NNJA 4TKUB 4IG4A 3O2JA 4TV8F 1E60A 5H9VA 5BNZA 5ICEA 1SUAA 2Q8QA 3NPMA 4Y6RA 4DR1B 4U2CA 2ZS8A 4MVJA 2A57A 3FMVA 1R0LA 4A2PA 4PN7A 4Q1BA 1KPIA 2A6PA 4DEYA 2WYIA 4TUYB 2QP9X 2QTBA 4M7WA 4ZTZB 1OWMA 1XPUA 4R6XA 2IUFA 2Z4SA 5JU6A 3NBAA 3VR3D 3NPAA 1NQOA 3BRSA 3PHCA 2QZ9A 1AM4D 1KZYC 1R6TA 3D2LA 4IH4A 2AG5A 5KBYA 1WP4A 1K2WA 4YHHB 2HF9A 4JOSA 1FSSA 1GGMA 4X44A 2R4QA 4N1AA 1F3LA 1KDPA 2F6RA 1XAJA 3EBLA 1EB9A 2JGKA 4A9AA 3JZIA 1E1QD 1ML4A 5JAQA 4MA5A 1SQ0A 3UH0A 2ZRJA 3AQIA 2WC1A 3EPLA 2NUTB 2ASVA 2QRVB 4P98A 2UU9B 4GXRA 1RBZA 4ASUA 1FP4B 4G86A 3MRXA 1GZ7A 1TU4A 1YT5A 4G81A 3TAXA 3UY4A 4G24A 1H1LB 5FBRB 4NDNE 4BNUA 2PYZA 3JQ9C 3V4ZA 3D7KA 3LT4A 3AJEA 3RRYA 4LTNA 2HT6A 1JQ5A 3C7CB 3TLZA 3IKMB 3ELYA 4UFNA 1CUIA 5DLDA 4COKA 4NZMA 5BY2A 4KWEA 2VYNA 2WIBA 2WPDA 3C98A 3GAAA 1IB0A 4ISBA 4NJEA 2BISA 1E79A 3IUEA 5FNVF 1DXOA 2J4DA 1XU9A 2R1VA 2BFBA 1TBRR 1LWOA 1LLFA 4IY1A 2GJSA 3GYGA 5DWDA 2QAGA 4RD4A 3VDNB 1Y8QA 2ZSIA 2AC4A 2FAXA 5CJ2A 1AZLA 1CXZA 4IIEA 4WZAA 5JTTA 1B8PA 3E5MA 3TGLA 3R0IA 4EY5A 1AQNA 3EIOA 2HU7A 1IY5A 4JUIA 1YCFA 2M6RA 3ICCA 3X1XA 1VA4A 13PKA 2IKSA 3NIBA 4X6LA 2G36A 2H5JA 3L1JA 1K5DA 2FW0A 4LVCA 5DLEA 5EUCA 1S3SA 4KNVA 2CN1A 3Q5GA 4JC4A 2W71A 3HH2C 1M1XB 2Z04A 3PIRA 5AVJA 5DNYB 1M8PA 3K96A 4C29A 3IEKA 4ZPXA 3SSNA 3QEBZ 2PLRA 2J3KA 1V1RA 3F67A 1SGPI 3FZGA 5DRTA 4MRPA 3DDUA 3B38A 1VKOA 1ZGAA 3O3OB 3U3OA 4MS1B 5JV5A 4H3VA 1P6UA 4UMFA 5JH7A 3TE6A 4J1QA 3GHHA 2GSWA 3CY6A 1F1BA 1KZHA 1G20B 2AK3A 2JS7A 3U3DA 2VLBA 3UK2A 3G5MA 2VDPB 2OD1A 4MJXA 3EVDA 4N47A 2O07A 1U3CA 3GVIA 3PVZA 1PR4A 1UDWA 3LLCA 3VDPA 1RLOA 3CX6A 4NAHA 3ZDXB 4MTLA 1BDBA 1TK9A 4KDRA 1ONBA 4JJAA 2QIOA 2EWVA 1PL6A 5IJWA 3FSEA 3DMFA 2XWSA 1RDFA 1XDWA 3V4LA 4C1NA 2VDKB 2XWBF 2C7BA 2EJUA 1AQIA 4PO1A 5AJUA 1GNQA 1MJGA 2VEDA 2FWAA 5B2FA 4KRXA 3SEZA 1KEKA 4LF9B 4ARIA 1WZCA 1I1QB 3OT5A 4D02A 2JCYA 3K0AB 4DY4A 2TSYB 3ZHSA 3N2GB 2XT6A 3MRSA 1U1FA 1ZK3A 3MTGA 3OIUA 3ZQKA 4Z4QA 1E5QA 4B71A 1PK7A 2IOFK 1KBFA 5L4SA 2HIMA 1ZRSA 3PTAA 2ZYWX 2EZTA 3C6YA 3TINA 3HUUA 2D06A 1HSZA 2RH8A 1IIBA 1PWHA 4KQCA 1T3GA 1JJ7A 1L6IA 4MVYA 2HADA 2W6JD 5C80A 2D2FA 3S2IA 2Q7XA 4FWBA 3NHZA 2A67A 2WU4A 2CJXA 2XKAA 3AY0A 3HHPA 4FFPA 4HSGA 1A82A 3TD6A 2CEKA 2QLNA 1XFAA 1QIIA 1QUFA 3QH4A 3D1JA 1UJ2A 3TD2A 4RVGA 4EGAA 5BWNA 4AJHA 3PD7A 2XZPA 4ER6A 4FJ1A 3RKUA 3WGGA 2ZSDA 1IXSB 1T9ZA 2IU4A 4GWGA 1ZO8A 2F1OA 1ZM3A 4EWLA 3HRKA 2IY7A 4P2BA 5L45A 1KSFX 1E0SA 4XQEA 5FV4A 3KPYA 1K5PA 2NG1A 5C9ZA 5H82A 2XRZA 4LS3A 2EBWA 4AB1A 1U80A 1AK1A 3Q3HA 4MS3B 4CM3A 1EZZA 1NE7A 1V37A 4QOJA 2OCXA 3H3FA 4XYGA 3KJIA 4NATA 3C1UA 4CMKA 1PR2A 1OFIA 1JVNA 2RCNA 2B9VA 4W5HA 4KDEA 4XOIA 5AHOA 1OMTA 1XDDA 1N13A 1SXHA 3L79A 2A9QA 3T7RA 2ZUTA 3ENZA 4LJYA 4GI5A 1G21E 1IDOA 5LYJA 1VYVA 4EYGA 4QBGB 4F5DA 3UHFA 5CX1B 5A9RA 3CNNA 3GYBA 3U60B 2YWXA 1RYFA 5KWJA 3ONFA 1PN3A 2EQAA 3NVAA 1JW9B 2WFLB 5ERXA 1L5MA 1M2OB 5ILOA 1TW3A 3ICWA 4MVJI 5DGHA 5GZ3A 4QLAA 3RU9A 1S02A 2PAFA 4WSOA 2BFWA 1AO0A 3SKXA 2O6HA 3H2IA 3PCTA 4JWKA 4G1MB 2GAIA 1T5SA 5DM1A 3RYHA 3UVEA 2QMOA 2OHOA 3PDUA 4A27A 2GNPA 4EHLA 1E6UA 2OYSA 4O02B 2H52A 1X77A 1FW8A 2WICA 3HPRA 3G7SA 4XD7D 3O1IC 2BFFA 4UDXX 4OXKA 1X8LA 5AESA 1WCV1 3NBQA 1YZTA 1BE0A 5F3DA 3DT8A 4YJFA 4KOEC 1GFWA 1T3LA 4HPWA 3VTKA 2UUOA 4YRBA 3ED5A 3OM9A 4KU4A 4A8HA 4F21A 1Z2NX 1ZP6A 3STWA 4CKCA 3JYPA 3H86A 1DC4A 3QTBA 1SGEI 4LQLA 3RNOA 2PZBA 2QEQA 1YDHA 4KSBA 5LZ5A 2H5LA 3HKEA 4YCJA 2JZNA 4PO9A 1RSZA 3DCIA 3RUHA 2Q4DA 4WTOA 3E8SA 1M7HA 1W49A 3U40A 3CZMA 1D07A 2ZXFA 1ODKA 4MWZA 2GBCA 2OQ2A 4OMUA 4XIJA 1GNLA 3GG2A 3WRYC 5AP9A 1YKSA 5C46F 3EZYA 5LJLA 2ZZNA 1EIWA 1Z29A 1L8QA 3QY0A 1DCTA 2CZGA 2EVWX 3OUZA 4PYJA 1I4TD 1E58A 1X86B 3PITA 5E0OA 3UKJA 2WSSA 3L8ZA 3LQRA 5LN1A 2E7ZA 3AB7A 2VNKA 3O73A 5HZGA 3DP7A 2XB6A 4GEKA 5KAPA 5L7WA 4ZRMA 5K8JB 4Q4AA 1I33A 2JIMA 3AR9A 3NI2A 2YV2A 2M32A 4J0JA 4D81A 2EOAA 3MG9A 1SPXA 4TT3A 3TCNA 1GA6A 4D9FA 5AI8A 1EE1A 4O4HA 4EHAA 1THZA 4AP6A 1HDIA 3VMMA 3VC2A 3MPUA 1GNTA 3WNCA 3DOCA 5BQ3A 3MRTA 1ZK2A 4S12A 4DB4A 2Z5FA 1JLMA 2F1RA 4V0NA 2R85A 1C41A 1TRKA 3VX3A 1P8AA 1WU7A 3WB9A 8MHTA 1F9AA 2G9QA 3PT9A 1EG2A 1QHHA 1S0UA 5EAIA 3ELUA 5J58A 2IIVA 1E59A 4DDTA 2P1DA 2PN1A 1YRQA 5FBQB 3V8QA 1IULA 1RHJA 3OURA 1JQ3A 2JFPA 2UVPB 4MWDA 5U1PA 3WBBA 4HDMB 1RACA 3N2YA 5LP1A 1GZ5A 3ND7A 3EXIA 3SVTA 4CEHA 3SZ3A 1XNRB 2NPIA 3H04A 1XOIA 1XSEA 4Y2UA 4CLDA 1GZ4A 4I8DA 5E95A 4AL4A 4XD2A 3GVHA 1LNSA 1FNDA 2VHEA 2PV0A 2Z8ZA 1R4NA 1KJZA 5K8IA 1G7SA 4MUFA 4G0QA 1Z4KA 2ZJBA 1NURA 4FFBB 4HGUA 5JHWC 1XZKA 5EIHA 2Z43A 2HU2A 1S01A 3O8OA 1PNOA 1ZKMA 3PC6A 4MYCA 1ACMA 4ZRDA 4TZ6A 3OCYA 4BUJA 2BOVA 2ZXEA 1J0BA 2AMVA 3T0GA 2G09A 3LPAA 1ATZA 1JHMA 1SGNI 1Z73A 4NNPA 2DF8A 5K3SA 1N8KA 4ZOLB 1NW9B 2PT5A 4KQJA 2J32A 1E9DA 5EP3A 4D42A 4K0RA 1JQLB 2FTKE 3CH4B 1D2EA 5FYQA 5CIYA 4WEQA 2XKKA 3KQNA 2GZ1A 1RQPA 1YBHA 3S5UA 3DEZA 4MK4A 4ZYYA 1ULSA 3OZDA 2AR9A 1MH1A 1L5HA 1L4KA 3D6NB 1K89A 1FSZA 1WUKS 4X1YB 5AVXA 1KEEB 2MWMA 4IJMA 1CJBA 3DONA 4HTAA 4PNHA 3WYEA 2ZROA 4ZVUA 5KU7A 3FUCA 4JB8A 2M6LA 1NI4B 1L5RA 3RT7A 4TPKA 2FUG6 1K75A 4AFNA 2J5BA 2BBTA 3OVOA 2NSJA 4FDMA 2D1QA 3V1LA 3L6BA 2I1LA 3A1EA 3BJRA 1J4AA 3G0OA 5CDUA 1L4HA 1RYEA 4CGZA 3DZGA 5H5JA 1MC1A 1WSBA 3I12A 3LWZA 1N78A 2FG6C 1MOZA 4DJTA 2R6HA 1S2NA 2QTVA 1F20A 1LQTA 3BM5A 1U63A 3CUSA 3L7CA 2E4ZA 2BGLA 2GRAA 3LVRE 3QJ5A 4P08A 3DV0B 5D3MB 3HBLA 1DMSA 5CIWA 3TDNA 4CIWA 3V8RA 3I45A 3PP8A 3ZY4A 5BMVB 3OTOB 4P4SA 4V0KA 1VMIA 1SUWA 4WE3A 4L08A 3VVMA 4DLTA 2G9VA 4W82A 3LYUA 2REBA 4BLTA 1P45A 1E6MA 3KQQA 1A5AB 1IRIA 4MV7A 4RV5A 3T4UA 2UZIR 1MN6A 1YQQA 4WBNF 2O4CA 3BMCA 4B5LA 4Q1VA 1GFZA 1SBCA 2QRHA 4A16A 3FTFA 4C4ZA 3FAZA 2IIQA 4P7BA 1TFRA 2IGTA 3MWKA 4Q12A 1TLFA 3TFQA 2YZ2A 6Q21A 4CMIB 4OK6A 5FI1B 2BEUA 4WV3A 5GP1A 5CFQA 3GLFB 1HDGO 2NV6A 3N0VA 1E4EA 3E7DA 2QAIA 1ZJ5A 3PZRA 4FFLA 4LMAA 4OQ4A 4B33A 4CIVA 4UBKA 4EEKA 1JNYA 1F9EA 1ZMRA 1YXMA 2F00A 2OV8A 3CEJA 3KP1A 3R7SA 2AUNA 3GRUA 5CT6A 5JCZA 3ZW9A 1GQRA 2F1JA 1QYWA 3WNVA 5LNK6 3TPFA 3IXQA 3CBQA 1IZYA 3ET4A 1K9VF 3IQWA 1T4BA 1Y33E 1WZNA 1VIAA 2X1HA 3KM0A 2CXSA 3RRMA 3KEFA 3II6X 3OJCA 5HFNA 4J3NA 1H0HA 4BFZA 4EATA 1JF8A 2BFOA 1WMEA 3CGGA 2AR7A 3LHFA 2CHFA 2GM3A 4RAOA 2XY4A 3TXYA 2C03A 4L9MA 1NUSA 2ZS7A 3KHSA 4MXDA 2FMXA 4OSEA 3HDVA 1E89A 2JLAA 4BEWA 3LOPA 3W79A 5FKJA 2PJRA 3AF4A 4R1UA 2H59A 4X63A 4QDOA 1ODCA 3E15A 3VUFA 3O8NA 5ICMA 3HCFA 3QAHA 2QZJA 4JYZA 1JPJA 1LRJA 3OJXA 2XSZA 3T52A 3UHOA 1RXVA 4FMDF 4BS9A 4HNHA 1V2GA 1WHSB 5JXHA 1WABA 1EESA 5FLEX 3GGSA 4FMCF 2JKYA 2GCOB 3KCQA 2OAEA 3AEQA 3A25A 4HR7A 4M1YA 4RNDB 2ISQA 3MOGA 2JI8A 4DPKA 3DKKA 5GTDA 2IXEA 2Q2QA 3PLNA 1VKHA 5FWAA 3ZOKA 1MP0A 4P3NA 2YX1A 4K2HA 3ZUPA 5T3UA 4TRMA 3R7NA 3VH4A 3Q0EA 4P33A 2Y05A 3BXFA 1KVTA 3M3PA 4UHKA 1Q1QA 2Y1KA 4Y6OA 1U1DA 3IA7A 4RLFA 4HFJA 3D6TB 2H2FA 4J1NA 5HUJA 3FOEC 4QJ4A 2ZRIA 3KUDA 3WK4A 3ZE6A 3QIAA 1OXXK 1ZD3A 4LNUA 1PT9A 2Q5FA 4UM8B 4US0R 4CQJA 4RE5A 1DAOA 1NULA 2J87A 4UNQA 2P3OA 3SY8A 1P91A 3ZE9A 4HN2A 1E8NA 4I4TF 1Y1PA 1P8JA 4R51A 1JQKA 2AFIE 3SXUB 3G1UA 2JRCA 3PL5A 3RG2A 3WAKA 4DLRA 4ZAWA 1N57A 3BN3A 4UU0A 1J2YA 2FB9A 3EVCA 5H7XA 4AJNA 3IVMA 1U5BB 4XJVA 1K06A 1X3SA 1X7WA 2WYWA 5LXTB 1ORVA 5JDCC 2PX4A 5TQVA 4Q9AA 1DAMA 4TMWA 1Z63A 1G21A 2IE0A 3OZUA 2XQFA 3I52A 1Y89A 3BSYA 4WXMA 2AUMA 3TECE 5ISMA 4A0HA 2Q5LA 3M4XA 1GQYA 3DFKA 4M8LA 2I6TA 5D85A 2EFEB 5LB2A 5HMLA 1W34A 2YWCA 3NBMA 4IHAA 2PS9A 5ITZA 1SVMA 1Z2IA 1EK6A 2CBXA 2IXFA 2WHPB 1NHGA 3CRZA 3KYJB 4KQXA 3PICA 1AF7A 4ZEWA 3RE1A 1FXWF 3V8NA 3WGKA 4TV8B 3H7IA 4MV3A 5JS1A 5CNJA 1BX1A 1MORA 1XAIA 3G8BA 4V3BA 3V9PA 3W7BA 4H1WA 3KETA 4Y6QA 3ZE8A 3X1MA 3ZHBA 1CUWA 4J94A 4CRWB 5EHIA 1X8XA 4U7FA 3S68A 4LZNA 4Q1EA 2C9MA 2CWWA 2GBLA 3H1PA 4LIPD 2GKSA 4OAOA 4RPGA 1E8MA 4HS9A 1YCDA 3VNRA 4BWGA 1QYDA 4DG8A 4KYTA 2MSKA 2CLLB 2QN9A 2R48A 4MMZB 1R0KA 2QRLA 4CCAA 1TAUA 1WDMA 3MPOA 2ORWA 2OGWA 3S55A 4G0OA 4UVHA 5BW4A 1M34A 3WISA 3WTBA 4BNIA 1F5NA 2ZUBA 1FMJA 3CZRA 3G0GA 4E08A 4L28A 2ZAOA 1WIWA 5AKEA 5KTKA 4NTZA 3EIHA 4HFMA 2QTNA 3ANXA 3PNBA 3VKFA 2HWYA 2WI8A 3JVIA 3AH8A 4IYJA 1USIA 1K5GA 2OCBA 5DXAA 2Z57A 1S9DA 1FDTA 2ANCA 4OJMX 1E0KA 1Z22A 3BB1A 5LYYA 2FN9A 4MWGA 1UP7A 3NUQA 2C5HA 1PSZA 4YV1A 2FJUA 4WLEA 1NUQA 4H7EA 4YPVA 1JG3A 1V39A 1XQ9A 1Y4AE 2RFLA 3H2KA 1I2ZA 3SDBA 1Y9DA 1RJFA 1DDOA 5CLJA 4FILA 5EJ2A 4F3TA 4M1MA 5KDDA 2W7TA 1Z83A 4A6XA 2ONKA 4IH9A 1R5JA 4F3KA 2GKVA 4F8EA 3IP8A 4B3MB 1TUBB 3ILSA 4ZAFA 2P1ZA 3LZ6A 2ZIEA 3QKWA 5J40A 1U8CB 5FNVB 1A2QA 4MDHA 4ZDKA 4WZZA 3K2EA 3KQUA 4G4IA 1E3TA 4JJZA 2LZ0A 3HI6A 4ZAZA 4BU0A 5AI4A 1QRTA 2K2QB 2B92A 2ZVQX 1NVGA 4MI3A 4X8HA 5KS2A 4FHGA 4MP3A 3MWFA 1VRWA 4Q9DA 3AF1A 2X86A 3FNGA 1QIKA 3PC7A 3WBKA 4ZQBA 4R81A 4Q6BA 5AW1A 2KW5A 2WSIA 3O1LA 1ZR2A 2W2KB 4ZKEA 5JNSA 4IV5A 4YRCA 2FNAA 3ID6C 3OWXA 4A3SA 3HVKA 1L5FA 4N3BA 4RESA 5FTJA 3OOEA 2FW9A 4FHEA 4ZAGA 4RIGA 4CDGA 1TGSI 4IQ8A 1HDXA 4CEJB 5FPKA 4XXHA 4QOFA 3D02A 4LJ4A 4UVIA 1G59A 4MR8A 2SGFI 3BWDD 2O3JA 4OL9A 1OV4A 4JP2A 2OGSA 5TY0A 3W8NA 1PAUA 4GOOD 1JFFB 3QFCA 5KVAA 4DHWA 3L8HA 2Y8EA 2I7XA 1TM1E 4RD2A 3C3BA 2ATXA 3PQEA 4L8YA 4X00A 4A6DA 3C15C 4E31A 1QONA 3RRZA 3F9CA 5E8RA 2J7PA 2N0SA 3BD7A 4OK5A 1VL2A 1CHDA 3A6GA 1H6CA 5L7YA 2XXAA 3C3AA 3L9WA 4WL0A 3WZ2A 1CE8B 3T7KA 4FTWA 4DHEA 3KQKA 1IXRC 3R09A 5F4ZA 2P2SA 2RIJA 3V42A 3S7ZA 3UIEA 3RQSA 1CJVC 4JI7B 1AB5A 3DWGA 4DM4A 2Q4TA 3TQRA 3WJAA 4BO2A 3HA3A 2HC9A 4TTRA 2J09A 4Z8YA 2VTBB 1SGDI 2ES4A 4A36A 2V8BA 1VCHA 2WWRA 1RQ7A 1M8GA 1JIVA 2GYWA 2QR3A 2VZEA 4FGZA 1M1NB 5DSZA 5EQDA 9LDBA 4HF7A 3RBVA 1ZA1A 2KPOA 1CQIA 1RCTE 1YFZA 4Q4DA 4X20B 5EX0A 5K8UA 1TTTA 1RPJA 3UUGA 1G8YA 4PRYA 4G67A 3FZYA 2OEPA 1EBFA 1KYVA 2C2ZA 2XDYA 3DC2A 4D7AA 4BMOB 1YB2A 2YMQA 3JQGA 4LRUA 1UOPA 1O5TA 1YHNA 3G1TA 4AZSA 1EH5A 1HQYE 1FPQA 1RHRA 4BMXA 3BICA 3B6MA 5A4JA 1Z5ZA 2FQXA 5FOXA 1C80A 5AJZA 1KMQA 3Q7IA 4UMVA 3AEKA 3C3DA 3C1AA 3CNOA 3S1AA 1FFEA 1Y5IA 3AK4A 3KPWA 2PEZA 5L3QA 3K8ZA 2O7SA 2WUVA 2X4DA 3KQTA 5B1DA 3UA4A 3LFUA 1A9RA 1MRZA 3GLIB 5BWLA 4TWZA 3GRYA 5ESWA 3FDZB 3VYRB 2WFZA 3NWPA 3VPBA 2JFXA 2J4FA 2WIGA 3A3KA 1U0JA 4HRVA 3WGYA 4D82A 2JGDB 1H2HA 2I0FA 3B1WA 5FB3A 1H66A 1FEZA 3TZQA 5LJIA 2VHYA 2JVJA 1R6XA 1Q77A 2QOEA 3PYLA 5TVGA 2WWIA 4B46A 2C2OA 3E4CA 2YRXA 5A9SA 5KHAA 2VUSA 3IL2A 3NP9A 4AP9A 3OL0A 5DHRA 2IW3A 4HFRA 2DTDA 3SC3A 1ESEA 1BSVA 1U2QA 3H0CA 4RQUA 5JSQA 4EPTA 2XI4A 1AUXA 2RKBA 3AI2A 4Z54A 3PEUA 5MGNA 1R3DA 4BO9A 2PUFA 3TOXA 2P9TA 1PQPA 1W0JA 5EFZA 4LXGA 4R1TA 4YJHA 3DPSA 3VYUB 3UWOA 4PU0A 1SR8A 1TYAE 3WOVA 2FJPA 1RLTA 7AT1A 3E9DA 4CNBA 3GFQA 3RNLA 1RHUA 5DCUA 3DZCA 5C2JB 3E3AA 3RS7A 4E03A 1KZ6A 4JZYA 1IEQA 3UOWA 1REQB 4CLRA 2YRFA 2RH4A 1SHZA 2Q27A 3AFNA 3E6AA 4WK6A 3ER9A 2P6RA 2PSSA 4G0VA 2HSGA 2BONA 3LX8A 1GTMA 4RDIA 1VKRA 1YZUA 2CLHB 3CO5A 3GJ4A 2ZI5A 2ZBEA 4RU1A 5IXJA 4XFJA 1SKQA 1RCFA 3I6MA 2O1WA 3D3QA 2FLVA 3HBFA 3Q12A 4MRVA 3W9UA 1WKBA 1SG0A 1TECE 1JYFA 2DY1A 1RZVA 5E7QA 1KAQA 2C0PA 3IX7A 3DGFC 5ILGA 1ECPA 2XTNA 1P0IA 3T15A 1G5FA 1N5IA 4JX8A 5T67A 3BF8A 1XHEA 1U3DA 1T1SA 1CW2B 3BWYA 3M4YA 4QOEA 2VP9A 2ZSKA 4PFJA 5DGCA 2FK7A 1PLLA 2ZTMA 4G09A 1H2XA 2GVZC 4XCXA 4EPWA 4ALJA 1P2GA 1NXVA 2BI7A 3TLGB 4P5DA 4R3WA 3EZXA 2I6FA 2HRRA 1E2GA 2Y27A 4HB3A 1C9YA 1IUPA 1H8HA 3RVRA 4BFSA 1ZHOA 4OHKA 4KODA 4QRHA 2P77A 4AN4A 4URVR 2CJPA 1BC5A 4P92A 3WA7A 4ZYLA 2E5LB 5IBPA 3P52A 5GPBA 1WCIA 2XW6A 4ZEOA 4OQZA 3GGGA 4BQRA 1E3EA 1WM1A 3QXXA 4KAXA 3H3XA 3OAAA 4M89A 1KGSA 5CLFA 4NZYA 4XIYA 5L8VA 3W6UA 3WRXA 4AY6A 3CLRD 1X80B 2C5FA 2RHBA 1G38A 3TZ6A 3L8FA 4GDFA 4EB0A 2HRBA 1YDGA 1KY2A 2E9SA 2PLWA 3EUFA 4G5RA 4E1AA 4Y6LA 4YP7A 3F7TA 4J4TA 2V0NA 4FYHA 3TTXA 2G17A 5F52A 2ODTX 4WCFA 4C01A 5EFOA 1GTSA 1SKYE 3SDSA 4KNWA 1WW8A 1NJ1A 4ME6A 2YBDA 3DAFA 4IDDA 4MVJD 1R4ZA 1LV8A 3AG5A 1CT4I 1GD1O 4M6WA 5H68A 3LDGA 1CDDA 1JAYA 2QYHA 3NOQA 1KL7A 1KJWA 3T5BA 1ISHA 1XA3A 2AFIA 2O5RA 2VAWA 3L93A 3MD9A 1G6OA 3KOOA 3ORFA 3PPYA 2CCJA 2RMKA 3T9AA 3TFOA 4F97A 4ZMSA 1DWUA 2G83A 5F23A 2OVFA 3JQFC 2FE4A 2XDWA 4QUIA 3QHAA 1ISSA 2O06A 5DBFA 3K8YA 4R2KA 2IUSA 3LF2A 5G0UA 2FSHA 4ID3A 4E5YA 1DG3A 2FPGB 4KO2S 4CTMA 4WERA 2HO4A 2HNKA 5G0VA 3CCBA 3IPYA 2ZAYA 3GRAA 5GONF 3H6HA 3MJRA 3UHJA 1WVIA 4C22A 4ASUD 2ECOA 3IPXA 3TO7A 1PG5A 4P93A 3H2BA 4RD3A 5E6SB 2VDJA 2BFEA 1MO3A 1KU6A 2JCXA 3I6ZA 2ZBPA 3IKJA 1T9GS 3FLBA 3LHDA 4P0TA 3WG9A 2JJQA 3RYCB 5EL0A 4GP9A 1I36A 5CVDA 3THWB 1TPZA 3VHQA 2QT9A 5REQB 3H8SA 2QW0X 2IYAA 1OXVA 3CLUC 3K20A 3IKVA 4YJ3F 5JQGA 5JSZB 4DUZB 1L7VC 2H2IA 4MVJF 2C3PA 7REQA 3IGFA 4BLUA 3V1UA 1LLCA 5JWOA 2A5LA 2P3LA 2OT3B 3UT5A 2XCIA 4LZLA 4AUEA 1A27A 2XYRA 1Y3HA 2Q5EA 3D2CA 1K88A 4Z99A 3NWOA 5FBHA 3TCXB 4BNVA 1DT5A 1EUDB 1GPNA 2QTCA 3GN2A 5KMGB 2WJHA 1FOEB 5SY6A 4RY2A 3WL3A 4QYTA 1TAHA 4WCFC 4RCZA 4BNXA 2W2OA 2BTQB 2M2IA 2W22A 3I5MA 1CY1A 3BCHA 2IX3A 1JDPA 1WBBA 4ZCSA 2RDMA 1I0ZA 2WLSA 2N1MA 2QG9A 2OAQ1 1IEWA 3ZN2A 4AI6A 1CSEE 1MXHA 5FOVA 2BRUA 3QPCA 5LBIA 4TN1A 1P7VA 2XB8A 4BN5A 4IXMA 2F55A 4H7KA 1ECBA 1XD2B 1XJ0A 2V7XA 2ZJ4A 1E9VA 1KORA 3HA2A 3A4MA 3ECAA 1FQJA 4JELA 4D3SA 1JU3A 2BDEA 2NADA 1X7ZA 3ADOA 3IEXA 4XWOA 5ABPA 3CPJB 5E2AA 4B47A 1NVFA 2IF2A 1VP9A 3O82A 4X0EA 4CM4A 4AZ0B 1RAGA 1CUFA 1W87A 3K1TA 3SX4A 1HDCA 1QTRA 5CA1A 4JDUA 1SHKA 2J0UB 1PJ4A 4H9GA 5JW6A 4WOKA 3I9OA 1O9BA 4Y2PA 4Q3EA 2DFDA 4HS4A 4YJDA 3RIXA 4MQLA 4IOJA 1LCIA 2EFDB 4J0IA 4BLVA 2O2GA 4CMGA 3PDNA 3K1JA 4RH3A 3O84A 4JP5A 1B3RA 4JLNA 1RYHA 5CDSA 5AW7A 1NUBA 3K1YA 4AO7A 1P9RA 3ZI0A 4E4YA 4IEEA 5D1NA 1I5EA 2X3YA 2X5KO 4URWR 5D00A 4D4LA 3F4KA 2MHCA 4QYXA 1HZZA 2PIDA 4RF3A 5DEOA 3ZXUB 3Q8MA 3MJCA 3VHRA 1RFLA 4LN1A 4O1MA 2Q62A 2HZBA 1SO8A 2A14A 4R2IA 4QOHA 2MT9A 4YRGA 1QBGA 1DVRA 3I3OA 4JOBA 2XQJA 1MJ9A 5FD8A 1U0RA 3NV9A 3ESBA 2BCGY 2FFHA 1SD1A 2ZJYA 3I73A 3WL7A 5IH7A 2OV2A 1L5ZA 5JH7F 2A35A 4C0BA 2VUHB 3UATA 3TK1A 1H1DA 5F9HA 4Y8VA 4NULA 1FDOA 3B1XA 4P86A 1SJ9A 3RD5A 3CTPA 4LRQA 1Q0QA 1RD4A 2NQ8A 2H4YA 1J9ZA 4CV0A 1R9NA 2VF2A 4MULA 2BRUC 1GVHA 4FFDA 5EUBA 4BLRA 3WOHA 2OV3A 3FLMA 3L7IA 4HLDA 3PUJA 2QGNA 2Q1XA 3AWDA 4IBOA 1K1EA 4KLCA 1XD8A 2G08A 2XTMA 3HJGA 3QYJA 5TQ2A 2V58A 2RGEA 4JVOA 2YJ5A 3MOSA 2XMQA 3HR4A 5DAEA 2ZTHA 5IDXA 5LU8A 3JSXA 1LPAB 1Q1GA 2HK8A 1OHHD 1WR8A 2NUAA 4B7XA 2E6UX 4BLPA 4BYMA 1OBFO 4EJSB 1X74A 3H5IA 1EWTA 3TMAA 3GARA 3C5EA 1EX6A 1VKZA 3DTVA 4AQ7A 2C1ZA 3FR7A 1CEYA 2B20A 2PRIA 3KRTA 4FMCB 2QRGA 1IIRA 1N6PA 3ANSA 3WZLA 1NV8A 2BBWA 1WB9A 3HN7A 2BMAA 3IUBA 4JEIA 4WD3A 4Q4LA 1QZZA 3IMCA 2HMSA 2V4MA 2UZAA 3QVUA 3R6DA 4MVJM 4O2LA 1DARA 4KUEA 4PIVA 221PA 5CB4F 2GAAA 5FBKA 2V6BA 4BWFB 1ZHHA 1JDTA 1TL7C 1E2KA 3B13B 4NF2A 4Q7LA 2VDLB 4DRYA 2IFTA 2DYKA 4L78A 4Q19A 3S2GA 1HZZC 4CKXA 1VG0B 1YF3A 1JR2A 2GT1A 3BIOA 1ZOLA 3QLVC 4HWOA 5TMBA 1LLUA 2AZMA 3RU3A 3SNKA 1FLDA 1OYWA 1ZI6A 1TUGA 4MR7A 3MWLA 2N75A 4TQAA 1W5BA 1EAMA 4UE3S 1K9SA 3LMKA 4AJ2A 5EIOA 4H6VA 2AE1A 2Q6IA 3BKXA 4BNJA 3QGMA 2CXPA 4RJKA 5IMBA 1TXGA 2VJPA 5JNTA 1V16A 5AOVA 4B83A 4CL3A 5AM4A 4I4TB 1WUTA 2GHRA 2O3RA 1WDKA 1I80A 2GRUA 3OPVA 3SDZA 1ZW6A 1TEXA 4HDAA 4AMVA 4KP7A 3LKBA 4IMPA 1CZRA 2OL4A 2R6FA 4RTSA 9GPBA 2R8RA 3BXOA 3DZDA 4R54A 1VYTA 3AZQA 3C3PA 3RH0A 2RBGA 4EF6A 3AR4A 1R16A 2J6HA 5EQJB 4DSNA 3KBBA 5CNMA 5H3CA 1DPGA 1TVMA 3F6BX 3HN6A 4ACAA 1I1HA 5F64A 4B0OA 1H93A 3ZYCA 5LYJF 1J09A 2FPIA 2UZ1B 2QM3A 3BZBA 1RIFA 3N3BC 1V5WA 4B0PA 3R5AA 3T9CA 1D0VA 2WSSD 3RUEA 1CF4A 1KRHA 3PGXA 1QIGA 4NCXA 3NTXA 4YONB 4QUAA 3BMXA 3ZTYA 1ID8A 2CUKA 1P18A 2V98A 2PS1A 3O4JA 2UXBB 2ST1A 1Z7BA 1ZH0A 4GSYA 4PYMA 3WRVA 1KI8A 1G291 5EJ6A 1M5TA 3PE6A 3ECCA 3AOEC 3NQ41 1U94A 3LO8A 3PRYA 3OJEA 2HAEA 3HGMA 4N48A 1SUIA 2XHZA 3MB5A 4JI1B 1Y4SA 2WTMA 1MENA 2B61A 2VK2A 3LW8A 4PGAA 4CZ2A 5H16A 3IRVA 2I4TA 5JANA 2QYSA 4MPRA 5G40A 2VXCA 2YFKA 2VF7A 1QR2A 2BH9A 5B3AA 3UJHA 1T26A 3D3KA 3HB1A 3G2IA 3C16C 4RKYA 1UJCA 3SQDA 2NZ2A 4X6UA 2BH2A 3EF1A 4NIMA 3THYB 5KVSA 3AM1A 2GSDA 3PDJA 3UB2A 3TQQA 4CNQA 2DQSA 1R0CA 2VJMB 4NYIQ 2I78A 3DOOA 3JATA 4AS1A 5BVHB 3R3WA 3D3JA 4IJQA 2IODA 2R9VA 4N5NA 2YASA 5LOVA 4Y1RA 4UDNA 1WXHA 4HWTA 3LWNA 4S24A 3I8SA 2SKDA 1JAHA 5J4LA 3QUBA 2G0NA 5CXSA 4L5IA 3SOPA 1FTNA 3GFGA 4E7OA 4FOLA 2NXCA 2YWDA 3UV3A 1T0HB 4BVKA 3AERA 1PU2A 4LF7B 2FN3A 5TQ0A 1DPFA 3TNDA 5TVKA 4W5OA 5KWSA 4CCYB 2CEAA 3ZE2B 5L53A 1PV4A 1GGEA 4ZVSA 2EW2A 3ZVRA 3F71A 1O77A 3CKMA 4O4HF 1T8SA 1EVKA 1RC8A 5DNEA 3UH1A 1NNSA 1BXGA 5AI9A 2Q3FA 3A9CA 5EIAA 1RMQA 2XMBA 2OO5A 4UMEA 5A71A 3KWFA 2QXTA 1U1IA 2WJIA 3LT5A 2RBKA 4RDCA 5TMEA 2ZT8A 1PDOA 4JU8A 1M2GA 2IEAA 3PYXA 1CDOA 3C3KA 3A10A 5DULA 3FHJA 3K72B 4WFIA 5L6LB 2W8BB 4CMHA 1CUXA 5JYCA 2Y67A 4PCAA 4P1ZA 4D6PA 5H8WA 4IIGA 1I14A 2C00A 2XR1A 2FWMX 2Y93A 4A5OA 1NW3A 1TKCA 2ISSD 1Q57A 2XMZA 3E5RA 3PFBA 2QW1A 4FNOA 4JR1A 2H7XA 5B37A 4EAAA 3I2GA 2NYRA 4KMRA 2CLDX 4AG5A 3DXFA 5CVJA 3JALB 4TLAA 5DYTA 2O4UX 4HMQA 2P91A 1NVTA 2FV8A 2UZ4A 4JJ4A 3IKTA 4OMFG 2YFQA 1RAAA 1U5KA 3R7WA 1NXUA 4MCAA 1QYXA 3U17A 3ZWPA 2GKGA 1A9ZA 2ZDHA 2RBEA 3AONB 4MVJP 4XAQA 2D6FA 4QEDA 3NJRA 2B0JA 1UP6A 2IS1A 2OHVA 1UKAA 2FP4A 4HLQB 1TO2E 1VRVA 2ZCJA 1Z0AA 2W2MA 1MT1A 1OILA 3X2EA 1AQJA 2FE1A 5BRJA 4U1RA 5DK4A 4XDGA 1KI3A 5JPDA 1P1HA 2DP4E 3A6KA 3QVLA 4J49A 1ZMOA 4WK4B 1WXDA 1EUCA 3CJQA 2R00A 1QU3A 1GA4A 1CY7A 1J49A 2I33A 2Q4RA 3IP1A 2DPGA 3AFHA 5AK4A 5EZYA 2ZYDA 5CFMA 2P4QA 2GH1A 4Y18A 4F9TA 3AR6A 3FWNA 1NWCA 1P81A 1EFPA 1F51E 2HUPA 2ZJ7A 1G55A 3T54A 4Z2AA 3MS7A 5B6IA 3S8YA 5KNCH 1GCUA 5CEJA 1FNSA 1MC4A 1D2GA 1NXPA 3M70A 4GKBA 2P41A 1BW9A 4YV7A 1V1MB 2CDBA 4EB8A 3G2JA 3TL6A 5COQA 3KAJA 4X93A