2B8TA

Crystal structure of thymidine kinase from u.urealyticum in complex with thymidine
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
206
structure length
206
Chain Sequence
IGWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDTRSIRNIQSRTGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFGPIAKLFTYADKITKLTAICNECGAEATHSLRKIDGKHADYNDDIVKIGCQEFYSAVCRHHHKVPNRPYLNSNSEEFIKFFKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidine kinase
publication title Structure of the substrate complex of thymidine kinase from Ureaplasma urealyticum and investigations of possible drug targets for the enzyme
pubmed doi rcsb
source organism Ureaplasma parvum
total genus 54
structure length 206
sequence length 206
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2005-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2b8tA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2b8tA01
1TU4A 4MDFA 3BC1A 3N5CA 4LYFA 1AGRA 1KI6A 4JL8A 4WZBE 3T15A 1SVOA 3GLIE 1Q1QA 2W2XA 2ZI7A 2ZRLA 2JJ2D 1XMSA 2KB0A 2P2LA 1NLZA 2ZRGA 4MYTA 4RSGA 2RGGA 1R0YA 3EZ9A 2YUUA 2GZHA 3DKPA 5BN5A 2BEJA 2ZI5A 1VCNA 1DAHA 5K8UA 1ZVQA 2ZE5A 1E0AA 1J2JA 2R6DA 2YKGA 4WVFA 3TR5A 3UMSA 1TAGA 1D9ZA 4Q4JB 4IHQA 5A5GA 4TT3A 4KVAA 4ERNA 4MDEA 2VP9A 4O3MA 2IWHA 3IUYA 4WA7A 3K09A 1N6RA 1XRJA 3OFNA 1RC8A 2PJZA 1WRBA 3WNCA 3VTKA 2G77B 4Z8YA 4UXIA 3CH5A 2HYIC 4FCWA 1KO8A 2GESA 5JHHB 3SI7A 1U8ZA 3ECCA 4CEHA 2DWOA 2QT1A 2QTHA 1IONA 2EWWA 2J0VA 5FUYA 3QOFA 4LJ8A 1XFAA 4TLBA 4B3GA 1VYUA 4NYJR 3ETLA 4BFXA 3W6OA 1OH5A 1HEIA 4LV8B 2ODBA 4M53A 1V43A 3AVWA 3RVBA 4HLDA 2ZYVX 3MWYW 2QBYB 4IEEA 1CKEA 4PHGA 5CLLA 4URWR 3LW7A 2IA5A 2CL6X 221PA 1G6OA 4BFTA 1CLUA 4LV5B 2W0MA 2ZSAA 3PVSA 4W5WA 3ADBA 2J87A 2C95A 1B23P 4NYIR 4Q47A 4ASUA 3SR0A 2XZLA 1IBRA 1RJ9B 2PCJA 1G64A 1XWIA 5EXTA 2CBZA 2YYZA 2D7CA 5LBIA 1EK0A 1T8UA 5K8LA 4X8OA 2F9LA 2AX4A 4EFLA 3EC1A 4NPHA 2F55A 2HF8A 2NO0A 1MH1A 2IUTA 3VX3A 5LD2C 1FAQA 1E99A 1G8GA 1FQKA 3C5HA 4A0GA 1NI3A 3Q85A 4HDQB 2BM0A 3L2OB 1O87A 4LOAA 4B2LA 2UZ3A 1HE1C 1QF9A 4FXPA 4Q9IA 1R5BA 4LSGA 3RS7A 1NVXQ 1PTRA 1RZ3A 5FOWA 3SYKA 1EWQA 2D74A 2OCAA 3BGWA 4PC7A 4LYAA 3DL0A 3F0TA 4TLCA 2F3TA 1ZNYA 3OEEA 2YC4C 1HUQA 1H65A 1RFHA 2BKUA 2L0XA 4FMCF 5HR5A 2LCFA 4FCTA 3UMRA 4QOSA 3C5CA 4PSVA 4MGIR 5KSPA 1NG9A 1R2QA 4R2HA 4L9MA 4D82A 1ZJ6A 2GJKA 1X6VA 2JLQA 1YRAA 3LO5A 3WP0A 4OI0A 4EJSB 5G53C 3KY9A 2DWPA 2WSMA 1CP2A 5HE8A 1F2UA 2AHOA 1KAOA 3WMFA 4ZIRB 4OL0A 2XTZA 3K0FA 3DM9B 4X8MA 1Z07A 5AUQA 4M21A 3PJRA 1KO4A 1R5NA 2CL0X 1CRQA 4IVPA 4MYCA 2AK3A 3U44A 3KXKA 1TQ2A 2C03A 1W0JD 3L8YA 2FPLA 1XEWX 3B9QA 2W58A 4IDQA 4QNMA 821PA 3R9WA 1TX4B 2QAGA 1IN8A 1NVUQ 1E2KA 2ODEA 1G41A 5EUMA 3U4QB 2ENNA 3RRMA 5JSZB 1OFUX 2X2FA 5B57C 4A36A 2AK2A 2NOAA 2GK6A 2PLFA 1MKYA 3TGPA 1CULC 2FNFX 2ODWA 4NHOA 2ZRMA 2B8TA 1R8QA 5JMTA 2IUSA 1T9HA 3CPJB 2D62A 2FGJA 2CDNA 2GCOA 1KI6B 2F1RA 2E9SA 2CMKA 2WSSD 3FE2A 3K9NA 4RZXA 2DFLA 3S1AA 1VIYA 4BZQA 3T35A 3GMTA 4Q4AA 2YWEA 3QXHA 2PMKA 5JECA 3CLVA 2PT5A 2V4ZA 4OBEA 3LX5A 3Q9LA 4DDTA 1E2HA 4BFZA 4ZKDA 1U9IA 1JAIA 2JDID 1OW3B 2EFEB 3D7MA 4QGGA 1T3LA 2FWRA 1DO2A 1M2OB 1Z08A 2H5EA 2RGEA 2RMKA 1FPMA 5TDHA 1KIMA 2RCNA 4Q01A 2QEQA 1E98A 3NBFA 1CU1A 2ODNA 4B3BA 3EAQA 1SVIA 3EWSA 5EZ5A 1EFTA 3X1WA 5G3YA 1IJFA 4P4SA 4M1OA 4QBHA 4CEHB 2GK7A 2VPPA 1G7TA 2PX0A 2B21A 2XJ4A 3OHMA 3O8CA 3QXCA 4WXRA 4PO1A 3KKPA 2XNSA 4HI0E 1R0XA 3K70C 2D2FA 3UGLA 1KI9A 3O8DA 4GSYA 2ZM5A 1Q0UA 2A78A 2AR7A 4YQFA 1WP9A 1E79A 1VCOA 4URYR 2PJRA 4KAXA 1NVVQ 3MWLA 3NH9A 2PMDA 4HAXA 1SVKA 2BVNA 2HXSA 2NO9A 3ADKA 1SXJA 2QQ0A 3O47A 3GQBA 2EVWX 5B2ZA 1E32A 1Z47A 1G5RA 3B5JA 1D5CA 3SJZA 4ZV4A 1DOAA 5FOTA 1EFCA 2REBA 4Q1AA 3VHLB 4P4TA 2P0EA 1P72A 2DFTA 2KJQA 2XJ9A 3VU9A 4NONA 3QVVA 5D3MB 3J81k 1W47A 4QHYA 2QZ4A 4FMDF 1VG9B 2F7SA 2IYTA 3UEYA 5L3SA 4DUGD 2XZOA 1CBUA 3AP3A 1BYUA 1NLYA 1TQ4A 3Q5DA 2IXFA 3FFAA 1J8YF 3TNFA 4MRSA 5EE5B 1F6BA 3KX2A 5HZKA 2ZSEA 1E9DA 2OLJA 1XF9A 3KL4A 3OIYA 1KK3A 2NPIA 1X8JA 1Q22A 4JT4A 2QL6A 3CNOA 5FBQB 3SEAA 4N0DA 2BHRA 1DVRA 3U7FB 1MABA 5TY0A 4OK3A 4DLTA 1OF1A 4CT5A 4NCJA 3V00A 3GPLA 3MMPA 3VR5A 3C4JA 1VHTA 2IYXA 3TSOA 721PA 1E1QA 4C2UA 1LFDB 1OFTA 5J40A 2MMGA 3VAAA 5BN3A 1UADA 3OE7A 2FE4A 5E7IA 1X1SA 3HYRA 1EFRA 1HQCA 2GJ9A 2O8EB 4I99A 3PIRA 1E2NA 2WZQA 4QGHA 5DSZA 3VNUA 4DLUA 3VKGA 2A3RA 3K0FB 3LH5A 4Q7LA 4V0NA 4AYXA 3M6AA 1Z0DA 2CLDX 1PTQA 2FF7A 3B13B 5EXSA 1FP7A 3U44B 3G0HA 4BGDA 2ZJ8A 1G19A 4XVQA 2CVHA 4JLOA 2WAXA 3QG1A 1IM2A 3SJBA 1SVMA 5FR1A 4V0LA 2QAGB 3RS4A 1Q44A 4EPRA 2F1JA 1WF3A 2CNWA 5IDVA 5CYOA 4HATA 5F98A 4A2QA 3K9LA 1YE8A 4A4DA 3WXMA 3EZFA 1FUKA 1GKIA 4IFBA 5L3QB 2GWHA 1JR3A 3LVQE 3D31A 4A2PA 1JR6A 2CCKA 3BK7A 1J99A 3I62A 1KO5A 5JBQA 1KO7A 1XTSA 3LRPA 1IQPA 2OAP1 1JEDA 1ZNWA 4NYMQ 4UJ5A 1A2BA 1S4QA 2D4HA 4OHVA 1OXTA 2J0QA 3C14C 3LLUA 3OESA 4DLYA 2BBOA 4B76A 1KI1A 3CNNA 1Z5ZA 1R10A 4L4UA 1W7AA 4A8JB 5IF9A 4FMCB 3WNBA 1AN0A 1OT3A 2A5DA 3M0EA 5EXXA 3LXRA 2YOGA 3NEJA 4XOIA 3I8XA 5L3RA 2ZJBA 4YLGA 4B71A 5EJEA 5HE9A 3O8BA 5BQ5A 1JJ7A 4OQXA 1SULA 4AG6A 3TAHA 3AQ4A 4P4SB 5EE9A 2C9YA 2CE7A 4NTZA 2XTMA 1BS1A 3KUDA 2QU8A 4TL8A 5JEEA 2GVZC 4PPFA 1YZUA 2JASA 5L3VA 4TYPA 1W0KA 4IKEA 4BUJA 1YVDA 5C1BA 1U0LA 4HLUC 4G3XA 4RFVA 1XPUA 1Q1ZA 2BWJA 2ZROA 4TT3D 2GAOA 2QRNA 3GLIA 5FUVA 1P60A 2XNDA 3BAFA 1XTJA 2BCGY 3TIFA 2IHBA 5AUPB 1QBKC 2GEVA 4GBMA 2VEDA 3ZS9A 4P33A 1NMZA 1LF5A 3RS0A 2ERXA 1M7GA 1JALA 3H2YA 4ZKEA 1VMAA 4TYWA 1WA5A 2JEOA 2X19A 4Q7KA 5DO9A 2MSCB 3NTUA 4TMTA 2CK3A 1L2TA 1UKYA 4B74A 1I4DD 3A6PC 3TVTA 3AF1A 3F8TA 4F91B 4C9BA 2VO1A 3OAAA 1F48A 1FX0A 3VU9B 4HB2A 1K6MA 1XCGB 2G9NA 3MSXA 2EFHB 3KJIA 4C30A 2F6RA 3RDPA 5DISB 4B6EA 5L3SB 5JJIA 3RWMB 5CDFE 3I1FA 4Z54A 3TVDA 2W2TA 4ASUD 1CRPA 3MWJA 4MKIA 1SQ5A 4EPTA 1KK0A 4I1SA 1XJQA 2F9MA 4KSBA 4RD3A 2ZS9A 1W0JA 1ZU5A 2C77A 4RFSA 1PLKA 3SHFA 2ZRJA 5JS7A 3ZZUA 4AD8A 1XEXA 2EYUA 3E70C 3ZVNA 4X8HA 3KJHA 4RCYA 5SZIA 4U7DA 1YZNA 2VBCA 3TW8B 2BMEA 5TMPA 2NO1A 2ORVA 1KHTA 1HT1E 1P7CA 4TTPA 2Q6TA 1H8EA 4NH0A 1Z0AA 521PA 2C04A 4DLZA 5K8TA 3VR1A 5KNDA 3BRWD 1H8HA 2V8OA 4TMXA 2J41A 3OEED 4AK9A 1E6CA 1R0ZA 2IEYA 1E2LA 2WKQA 5JWHA 5L8VA 2OXRA 2IWRA 2ZI4A 3AKEA 3C8UA 2RH5A 3T1QA 3KQKA 4TTRA 2P5SA 1W36C 3Q3JB 4PC6A 4M1TA 4HAWA 4IJMA 1CR2A 4NL4H 5J4LA 1S3GA 2OZEA 3UATA 1R79A 3AEZA 3CWZA 2ZJAA 3KXIA 2DYKA 4GZMA 1JJVA 3FKSA 4B3CA 4UNRA 3QJYA 2HYDA 2QI9C 1U98A 4HB4A 4PO8A 3W8RA 2GAAA 1NKSA 1XTRA 2FSFA 4BLRA 2A5GA 3EX7C 3AVUA 1COWD 2BIFA 2E87A 1RPZA 3G82C 3FPAA 3U3OA 1VCMA 2WHXA 4HAYA 1KMHA 1KSHA 4C0KA 4QBGB 2PZFA 3IDQA 2P67A 1ONBA 4Q4HB 1F5NA 3U3JA 5KYKA 2FN4A 1XP8A 1N6KA 2ANBA 5KOYA 4FMDB 1G16A 2FFHA 4TSFA 4D0NA 1F2TB 3EIHA 4M1YA 1ZM9A 2X2EA 4Q9JA 4B35A 5JCZA 4M4SA 3I73A 1CJVC 1VG1A 1OPXA 3I3SR 3QKRB 3PITA 5FR2A 1YR9A 4C0JA 3C15C 3GFOA 1OH6A 3I92A 1XMVA 4TMWA 3QE0A 4BLSA 2BKEA 3NH6A 4PPNA 3H86A 4IDPA 4AYTA 2XXAB 4H9GA 2QTVB 1G3UA 1XTIA 2OV2A 4C0BA 3K1JA 3HP1A 4DBLC 3I32A 3PEVA 2IS4A 1ANKA 1ZM7A 2NGRA 4LHVA 5H8WA 4KU4A 4GNKA 1UPTA 3IO3A 4E09A 4LJ4A 3I4LA 3R20A 2B8WA 3QIAA 3PUYA 5J47A 3UKDA 1SVWA 3CRRA 4A0FA 4HDOB 2K5UA 4MKFA 4B32A 1S96A 1G291 3K53A 5DHFA 1S1CA 4E5UA 4I4LA 3IILA 2QBYA 1KJYA 4QXAA 3RHFA 3G5UA 3OEHA 4DKXA 1RVDA 4QM7A 1P9RA 5AR1A 3K0SA 3K0CC 4II7A 3ZIAA 3ZLJA 3B1ZA 3FFBA 1VYTA 5IRCD 3GLIB 2VF8A 4BECA 1NP6A 4ITRC 3U6KA 1RJ9A 1QHIA 3ZGXA 2GXQA 4Q21A 2W6JA 2FSIA 2IEZA 4IOLA 4NYJQ 5FPYA 2HCBA 2AKAB 1UAAA 1RKBA 2NZ8A 2BOVA 4LPSA 5FTNA 3TSZA 1OB5A 2J45A 2BJWA 3IQXA 4QHTA 3PEYA 2ZRKA 5FPTA 2V1XA 3DMNA 3KFXA 1TF5A 4U5XA 3ICQB 4AKEA 2QGZA 1E79D 1GRQA 3CF0A 4NCKA 4GMDA 1Q1EA 3AF3A 5SZHB 5EUQB 1NSFA 4NYIQ 5FBLB 4DLVA 3U2QA 4FW9A 1FNNA 3FHCB 1BIFA 1A7JA 4XWKA 1ZIOA 2DR3A 2IYUA 4GP7A 3U5ZB 1TEVA 2DFNA 2Z4SA 4G1UC 1SXJD 1MRNA 1NRJB 3AH8A 4RFSB 4V03A 4C3ZA 3BFXA 1WE2A 2G0NA 3RNLA 1UBEA 3IPXA 3U3RA 1E0JA 3QKUA 3CX6A 4Q1DA 3WY9A 2RB4A 1PLLA 4E22A 3ZH9B 2QROA 3QNUA 3EASA 2ZAMA 3SYLA 3JZAA 3QSYA 3SNHA 1DO0A 4NDZA 2WWIA 1G21E 2ZRBA 1T3HA 4PZZA 1M1YE 3FMFA 1XZPA 1W48A 4BFVA 3REFA 1VECA 5CJPA 1UBCA 1JPNA 3IHLA 1ZC4A 1N6PA 4EDHA 4ZDKA 1XCPA 1JI0A 1GAJA 1NN5A 4Q03A 4Q9KA 1GNPA 3AVVA 1SVSA 4W5JA 3GJ5A 2XXAA 2GEDA 5KTYA 1E2GA 2R6GA 4YONB 2I1QA 2JATA 3LD9A 4RKFA 2O8FB 3GEHA 4I1OA 4Q1CA 3U4QA 1E1QD 5HCNA 4URVR 5JSZA 2ENZA 1K8RA 1KY2A 3L82B 3OZXA 5ELXA 2J0SA 2R6FA 3SOPA 2ZR7A 2QTFA 3OE7D 4B44A 4MH0R 1EFRD 1Z2CA 2ZQ5A 3OF5A 3RYTC 1L4YA 2J5XA 4A0HA 3RC8A 3Q8XB 2J9RA 3RANA 5HKKA 4TZ0A 3DVLA 1AKYA 3U61B 2XGJA 1D8TA 2ZANA 4Q48A 3OIWA 2REXB 2CHGA 3WP1B 4CRWB 1KMHB 3PV0A 4Q1FA 1UJ2A 1LY1A 1DPFA 1VIAA 1JNYA 3B9PA 4RD1A 5FI0B 2WIAA 4MYUA 3SBDA 4KXFB 4HLQB 4UJ3A 5JWRA 4BFSA 1W49A 1UM8A 4QJ4A 3MUFA 4DIEA 1KBEA 4L9SA 4IW3B 1G5TA 2CNWD 1IN7A 2P6RA 1HQYE 2VRWB 3GFTA 1N6HA 1UBFA 2A5YB 4JLJA 4QC2A 4U02A 5FL3A 2I4IA 2FPKA 2OUKA 4BEBA 2GJ8A 5DHAA 3NC0C 1X86B 2O8DA 5FUXA 1JR3D 1XA6A 1UEJA 1UKVY 5FI1B 3VQTA 1W5TA 2XAUA 3NBZC 3Q72A 3SS8A 2WJVA 3VR3A 3CIOA 4QGAA 5BWMA 1KZ7B 1SHKA 5K8IA 4V0ME 5ANRB 1L8QA 4WZAE 4K81B 4LUCA 3F5FA 4A2WA 2XOKA 3WYAA 2ZR9A 1ZUIA 4D80A 1OIXA 3N2EA 3TK1A 4AIIA 4B2PA 2YINC 3QKTA 5EXPA 3LFUA 1P2TA 3VR6A 1NF3A 2AFIE 2FDCA 3EA0A 4IVRA 3BXZA 3CBQA 1ZBDA 2V6JA 5LB2A 4L8GA 3H4MA 4DDWA 4F4IA 4CEIA 2FU5C 3LAWA 4DLXA 2DY1A 1E9AA 2OFWA 3GLHE 2RGBA 3MFYA 3CF2A 1VTKA 3CRMA 4BASA 3ASYA 5LD2B 3I8SA 5AUNB 1YKSA 4EFNA 3SBEA 2XB2A 2VQSA 2ZSBA 2GRJA 4HZUA 5KSOA 3GLGB 1E1RA 4YMWA 4D2IA 2ATXA 3VKWA 2VIIA 1TADA 1TQ6A 4DIDA 1Z28A 4PHTA 4WZ6A 2IK8A 4B2IA 3U3KA 1W0KD 5D3MA 4FWTA 5BYKA 1W2HA 2GVIA 4D26A 1IXSB 1NLFA 2D06A 4ZDWA 2R2AA 4LV6A 1SGWA 3FOZA 2XNDD 2WKPA 4PHHA 4NU0A 3RS3A 3B78A 2YWFA 3VMFA 2O0HA 4I1UA 4R71A 3TQCA 2IS2A 1KI8A 1U90A 3UXMA 2VHCA 2VP4A 1ZMXA 3HDTA 4M0LA 4DHEA 3FHOA 1A5TA 5JRJA 2CK3D 2QSYA 1J70A 4RKEA 1XBTA 1E2IA 3MCAA 2A5FA 3FYHA 4I81A 1OE0A 3BWDD 3OAAD 4JBXA 4M9ZA 3RRYA 2YZ2A 3UIEA 2R6AA 5DYIA 2O8EA 3Q5EA 2HDNB 1D2MA 3UFFA 4XSHA 5GJWC 4NCHA 1DBSA 3EW9A 1G3QA 1KI7A 2QMEA 2V54A 4Q9HA 3B82A 1RFLA 1COWA 1RW4A 2LWIA 3T5GA 3VKHA 2R9VA 4KCGA 1A4RA 3AV0B 4Q00A 4GOJA 3T12A 4B3FX 2DBYA 1WDTA 2GBLC 5KPDA 3BJIA 4M1KA 1NN3A 8OHMA 1XPOA 4S2EA 2ZVPX 1OXSC 3NWJA 3P20A 4R9UC 3TAUA 5KDOA 2YOHA 4CYMA 1P73A 2EFDB 4BZXA 2SHKA 1T5IA 4BLTA 3P26A 5CDFA 3L0OA 3K9GA 1US8A 4LYJA 1E2EA 3CUEF 1H8ED 2G83A 2PEYA 1DG3A 4TN1A 3DO6A 5L3QA 4MRPA 1EGAA 4QL3A 3R7WB 1XTKA 4NBSA 1H8HD 1G4UR 1GNQA 1KK2A 1PUIA 5H70A 2QP9X 3N2IA 4ZI3A 1PJRA 4Z8XA 4MQBA 2ZSDA 5HCIA 3T61A 4DJTA 2FG5A 2ONJA 1MO4A 1FMLA 2C96A 1KKLA 3GLGE 1EXMA 1WBDA 3ICEA 3NDBB 3ZD7A 4OJKA 3AVPA 1KO1A 2J0UB 3MG9A 1DADA 3GLFB 2O8BA 4DXAA 3Q7QA 4F92B 3FKSD 2IXEA 3DKVA 2JA1A 1ZRHA 4V02A 1PLJA 1ZM2A 1GKUB 4A8JA 3N70A 3KB2A 3EPJA 4IOJA 4GMXA 3B7GA 2Q3MA 3ZZ0A 1JBKA 1FTNA 1Y8FA 1GRNA 3K70B 2O8DB 1J8MF 1E2FA 1ZD9A 2PX3A 2WWYA 2VH5R 4URZR 3WHKA 2RKOA 5KUTA 2DB6A 1G8FA 4RZUA 2HUPA 3U3MA 2C98A 1QRAA 4TSFD 1JECA 2WV9A 5JFGA 2BBTA 3T06B 3FB4A 4IOMA 3L0PA 1TL7C 5GJCA 2QQEA 2VLIA 3HR8A 1ODFA 3ZJYA 3E2IA 3RWOA 2FFQA 3MRSA 2WJIA 5E7MA 3HPRA 1SKYB 4CEIB 1E9FA 1N0UA 3W9YA 3CZQA 4ACAA 4TL6A 4ZDJA 2X1VA 4MRNA 1DAMA 3DMDA 4U00A 1R6BX 5FTJA 4LWZA 3PQCA 1LW7A 1DAGA 4KLNA 3AGPA 1VCIA 4LPKA 4OYHA 4QBFA 5CIQA 1DG1G 3I72A 4HZUB 4D6PA 4FI3C 2F3RA 3SN6A 4V0KA 1CJTC 4GL2A 1N5IA 2KSQA 3CRVA 3TRFA 2WKRA 2UZIR 5F3WB 4UKDA 2AWNA 3GEEA 1S1MA 3HWSA 4WW0A 1VPLA 1KOFA 2GETA 2WPDD 4US0R 4B73A 3MAAC 3R9IA 5JCPA 2OT3B 2MMCA 3A1TA 4B3DA 3LVRE 2MSEB 4FIDA 2ZRCA 4B48A 2VHJA 3IHWA 3OEHD 1AZTA 5FTMA 1KDOA 2EFCB 4MYHA 3LQRA 4XTCS 5G41A 3ZIAD 4Y0VA 3DOEA 3FDIA 3K8YA 4P31A 5BN4A 1UBGA 1GSIA 1XX6A 3BERA 5FH9A 1UEIA 4TZ6A 1MV5A 1RYHA 2ROWA 2GXUA 4UNQA 5JEDA 2OBNA 3L8ZA 5H1YA 2W6JD 3U6BA 1EESA 4K8OA 5DN6A 2CLCX 2NMVA 1A2KC 2ZE7A 1YZLA 1II0A 2W00A 3LBHA 2AL7A 1UKEA 1XNJA 1XZQA 3LNCA 1G8YA 2Q3FA 3IBGA 2OO7A 5CLQA 2QA5A 4AI6A 3KKOA 4QM6A 5AJWA 2G1JA 2WM9B 3BORA 3W90A 3KZ1E 3AB3A 3GLFE 3ZVRA 1R8SA 3BH0A 3BFKA 4QG7A 5JRZA 4LBVA 2I3BA 4ESVA 4BLOA 2ZXUA 1KDTA 1YR6A 1YZQA 3AUXA 1JQLB 1NBME 3UWKA 1TUIA 1Z06A 1QG2A 4A0RA 2GEUA 1SZPA 1Z0IA 2DFKB 4PC3A 2IF2A 3H84A 5TV2A 1G7CA 4DB2A 2O8CB 1TBOA 4JVLA 2OSBA 4PSAA 4DZZA 4RD2A 4X8LA 1KYIA 2EW1A 2YHSA 3DDCA 2QPTA 4C7OB 2G6BA 4BEJA 1QVRA 4XWAA 4WBSA 3QI2A 1US8B 2IYWA 3FVQA 3THXB 3LDAA 3ZQ6A 1QHNA 2ANCA 5GVRA 1XCMA 4CDGA 3NC1C 4JVNA 4TLAA 2QGNA 4B75A 3UGDA 1SKYE 1BO6A 1TPZA 1P75A 2AN9A 2EYQA 4Q4HA 2JLUA 2W83A 4CEJA 1KI4A 121PA 1F2TA 2DPXA 3DHWC 1KK1A 2J46A 1DS6A 1LF0A 4B43A 3SFVA 1W4AA 1K5GA 2ASEA 2G88A 2O8BB 3QKRA 3MJHA 4OI2A 1OIVA 4L5BA 2B7CA 3EG5A 2C9CA 1BMFA 1I4TD 3A4MA 5HKKD 3UEJA 1NVWQ 1HTWA 2O5VA 1SVLA 3D8BA 2IT1A 3KKQA 5FBRB 1HURA 2FSHA 4UXJA 1N5JA 2NZJA 1NNEA 4G5SA 3ZDQA 4PR0A 1CXZA 3CKLA 2FOLA 3SZRA 3CNLA 3R8FA 4ZPXA 1N3BA 3UMFA 2WTUA 2RHMA 2GVDC 3GJ4A 1GKYA 4LCBA 2Z5FA 2OXCA 1AIPA 1YR8A 2FGKA 2EWVA 4QJ3A 1NIPA 1W46A 2IL1A 3IEVA 1D9XA 3THWA 4H1VA 4MITA 2JCSA 2KWIA 4TLDA 3BIFA 5EE0A 4MRVA 1II8B 2BM1A 4D25A 3QPVA 4B34A 1S9HA 3MD0A 3LV8A 5M04A 2H92A 2H16A 5FL7A 1Z6TA 2V7QA 4LJ9A 1JB1A 5BXQC 4K46A 1IN5A 4LYHA 4XVRA 1N6OA 4PFSA 2RGAA 4JKIA 1E0KA 3X1ZA 1M8PA 3RRZA 3W3AA 1GUAA 1U9IC 1KSJA 3NEYA 1X8LA 4DEXA 1QG4A 1U8AA 4PQYA 4EAQA 1E9BA 1MO5A 3I5XA 2OCBA 3EC2A 2PT7A 1AM4D 1G8PA 2XOKD 5KDLA 3V4RA 2RAPA 4IDHA 4R2IA 1E3MA 2XITA 1YHNA 4NCIA 2ZYTX 2BJVA 2ZJYA 4JLVA 1TBNA 4DCUA 1M74A 2ZI3A 4N0EA 4ABYA 4D0LB 4ARZA 5AJYA 4M9XA 2ZTSA 3RSLA 4V0MA 4YC7A 4DCTA 2PZEA 1N25A 4YDSA 2ELIA 1E9RA 3CW2A 2RGNC 3WRXC 3CB4A 3PENA 1E1RD 1LB1B 3CRQA 3CONA 1Q21A 1IAQA 4M9SA 4P0TA 1Q12A 3FGNA 2WJYA 5DNYB 5CJ2A 1E0SA 2BBWA 4F7WA 1DAEA 4M9QA 1EG7A 4JLKA 2GILA 2ZITA 4JLBA 1C1YA 2P65A 5E95A 2VP2A 2JLXA 3GLHA 1NSTA 1Z3IX 2ZRHA 1SXJC 3U7EB 1ZM4A 1QHXA 4LHXA 4JVSB 5DI9A 4F38A 3AKYA 1G3IA 5C46F 3AVXA 1I2DA 5HTKA 3EZ7A 4LBWA 1MT0A 4PAOA 1P2SA 4ILEA 2E1RA 4JYBA 3MGCA 4LI0A 3ZQJA 4JVMA 2R62A 3UANA 2O8FA 2F43A 4DWJA 4FWIB 3L43A 4RJLA 1OSNA 4AURA 2WOOA 5FUWA 5EP4A 1NJGA 1Z0KA 2ZJOA 2FZLA 1ZNZA 5UKDA 2V3CC 4KHZA 4JIMA 3ASZA 1PZNA 3UGIA 3A1WA 1JXOA 4RD0A 2ZSFA 1P9WA 3A1SA 4UQOA 2FEOA 3HYTA 3GJ7A 4YXWA 4C2TA 2R65A 2ZRIA 2DB3A 5A4JA 1PV4A 1S0UA 3AF0A 5TARA 1W4BA 4MGYR 1KNQA 1RRCA 2IYVA 4CEJB 5E3HA 5DGXA 1UF9A 1OYYA 3GEIA 5FOUA 3CX7A 4JLNA 1DEKA 3QXSA 3SU8A 4N1AA 3KTAB 3AVYA 1XD2A 1KSGA 2VRWA 3B1YA 1L7VC 2OESA 1XEFA 2I1VB 1GTVA 4M22A 1UDXA 3TR0A 4LHZA 4JS0A 5DLQC 5B64A 5CK5A 1I2MA 3FTQA 2CE2X 1N5KA 2FSGA 4KYIB 2ZRNA 4PQFA 1FFHA 4L16A 1E69A 1VG8A 2ZI6A 2PLRA 3AF2A 4BE7B 3GJ3A 1CR4A 1TQDA 3H1TA 4PTLA 3SJCA 4DDUA 1G1MA 2FH5B 3CF6R 2OBLA 3THWB 1PVOA 2ZJ5A 2WPDA 1AQYA 3RS5A 1R4AA 5DI3B 1U81A 1Z83A 5FBVB 5HPYB 4E07A 2KBEA 2QPAA 4OQFA 2N46A 3CRW1 3AP1A 3LW8A 5AJVB 4BFWA 1G4AE 4WOPA 1AS0A 1CS4C 4FD2A 3A36A 1QZXA 4EUNA 3IKJA 1OXVA 4A92A 2ZS8A 3GLGA 4DSUA 1FTSA 2QY9A 2VP5A 3PEWA 4S35A 3EPLA 2GCNA 2QMHA 2TMKA 3LX8A 4OK5A 3QF7A 1YZTA 2QM8A 4JYCA 4M1WA 3UWOA 2N42A 4GOXA 3B1VA 4RD6A 3BBPA 5DIFA 4HDCA 2YC2C 2FPMA 2C5LA 1YJ5A 1QHGA 4LRWA 1M6NA 2B7BA 1FZQA 1FW6A 1NY5A 5B30A 4ARZB 3IO5A 2JJ1A 3A37A 2WVJA 1VG0B 3D6TB 2O0JA 2QM7A 2YWHA 1N6IA 3SC3A 2O0KA 4EKDA 3KQLA 5AK0A 2J7PA 2RHDA 2ZE8A 4DT1B 1V5WA 1G7SA 2ATVA 2JIZA 1OYWA 1ELOA 3BB4A 4HAVA 1QHSA 4DEYA 4Y0AA 4NKRA 1MO3A 2BCJQ 3QXXA 2GBLA 4ZCIA 4ZI2A 4DLRA 3CH4B 2LKCA 2CHQA 2ZUCA 3GLHB 3KDSE 3FHTA 4XJXA 3JVUA 3EIEA 1FNMA 1Z0JA 3I5YA 1ZUNB 4PPQA 4RD4A 3TH5A 3TQFA 1UDWA 3KJEA 2FEMA 1Z6GA 2JGNA 4GRAA 4O2LA 1M7HA 4AWXA 621PA 2BMFA 4QHSA 2JLYA 3LBNA 1P3JA 3BD9A 2W6IA 3TUIC 2FJUA 5KPJA 4DLSA 1P6XA 3FMIA 1UKZA 4OI4A 2ONKA 3MJRA 4PO9A 1IHUA 5DN6D 1F60A 3QXJA 2ZPTX 4D4JA 4OKSA 5CK4A 2F43B 4LJ7A 4US2R 4UNSA 2J59A 4PC1A 3W8NA 4L9WA 5EP2A 3EPHA 4A1FA 4DSTA 1C9KA 1ZCAA 2QG6A 3E1SA 1KJZA 3ND8A 1J90A 2FV8A 3ZS8A 1L4UA 2QRZA 1IN4A 4GP6A 3R7WA 1U94A 2JJ8A 4IXNA 4PC2A 1NL3A 3CWQA 2CVFA 1GL9B 4LBYA 2OILA 2WMOB 1X3SA 4ZCLA 1Z29A 4YMVA 4DDVA 5KNCA 1M34E 2KI5A 2VSXA 2E73A 3SQWA 3PFIA 3NG1A 4LK2A 1S9DA 1A1VA 1FP6A 2WWXA 1MR3F 1NIJA 1OJLA 3HJNA 4NP6A 1DAIA 2J0UA 3AVTA 2J7KA 1TEXA 5FOXA 3GLFA 1ZNXA 3U60B 2DCUA 3CPHA 1BH2A 1XD2B 2Q9BA 3WBJA 2VF7A 2QT0A 1DELA 3ONWA 5EP3A 5IK2A 3PEUA 1T6NA 4ON9A 4OQMA 5FBWB 1NBMA 2ZIAA 1MOZA 1T0JB 4TWZA 1OB2A 3LXXA 3RC3A 3KB1A 4W5HA 1IN6A 2WJGA 3JVVA 3VHXA 4KITB 3KUCA 2IYSA 4KVGA 1B0UA 1KZGB 4HAZA 1GVNB 5EZ6B 3SHWA 5CIWA 3TKLA 1XXHB 3RSOA 2Q21A 2YV5A 4D4KA 5LPNA 1WXQA 3AVOA 3HPQA 5KHOC 4P4UA 3U7GA 3QF4A 3ZZTA 4HB3A 1XJ0A 1D2NA 5LDDC 4CW7A 3L0IB 2JLSA 4BQSA 4NCNA 4EPWA 3B8HA 3RAPR 4LJ5A 1E2JA 1NY6A 3LLMA 4Q19A 4HLCA 3X1XA 2CHVA 2KBFA 2WWHA 1BMFD 2ZU6A 4JMPA 5J4KA 4N3NA 3BB3A 3EIQA 2OHFA 1G17A 2DWQA 2W0SA 3LQQA 4J0QA 4TMVA 1XJCA 1JPJA 1KJWA 2IHYA 1GL7A 1CIPA 3EZ2A 3SQXA 4F4CA 5GJBA 4TQAA 4AKIA 1OKKA 1TMKA 1FARA 4BZPA 1I4LD 4TL7A 1GL6A 1Q57A 3BFVA 3QUSA 1OV4A 4MRRA 4HEJA 4LZZA 2GKSA 5AUOB 3EZ6A 3HU1A 2RGXA 2GHIA 3A8TA 1LV7A 1W1WA 5FL7D 4AKGA 4LC0A 5SZKB 3SDZA 2V7QD 4B33A 5JLJA 1Q1BA 5CB6A 4CIDA 3NIBA 2GCPA 4F93B 5H68A 2WJHA 1Y3AA 4EPYA 2FFBA 4MUBA 2ZE6A 5JJKA 5IHPA 5F2EA 4G5RA 4D4MA 5J5CA 1MO6A 3PUVA 1P4SA 1BKDR 4O2RA 3WMEA 4IOKA 1KMQA 4P3YA 4QGFA 2NPFA 1GFIA 1LS6A 2N1BA 4GT1A 2ZJZA 3NKVA 2VP6A 4A6XA 1LNZA 1QHHB 1UFQA 4FINA 3SFZA 4CF7A 4A6PA 2ORWA 1ETUA 2BMJA 3QY0A 4QFMA 1XDBA 1GM5A 1E94E 3LBIA 1RYFA 1U2RA 3T1VA 6Q21A 1T91A 2H8KA 3B1WA 1CJKC 1HE8B 3QENA 3EPKA 5IT5A 5KDDA 5KSZA 1JQJC 2IS1A 3TUJC 4YMUA 1DAKA 2O8CA 4PX9A 2YVUA 3GCGA 4MKGA 4GFDA 2WJJA 4JLMA 1XXHE 4QKQA 2IUUA 3SJAA 5CYPA 4ZDIA 3FKQA 2GF0A 1GIAA 3W6NA 5J4VA 4KFTA 4C7OA 4Q1EA 1AK2A 1G18A 1RRPA 3KFVA 3BE4A 2CL7X 2CLSA 4TQUS 1CR1A 5EP1A 4C4PA 1J7KA 3UG6A 4EPVA 4W9MC 3THXA 4GI7A 2GZDA 3TMKA 1FUUA 5DE3A 4OQLA 3L0SA 1T8TA 2VHTA 2ZYUX 4P32A 4WAUA 4EJSC 3BB1A 4EQ6A 2HLDA 1OHHA 1S2MA 4IXMA 1N0VC 5EQTA 2VHUA 1VKJA 2WOJA 3KXLA 5JI3E 5JWOA 2JAQA 1OH7A 4B6FA 1GITA 4B47A 2EQBA 2H7VA 3M1IA 1QDEA 3B6EA 5C4GB 1XPRA 3P1JA 2IC5A 1IY0A 4CZ2A 1T3SA 4TMKA 2VP0A 2V9PA 3VR4A 3UG7A 4G01B 1HV8A 4HLUA 4DVGA 4XH9B 1E2QA 4OJQA 1QVAA 4YXWD 4JBWA 3BH7A 2PZGA 5KU1A 2A9KA 4TYQA 5DH9A 2OE2A 3IIJA 1OFIA 1R0WA 3QBTA 3IQWA 2GXAA 2AFHE 2WBLC 4M2LA 3QF4B 4LJAA 1Z8FA 5JI2E 1KBFA 1GOTA 1II8A 4ESHA 1E2DA 1JEEA 1GZSA 4Q02A 3WNDA 2WICA 2GJSA 2REOA 2QP3A 1X8KA 4UXHA 1EWRA 3VR2A 4OHYA 4TL9A 1GRRA 3T5DA 1P62B 2VSOA 1R7RA 2F1HA 3DZ8A 1S8FA 4PZYA 1G3MA 2AWOA 2NIPA 2XX3A 3QPUA 4AC9A 2GDJA 3KQNA 1KSFX 1W2GA 2ZRFA 1E96A 2HXYA 2UKDA 2ZRAA 2Z0MA 1OIWA 2CEAA 4C0SA 1SHZA 3QVUA 2Q3HA 2QPOA 2RGNA 2G0TA 3K09C 4HUQA 2CCGA 2IYQA 2IYZA 2ZU0C 4XD7A 3TLXA 3LWNA 3W5IA 4RY2A 4DSOA 3UPUA 1CR0A 4E03A 2OAQ1 4LC1A 1GG2A 2F1IA 4C0HA 4BRUA 2C99A 1GILA 1TF7A 2QE7A 1LVGA 2G1KA 2HJGA 4TLEA 1RIFA 4KJZA 4PQRA 3IIMA 1ZD1A 1RE0A 4Q7MB 5F9FA 1U99A 1G5PA 3THOA 1X1RA 1QHYA 3PG5A 4LX0A 1M7BA 4GOKA 2QNRA 4IDOA 4PAMA 4KODA 5GADl 1AZSC 3TUZC 4XIGS 4G5GA 2XB4A 3IEUA 1EFUA 5C4MA 4MGKR 3SYNA 1AS2A 3X2SA 5FPSA 1OFHA 2ZAOA 1Q20A 3F3YA 3WRYC 1XB2A 2FFAA 4LHYA 4BFYA 3RLFA 4HUTA 3NBXX 2OFOA 1NN0A 2Z43A 3CR7A 4O25A 5DYGA 4KI0A 1ZINA 2JJ1D 3AUYA 3AP2A 1FOEB 2XSZA 4OHXA 5FTKA 4QRHA 2ZRDA 3A58B 3R8CA 2ZREA 2NTYC 2A2ZA 4CT4B 1W4CA 1NG1A 1ZM3A 3W3ZB 2AXNA 2JLRA 5J4YA 3A1UA 2D3WA 2J7PD 1Z2AA 5FPHA 2PBRA 1TTTA 5F9HA 3CM0A 3P4XA 1S3SA 2JIZD 2HEIA 4JJKA 2AXPA 1YR7A 1BYIA 2R6CA 3GJXC 5G3ZA 5TVKA 1AJEA 1AGPA 3FWYA 1XD9A 1Z22A 1Z6XA 2ZRPA 3WMGA 2MSDB 2OG2A 1G8HA 3IIKA 1KDRA 4NZYA 5JJLA 1F2UB 2JLWA 4G5OA 1WCV1 4KFUA 3V9PA 1ZYUA 5EE3A 2Z4RA 4BFUA 1OXXK 3PXGA 1E2MA 2R8RA 4H1UA 4AKHA 2YWGA 4BLPA 4Q5IA 3NXSA 1AA9A 2P5TB 2P6UA 3LY5A 4ZO4A 4URUR 3P32A 2JJ2A 5FFMA 3D3QA 2IS6A 4EQ6B 3GP8A 1CJUC 3DEFA 2AKYA 2B6HA 2CCJA 2W6ID 4JLDA 4KV9A 3T1OA 1YZKA 3B85A 4DC9A 3CXLA 1VHLA 3HU3A 3U7HB 1KKMA 4DSNA 2LKDA 3WBKA 1HH4A 1KNXA 1ZU4A 2P6NA 3KTAA 3MWKA 4PAQA 4FKDA 3BJIC 4JL6A 1XMJA 3UK6A 1Z6YA 4JLPA 2OLKA 2NG1A 2Q0HA 2QAGC 4RZ2A 4Z1MD 2GNOA 3CX8A 2GCOB 3QBVA 2NQ2C 4G0NA 4C0LA 3S1AB 1Z6AA 1GNRA 4JSYA 5G40A 3K0CA 4BPBA 4Q4AB 3BS4A 2IW3A 4JL5A 1DE0A 3NBYC 1GDDA 3B1XA 3CO5A 3QKSA 1W5SA 3AKDA 2A5JA 4OHZA 1ZC3A 4KFRA 4DRZA 4W7SA 5CM9C 3K9HA 4FMBB 5DI3A 3V4FA 4F4JA 1IXZA 5E7JA 1AQUA 1KAGA 4RCZA 5JS8A 3KQHA 2ZI9A 1G7RA 2J3EA 3A4NA 2X8AA 5FTLA 2CJWA 5IK2D 2IXGA 1NVVR 1NBMD 2QSZA 1E9CA 3K70D 3ZD6A 5EE1A 4OK6A 4PANA 2D7DA 1U8YA 5KO2A 1O3YA 2IYYA 4JZKA 1XEWY 2AD5A 2BDTA 2V55B 4NMMA 1G3RA 3AF4A 1CF4A 4PZLA 4A8JC 2CXXA 2D2EA 3MLEA 4EIWA 3OIUA 1DTSA 1KGDA 4ZCMA 1E4VA 4QNRA 3A4LA 2QMOA 2WWWA 2IX3A 1G6HA 1XTQA 5CM8B 4HUQB 5J4HA 3THYA 1DARA 1Q3TA 2JLZA 3GJ8A 2Q9AA 1XD8A 3O8RA 2KE5A 4GDFA 1WMSA 3RRNA 4MA4A 4EFMA 1HA3A 3OFND 1G20E 4PXAA 5GJVC 2HCJB 4PHFA 2GTPA 2ZETA 4JSTA 2ZUDA 4YMSA 3WYFA 4DB4A 1N6NA 3CPEA 1Z63A 1SXJB 5FOVA 2FA9A 5C2JB 1SKQA 2YJTD 2VYFA 2VA8A 4DT1A 2WWFA 4US1R 1TUEA 1VYVA 4JBYA 3EWAA 3IBYA 2FZ4A 2RGDA 4Q4LA 2UVQA 1C4OA 2XZPA 2IYRA 1NJFA 1OKKD 3TE6A 1P9NA 4KBGA 2PEZA 1P5ZB 2OEPA 3C7KA 4Q1BA 2ORIA 1NMXA 4FCVA 3H0KA 3LA6A 3PUXA 4Q9LA 5FOSA 4AY2A 4YMTA 1W36B 1JXMA 4Q7JB 1E4YA 4TYNA 4BRWA 2ZUBA 3VFDA 3DPUA 1N0WA 5B58C 4D0GA 2BEKA 2H1LA 1D6JA 2R44A 1U0HC 4TQ9A 3VNVA 1BOFA 2BMDA 4HSEA 1NN1A 2IBMA 1FL9A 5AJXA 2FX3A 4OQNA 1MABB 3WYGA 3KJGA 1GWNA 2C8VA 2HT1A 4MKHA 1CJMA 1P61B 4TTQA 1W4RA 4TMZA 1D2EA 2OCYC 1HY3A 3K0AA 4GPTA 2EFGA 3EXAA 3ZVLA 3R9XA 2VSFA 2GJAA 3ZYCA 2QN6A 421PA 1YQTA 1ZUHA 3X1YA 2H57A 1E9EA 2ZVQX 3AVQA 1XMIA 3AKCA 1G9XA 3A1VA 1N2CE 3FMPB 3QPWA 1ESMA 4BWYA 2AD1A 1KTVA 4IFEA 3IGFA 4POAA 1IXRC 1NKTA 1FMJA 3W5JA 2VL7A 1TF2A 1IY1A 2WSSA 3TJZA 3EA5A 3QG5A 4QBIA 3WHLA 4Q66C 2G3YA 5P21A 5C18A 2JLVA 1WBBA 1IJEA 3PCRB 5JZVA 3NHAA 3TW4A 4ACBA 4M1SA 2QUZA 4KLZA 1LS1A 1CTQA 2B92A 1HT2E 1GP2A 4D81A 3VX4A 4NYMR 1FQJA 2V6IA 1HYQA 2JDIA 1MRSA 4LJ6A 4IVQA 1JAHA 2QENA 1WQ1R 2PL3A 2EU8A 4C0AC 2NO7A 2QP4A 2P3SA 4L15A 3HU2A 2Z6VA 4LBZA 4XTRA 4IDNA 4WXPA 4A15A 1ZCBA 2GXSA 1A82A 3GD7A 3EARA 1CEEA 2BC9A 2HLDD 2YNMA 4DLWA 4HAUA 3BH6A 4LHWA 1XXHA 1OHHD 4AYWA 4KBFA 4CVNA 3NHBA 2HJVA 3DM5A 3T34A 3P27A 4D4LA 5CB8A 3HR7A 1SXJE 3KKMA 4LGMA 5JHGB 2ZYWX 3QKSB 4Q4JA 1VDZA 4DCNA 2HF9A 4HZIA 1WB9A 1KDPA 3SE0A 2GF9A 2OCPA 1KY3A 3CZPA 1IY2A 4EPXA 5CITA 3KQUA 2WAYA 4B6DA 2O52A 1KI3A 2CJWB 3M4YA 4FN5A 1Q3HA 4JKYA 2C78A 1LTQA 4KSCA 4I1VA 1OXUA 3C41J 3AM1A 3QEJA 2FMXA 2RGCA 3KKNA 4NE2A 1ZD8A 1RRFA 1RRGA 4YDHB 3I61A 3C16C 4TYYA 2W2VA 5LB4A 2GA8A 1DAFA 3CR8A 2C9OA 2HV8A 3Q7PA 2VTKA 2V1UA 3B2EA 4XWOA 4HB0A 1Y63A 1ZP6A 4LY6A 1ZIPA 4GZLA 3PUWA 3RABA 3THYB 5D3QA 1N5LA 4DUGA 5FPKA 3ADDA 3REGA 4LJYA 2HT6A 4PPGA 4DCVA 2QORA 2WIBA 4G5QA 4KO8A 3PR1A 2FNAA 4JLAA 4M1MA 1NMYA 4XSGA 2X77A 3DOFA 5KNBA 5E4FA 2ZS7A 4URXR 2DHRA 1YU9A 2OM2A 1U0JA 3BOSA 4M8NE 1W44A 2ERYA 2PCLA 4QJ5A 5BYJA 4DCSA 1AS3A 3ADCA 1E9SA 4MGZR 5AWFC 2OFXA 3QQ5A 5A0FA 3FMOB 5AJZA 3GJ0A 3GJ6A 3P4YA 2H18A 3RS2A 2J1LA 4IRUB 4UNNA 1FX0B 2OBMA 3ND9A 2WMNB 4XD7D 2ZEJA 4BLQA 1K5DA 1QHHA 3E5HA 4Q18A 2GZAA 1KI2A 4RVCA 2QE7D 2YOFA 3W6PA 3W34A 1N6LA 1JR3E 1F3OA 1ZAKA 2BV3A 4B3XA 3B60A 2ZR0A 1EX7A 3ZVMA 4R7ZA 2ECKA 1XEXB 4PSKA 5GVSA 2C2HA 1T5LA 4OHWA 2IF0A 3PUZA 4A82A 5KSYA 4OI1A 2NO6A 1P2VA 4EJSA 2IYLD 3K0AB 5TXGA 1II9A 1AKEA 1Z0FA 3AGQA 2A7QA 3OIVA 4LDJA 3TBKA 1XU4A 4A9AA 4ZIRA 1W36D 2XTNA 4JJZA 4MUAA 3IPYA 1T0HB 3DZDA 4R98A 2VHQA 2Z83A 1TNDA 1YRBA 2ZJ2A 2WWGA 4O0MA 5TB5A 1ZW6A 4Z51A 1TU3A 4V0OA 5SZJA 3JZMA 2XSZD 4AG5A 4Z1MA 1E2PA 1T4GA 2A30A 1R5OA 4UNPA 4IEIA 3NVAA 3X1DA 2QAJA 2Q9CA 4C0QC 2QMUA 5BW8A 3NDPA 4XVUA 4KFSA 1OH8A 1ESNA 1YZGA 4HYYA 1P2UA 4WIAA 3T1TA 2PH1A 4JT2A 4CGZA 1IOZA 4RZ3A 2BBSA 2XEXA 2Y8EA 3GFPA 3QEOA 1EX6A 1PUJA 2H17A 1OLOA 3K0EA 4KYUA 3TSWA 5HZHA 1EFHA
chains in the Genus database with same CATH superfamily
1U2GA 4TXNA 4D46A 1ZH4A 5E0OA 3BC1A 2EJBA 1X80B 3C39A 2HRBA 3PSAA 1AGRA 4OTZA 4ID9A 4ZVNA 3A6JA 1IG3A 1SVOA 3NOVA 4OA5A 3GLIE 3NTLA 2H2FA 4HAIA 2W2XA 4CMIA 2QM0A 3EN0A 4GMFA 2JJ2D 3QVMA 1IFXA 4MWDA 1X13A 1P1BA 3F6CA 3L3BA 2YUUA 2GZHA 4TTJA 4MHSA 1MX1A 5BN5A 1YFKA 2QRVA 2ZI5A 5K8UA 1ZVQA 3F5DA 4LF9B 2ZE5A 2QZJA 1W85A 3RK4A 2OCIA 4XPIB 1P1IA 4WVFA 4F85A 2HBYA 2HB6A 3HH2C 4GLOA 4M0KA 1SD2A 4YT5A 3LUPA 2O9JA 4JFAA 1E63A 1ST3A 4ARAA 2B5OA 4MDEA 2FCAA 4O3MA 2NUTA 3IUYA 1L5KA 2O3RA 1WKBA 1KMAA 2QVZX 3OFNA 4NAUA 2FW7A 2PV7A 3B7WA 1J5XA 2X8JB 1WRBA 2G77B 4ENQA 1CZHA 1V11A 3HJCA 3CX3A 5JHHB 4N40A 2DWOA 6ADHA 2EWWA 3BXXA 5FUYA 3GW8A 1XFAA 4B3GA 4DY6A 2VUSA 3ETLA 1DWPA 1CQXA 3GV0A 5K9ZA 1DX4A 4ZTZB 1RXIA 4HLDA 4XB2A 3H7IA 1QQAA 2H4HA 3QV1A 1CKEA 3HGQA 2QBYB 1N4AA 4WY8A 3BQNB 1H05A 3C3BA 2IA5A 4YRAA 221PA 1G6OA 1E3IA 1P2BA 2HMSA 1CLUA 2Q4RA 3FY4A 3I5UA 4YVFA 2W0MA 5EGSA 1Z0SA 4W5WA 5A71A 2J87A 2C95A 2HPZA 1B23P 4MOWA 4GE0A 4NYIR 4GBJA 4W1PA 3LJKA 2X7JA 2PCJA 1G64A 3HCPA 4D6YA 1XWIA 3E3OA 2BFEB 1JEJA 1ZVKA 5EXTA 3OX2A 1QH1B 2AG0A 4H1HA 3CLUC 2GIVA 4GMHA 4PYLA 1SXPA 4YMHA 1E1DA 2F9LA 3MINB 3EC1A 5IK2D 4BEWA 1EQAA 1KQOA 1ZA1A 2XMBA 3L4BA 4M76B 3SEQA 5AKJA 2CLMB 3JWIA 1E99A 1G8JA 3EIXA 1PS9A 3N7AA 1FQKA 4ONEA 4RPGA 5HF8A 3OFKA 1GTL1 2IPAB 1PAUA 4ZEOA 4HDQB 2XT9A 3UWMA 3IOCA 4LOAA 1QZTA 3UXEA 2UZ3A 1HE1C 3FYUA 3PLRA 4FXPA 4MIEA 4WECA 2LR0A 4RO0A 4Z6KA 1E7WA 3BFPA 1SM4A 5I7HA 1PTRA 1RZ3A 5KAPA 3SYKA 1EWQA 4PC7A 2OCAA 3BGWA 4LYAA 2X9QA 2GBFA 3F0TA 4JDUA 4RL4A 3YASA 4YJ2B 3D8RA 1WOYA 1ZNYA 3SC4A 2HF7A 4DMHA 3E7FA 2QTCA 1AN1I 4Y2RA 5KTTA 5CLHA 1H65A 1RFHA 3QBEA 3OFJA 3ROGA 1WV1A 3S5JA 3AOEC 4KAJA 2WDZA 2VT2A 3E9CA 2QD4A 4FCTA 5EJ5A 3F49S 4QOSA 3C5CA 4MGIR 3CNEA 2CKDA 3H75A 1DL5A 2GMWA 3LCJA 1R2QA 3MOIA 1C3JA 3OPYB 4DANA 4F3NA 4CQNA 1G2IA 5L6LB 5DU2A 1EUCA 1VXRA 2ZJFA 3KT3A 3LO5A 4TTTS 3UC9A 4OI0A 5G53C 2DWPA 5BPHA 3IP7A 2HWWA 4W99A 1O95D 3WK8A 1VHWA 4MEJA 9ABPA 3EGVA 1VPWA 1KAOA 3RVJA 3UKJA 3TNYA 1U5CA 3GT7A 4U2KA 1LSJA 1E3SA 4M21A 2GEKA 3G7SA 1R5NA 3FAZA 3G0CA 4JYMA 1JU4A 4ZN6A 4HDRB 5BOVA 3U44A 2WHYA 3QH4A 3QW2A 1W0JD 3FCUB 5ULLA 3B9QA 3EFBA 4R1QA 2PA0A 4G5YA 3Q8KA 2FR0A 2R1VA 2QN8A 5ALUA 1V16B 2ACWA 2C7BA 1NVUQ 3EGIA 2HMWA 3FNHA 4EOGA 1LPSA 2VSYA 3D6UA 5JSZB 1OFUX 1LQUA 1D6MA 1GZ4A 2AMJA 4A36A 1NJSA 4RVFA 3DC7A 3HK2A 1HDZA 4MP6A 1VLMA 2CFTA 1M8KA 4IF6A 4JOCA 5JO9A 1DC7A 1GNTA 1JH8A 1Y4DE 2Z9DA 2KPOA 1TLTA 3D7KA 5ENVA 3TM4A 3OZ7A 4G0OA 1T9HA 3ZLBA 5AK6A 3KQWA 1IL0A 1KI6B 3HJUA 3Q9UA 4RZXA 1ABEA 1I0ZA 4NBRA 2YY7A 2OK7A 1GTSA 4A73A 1T8SA 1LLDA 1PJQA 4JJFA 5LNK1 2V3WA 2C57A 2YWEA 1E58A 3OCYA 4AMLA 2PT5A 1QLWA 1SBIA 2ZTUA 1ZEJA 1REQB 1UCFA 4Y7DA 3VA7A 1FP2A 4F1JA 3PTZA 3QVGB 3NHPA 1DQZA 2PO5A 1N2CA 3PDUA 1UVGA 3CLTC 3EFOA 4BFZA 4GYWA 3CFYA 3VVMA 4ZKDA 3ANSA 2JDID 2GAIA 4HQ6A 4EUFA 4XUDA 1T3LA 3EFHA 1WOMA 2JLBA 3LECA 4FBMA 2UYGA 4KRGA 4Q3OA 2RGEA 3SIXA 1O58A 1JEQA 1WKCA 1RBQA 3C85A 4NIMA 3QVKA 5CBPA 3JS5A 1E98A 4KRXA 4CKYA 3NBFA 3FKJA 4B3BA 4MCIA 4S1OA 4WT7A 5EMKA 1LPBB 1X42A 3IAUA 5G3YA 3SQDA 1PZMA 3L92A 2YNMD 1J33A 1I1OA 3FI0A 5CAEB 2DTEA 4EFDA 1F17A 1T6YA 1KF0A 5JNSA 3HXMA 1UJNA 4P53A 1YTLA 4RLHA 3UJCA 3I2IA 3N05A 2XBUA 4KDRA 5F73A 4PO1A 4C06A 3KKPA 2XNSA 4HI0E 5K01A 1GTZA 3QMMA 3K70C 1P3DA 2XMSA 3CF4G 1WABA 2CD9A 2VZ9A 1P19A 2QN1A 2WJ4A 4GSYA 4TKUB 4TWRA 3WRXA 6ABPA 1I10A 2JRCA 1WP9A 1Y9DA 4YJFA 4Y3UA 5I7OA 5AM1A 1I4EB 3HA5A 3NH9A 1UBRS 5F77A 1TQHA 2FF5A 1CUZA 3ND7A 2A9FA 5E1OA 1XUOA 3JZDA 1KE1A 2HXSA 2IY9A 5FNVB 3ADKA 1DX6A 3OPNA 5J2TF 2QQ0A 5C5CA 1MVOA 2EVWX 1Z47A 4X1YA 2HCRA 1JHXA 2QJRA 3RFTA 2GB4A 1H1LB 4OHMA 4RVOA 5E6RA 1QX3A 1U1DA 2REBA 1SG0A 3VHLB 3VR6H 4P4TA 4OLAA 2P0EA 1CDDA 1P2FA 3QVVA 4G9BA 1K63A 1W47A 3FC3A 1CW2B 2QDXA 3JZIA 3HJBA 2QJTA 4ZHQA 5L3SA 2IYTA 3UEYA 1GUDA 2IOFA 2J33A 2RARA 3RFXA 4F60A 1CBUA 4RCVA 5B6PA 1NLYA 1P1KA 2D00A 1YS2X 3H8SA 5I48A 3PEFA 2J3MA 2B2CA 4R0NA 2V7UA 1K5PA 4MRSA 2REQB 3L77A 4XCQA 2HQ1A 2OLJA 1ZRMA 1YXMA 1YB5A 1E6KA 2ZP1A 3SEAA 4N0DA 2VT6A 4LI3X 3EMDA 1M2FA 4NMWA 3H8WA 4M60A 1FTGA 1Z4NA 2Q3EA 4RWZA 4Y2PA 2OHHA 3E27A 4NAVA 2UYQA 4H0FA 4NCJA 3SJ7A 3V00A 3VR5A 2IYXA 4BQOA 4YRZA 721PA 3ZJVA 1XVUA 1E1QA 2LP4Y 3I23A 3IJ5A 4J9VA 4LOLA 4UD2A 4Y98A 3RVPA 4YCSA 1TC2A 1B74A 5DDIP 5BN3A 1Z7YA 1IUKA 2P77A 3AY7A 3HVUA 3W4IA 1ZJZA 4MHOA 1EFRA 5EJ9A 5U4XA 1HQCA 1TGSI 1JJFA 2GJ9A 2OBFA 2ZWOA 1TVMA 3G8CA 3ZHRA 5IBCA 5LLDA 1E2NA 1U2QA 1VZ2A 4DLUA 4D9IA 2AF3C 3AX6A 5IDYA 3VKGA 2J0EA 1NSYA 4Q7LA 4LFCB 3FSXA 4V0NA 2RH9B 1P8JA 1FSGA 5FA6A 3M6AA 1Z0DA 3JQCA 2XDYA 3L49A 4W6ZA 2FF7A 3R74A 4DRXA 1PDOA 4MR8A 2XOXA 4BGDA 2FR1A 1M8JA 1A9QA 1UQRA 2AG1A 3I39X 1NOKA 2Z8YA 3ORHA 4LRYA 4PG4A 5ESXA 4XVQA 2CVHA 4AJ2A 3TMYA 3QG1A 3SJBA 2KW5A 3E82A 2Z30A 2B9EA 1TZCA 2D1RA 3RS4A 1Q44A 4EPRA 2QRUA 6YASA 4FKZA 5IUJC 4B3SB 5IDVA 2GFIA 4BV3A 3VVBA 4B09A 5F98A 4Z4IA 4EITA 3DDNA 3IMCA 3K9LA 5D6NA 2YH2A 2OP0A 3OI7A 1ABFA 1CF2O 1T24A 3R24A 4IFBA 2GWHA 4P1ZA 4PS1A 2HM7A 3A04A 3DQPA 3LVQE 2CLFB 3GGGA 3D31A 1LTKA 1Z12A 2UZAA 4YR9A 2CCKA 2GSWA 1ZMBA 4YEDA 3U39A 1J99A 1SHUX 3CUUA 3C6KA 1MIHA 2GZMA 3O8NA 3DBIA 3A26A 3JTEA 2BRUC 2J4FA 4CDMA 5JBQA 5DBFA 1XVLA 3LRPA 4W5OA 2DJ5A 1IQPA 4AJEA 5ALWA 2H2DA 1QAQA 1CZOA 4OHVA 4GZ3A 1RWXA 3C14C 2VYCA 1E89A 3EMBA 4MVJE 2CZQA 3VH3A 1WD5A 1Z17A 4INOA 4B7CA 5CB4A 5EPEA 4A6EA 1AVTA 1KI1A 2PX6A 2AV6A 5JUWA 1R10A 3H6HA 1DQYA 3EEFA 5IF9A 4I4NA 3K2QA 1PEKE 3OD1A 3QBDA 1VKZA 3RGGA 3WNBA 5AJUA 2B0JA 5DGDA 4B45A 4ZZ1A 1DTWB 2RBGA 2SKDA 3MVEA 4R1SA 3I8XA 4J1SA 4M38A 2ZJBA 5KWJA 4FILA 3S2ZA 3T9FA 3O8BA 2B37A 5SYNA 4D9MA 4QPCA 4OQXA 5IBPA 4IIBA 1SULA 4C29A 3M33A 3KCNA 3WSWA 1GDHA 3PPXA 3V46A 3IAM6 5AXAA 2BFMA 3AQ4A 3OQVA 4P4SB 2HRQA 3A1DA 3BWYA 1FSSA 1JEYB 1L5YA 3USES 1C7ZA 2XTMA 4ZV7A 3RAGA 4BATA 1K8XB 2BGMA 1LDYA 3NV9A 2BEVA 3KTOA 3OX4A 3VU8A 5JEEA 1SXQA 2Y92A 2JASA 2BP7B 5AT1A 5L3VA 2Z2ZA 2CWDA 3PDWA 1X7XA 4HLUC 4REQB 1Q1ZA 4B8YA 3KT8A 3VR4H 1X9HA 4TT3D 4I3GA 3VXKA 5FUVA 1A2QA 2E5WA 2GD0A 1IPEA 3IUSA 2IHBA 5T6MA 1QBKC 1RFGE 2H5IA 3D02A 2Z3ZA 3QKWA 4M89A 1NMZA 3F6EX 1QK3A 1L5HB 3FPGA 4BZZA 2H29A 4EY7A 3MB8A 1QKJA 1PNRA 3LSYA 2ATEA 1UMBA 5TLSA 3QITA 3PGKA 3R3XA 5HILA 4ZKEA 1OC2A 4QRDA 4BO4A 5I7VA 5DO9A 2X19A 1XC7A 5EWMA 1J8QA 1F2VA 4YAKA 2CYBA 3NTUA 4YJGB 1BFDA 3UXHA 1L2TA 1UKYA 1C80A 2MWMA 4HLNA 4RZHA 3WA6A 1PTJA 2R00C 3F8TA 1JT9A 3LDFA 4F91B 2V58A 5J3JA 1PYOA 4R6XA 1FX0A 3KB6A 3EGXA 2FUG6 4FJ1A 4HMOA 3LQ1A 1L0BA 1VI2A 3Q2KA 5C1IA 5BSRA 3RFVA 4D9FA 4LQ4A 3MSXA 2IGBA 3FBTA 4C30A 4B6EA 3QU2A 2R8ZA 5KYWB 4LN1A 2FK8A 4U2FA 3I1FA 5ARCA 4Z54A 1R1DA 4S1VA 3UWPA 2CUNA 3FF4A 4LCEA 3SMVA 4DSAA 5ICGA 1UPBA 1V8BA 1CRPA 1SGYI 1Y5NA 2FWJA 4FGKA 2WF9A 4FHDA 4FS3A 3BFJA 2ZS9A 1W0JA 1ZU5A 3ELWA 2JLAA 3O9MA 13PKA 4FP9A 5FA8A 5FI5A 5FLXA 5JS7A 4A10A 4AD8A 4I4TA 4EVQA 5K09A 4CLOB 5B2FA 5JY6A 2VKQA 3ZDDA 5CXUA 3DVSX 4X8HA 4EM6A 3BVPA 5A0VA 3LKZA 4H16A 4HTAA 1FC0A 2VBCA 5EESA 4AY3A 2FOXA 1Z56C 1JBQA 3ZY5A 3OTWA 3TGWA 3C6ZA 1HT1E 1GNLA 4ISBA 3TYXA 1FNBA 4LGYA 1H8EA 4H7HA 4UM8B 2OU2A 3ZE0B 1Z0AA 2C04A 5K8TA 5KNDA 3VR1A 4P3NA 5DTMA 4ND7A 4DNXA 1H8HA 5ECWA 4EKNB 3UK1A 4Y6GB 3OEED 4DPKA 5B12A 5JU6A 1J7JA 2OMKA 3COWA 2N47A 4AK9A 1JWAB 2WIDA 1MPXA 1R74A 3WA7A 4DV6B 5LQDA 3E9ZA 1IHYA 4IHKA 4OHPA 3WTCA 5L8VA 2V0CA 1AQLA 3C8UA 1L5WA 4IZIA 1UJ5A 3WB0A 2VJCA 3EDRA 3G2QA 4HAWA 3RUHA 2XCLA 1CR2A 5A9SA 1GAEO 3UATA 4JXJA 4ZREA 3H9GA 3D8SA 3SGBI 1LPOA 2UZ1B 3AEZA 3CA8A 3CWZA 3KXIA 2NU1I 3QJ5A 1RZVA 1THMA 4XW2A 2ACKA 2YWDA 3MRTA 1ADFA 5D5HA 1ZJYA 3TS1A 5J2TB 2YQ4A 4P80A 4WL0A 3RJMA 2XYQA 1CQZA 3AG5A 3ROKA 3PICA 5IJ9A 1XZMA 5DW0A 1U98A 2NUAA 4PO8A 5ETJA 1NKSA 4FGJA 3W8RA 3NHFA 3MCVA 2PFGA 3R6GA 4IKOA 1HE3A 2A5GA 2I3GA 2OBYA 5GONA 5B4UA 5K05A 4E51A 3U3OA 1VCMA 2H9IA 4R1NA 2XYPA 3V6LA 4QBGB 1PS0A 3D3EA 3IDQA 2P67A 2AZDA 4Q4HB 2JA2A 4D7AA 3OUZA 1P5HA 2FN4A 2YJGA 1B0ZA 2E6KA 3R4CA 4K6MA 2XBMA 3IPAA 3SSNA 1U28C 3NVMB 4HOYA 6REQA 3RVKA 5JCOA 3IFSA 3WRWA 3EIHA 3AHHA 2IZ5A 5CM8B 3WC4A 4F3RA 4K28A 4M1YA 4W1RA 1S2IA 5T41A 1KORA 4B35A 5JCZA 3DF7A 4S0XA 1D07A 1KC3A 3CINA 3EAGA 3KVOA 4EAAA 3I3SR 4FD3A 3PITA 5KOHB 1OH6A 2GYWA 5CDYA 2HKIA 3I92A 1GXSB 4RDXA 4LGCA 4OH7A 3QAHA 1DDIA 2HEGA 2YIVX 5G4KB 5BNIA 1BC5A 1KYYA 1MEOA 1BJKA 2PGLA 2C9ZA 1N34B 3OBIA 3S7TA 4H9GA 2GHTA 3CSSA 2IS4A 3UUFA 5LR6A 3I32A 3JAKB 1ANKA 2YMPA 2X9GA 3TFQA 1D8AA 4CMJA 4ZJZA 4PM4A 4LHVA 2K2QB 1V5GA 4QU9A 3W05A 3JAMA 3IO3A 1GG5A 2FFJA 1ISGA 3R20A 1KDZA 3OE5A 1C3OA 3RTBA 4PO3X 1CEQA 2EIHA 2ROQA 3LHDA 3O75A 3CRRA 4KDCA 3VVCA 3N8NA 2ZXFA 4CG0A 4MKFA 3EWIA 3K4PA 1RQPA 1S96A 1XRMA 3Q7RA 1L5RA 4G0MA 1ZMTA 2J5BA 3IT3A 4GGPA 4RPIA 3DBLA 4IIGA 4N82A 4E5UA 3IILA 5AHXA 1QTNA 1XDSA 3RU0A 2ESRA 4O4JA 5E4TA 1PR6A 3G5UA 3DFFA 1T2UA 2GFHA 2Q2NA 1PR1A 4IH4A 4BS9A 1V25A 2G9ZA 3ZLJA 1QTQA 1DZIA 2AR0A 3FFBA 2E7ZA 2OAGA 2C0CA 3VNBA 4MVWA 4BECA 4XGKA 4GZ6A 3H11B 1MMFB 3WYCA 1TIPA 2HU2A 1QH8A 2YQZA 2FPIA 3ZGXA 2GXQA 4C87A 3Q8LA 4DUZB 1GA4A 3NBQA 2IBTA 3AHEA 4LXXA 2FSIA 2J6BA 2JFPA 4FBGA 4IOLA 4FVTA 4NYJQ 4XJSA 5FF9A 4A26A 3DULA 3KL2A 3DZFA 1UAAA 1KVQA 4R8LA 2BEWB 1SBYA 1F8UA 3IP1A 3R5KA 2BOVA 5KKNB 4DNFA 1L5FA 4GLLA 3TSZA 3GEBA 2A4KA 4IS3A 4LMAA 1AQJA 3D4IA 3E5RA 3QVOA 4QOEA 4WWHA 2BI7A 3DMPA 5FPTA 5F7OA 3AOEA 5DK6A 4QULA 2W2LD 3T4PA 1UJMA 1C4XA 4NDNE 1RHUA 4AKEA 1PT9A 3E84A 5CFOA 1E79D 1GRQA 4NCKA 4KO4S 5EUQB 4LNUA 1N0HA 4Q93A 2TMYA 3L1KA 3OQOA 3PJGA 4UM5A 2YBEA 3U2QA 1FNNA 1XPJA 5A9TA 5EMMA 3WICA 4H4DA 1ZIOA 2IYUA 3PFKA 4JI1B 3WYDA 1QG6A 1NR1A 4G1UC 3DFIA 1SXJD 1MRNA 2C07A 2XXJA 4S2UA 3ZGLA 1CE8A 2R97A 3IAEA 3BFXA 5I8ZA 5A4IS 3T94A 2AFIB 4L74A 1VLQA 1CYDA 3RNLA 3RYIB 1VA5A 3U3RA 3VC2A 4AZSA 1GPKA 3D2CA 3DL2A 1YTUA 4KWHA 3W1VA 2RB4A 5EERA 2PLAA 2QROA 3QNUA 3EASA 1SGEI 3Q11A 5HTOA 3SNHA 1BG6A 2BHSA 1ZPDA 1U8EA 2NSYA 2WWIA 4NDZA 3HDHA 1JHOA 4JLUA 1GU7A 3SEZA 1QGOA 2I03A 1QQ6A 1QC5A 5KI6A 3L7YA 4JASB 5KS2A 4M8LA 4BVBA 1ZUD1 4P5PA 1UKAA 2UYOA 4FMPA 5H3HA 3LXUX 1NBWB 3R6TA 5CJPA 3T5MA 1OZAA 3OY2A 4Q1VA 1NNLA 4JQYA 3TZEA 3ZBQA 4ZDKA 5K3EA 4DYVA 1JI0A 4W82A 3IQGX 4FOPA 1RJDA 3PPWA 1SVSA 3PLNA 3UWSA 3VVLA 2GEDA 5KWIA 1E2GA 5KTYA 3PQ7A 4RKQA 5E3JA 2I1QA 3LD9A 2DULA 2F4NA 5HKLA 2B4AA 4QGBA 3S40A 3SX2A 3UCFA 4CI9A 4BAGA 4IWYA 1T8WA 5NULA 4TVKA 2Y4NA 3B3GA 4KQ9A 1K75A 1KY2A 5JTTA 5ELXA 4MQEB 2YVLA 3OF5A 3RYTC 1L4YA 2A35A 5CEEA 4A03A 1DCFA 2I99A 3BN3A 1XALA 3Q8XB 3VV3A 2J9RA 1A9OA 1GKLA 2QTNA 3AM5A 3FOWA 3RANA 2E6UX 3TLBA 3DVLA 1R4ZA 4CFYA 4Y6QA 2BR3A 2HA3A 2QXUA 1IHDA 2V7VA 2EKLA 2ZANA 4I5GA 3S1LA 3ZLVA 4AJ9A 1M6YA 2REXB 4KLCA 4F84A 4EO9A 1KMHB 4Q1FA 3EGEA 3HUUA 3RAFC 4RIEA 1J42A 3CVUA 1EQUA 4KZPA 4QEKA 3V1UA 5FI0B 2Q2VA 2DPMA 3GX1A 3T7CA 4BL5A 2VP3A 4KMMA 5BQPA 1JIKA 1TYZA 1QV7A 3DFZA 4OVKA 3FIUA 1KBEA 3PC2A 4QU5A 3IP3A 4IW3B 1G5TA 2CNWD 1HDIA 2C7RA 4WKPA 3LYLA 5KTNA 3TTVA 1M2OA 3TCNA 3HZOA 4BU1A 2OD9A 3GCZA 4Z7QB 5K03A 2JW6A 2FPKA 3GLTA 5DHAA 3NC0C 5F2OA 2VHZA 5FUXA 1Q11A 5G4LA 2O8DA 1OWLA 5BMVA 3D3KA 2L8EA 1UKVY 4RQAA 2GN8A 1H0KA 4FYXA 2XAUA 3U9TA 4CMEA 1BEEA 3VR3A 1QORA 3HFRA 1KZ7B 4K6FA 2FW0A 4V0ME 1BMDA 2O2XA 1OFUA 3LYUA 1HWYA 1N8TA 4BUZA 3UUWA 4C3UA 4D80A 5JNWA 1OIXA 3TK1A 4I46A 1D2GA 4NJMB 4XB6B 2YINC 3QKTA 4XQEA 4AIIA 4EG8A 1P2TA 3NRJA 5LYYA 3KHSA 2AFIE 4F5DA 1L4FA 4IVRA 3M4NA 3CBQA 1YI8A 1Z8NA 2I4NA 3TCKA 2DG2A 2V6JA 4CU5A 1ST2A 2CMHA 4D8TA 3V1KA 4DDWA 3ESZA 5A1JA 3HVIA 4Q3CA 4PFQA 3SR4A 1EFVA 2BEUA 2VJLA 4WERA 3GLHE 5AKEA 5HNKA 1VI5A 3CF2A 1VTKA 1WG8A 2DHQA 3ESQA 3I8SA 5JJBA 3FUWA 2NNLD 3FOEC 4Y30A 1YKSA 4OMFG 2VQSA 1VDDA 4GXQA 4O4HF 3GLGB 1RCUA 4GECA 4PY2A 2ATXA 4JJ6A 4UU7A 2YFKA 5C7OO 5AKYA 3AJRA 5BSMA 1TADA 4ITVA 5E8RA 3L05A 3VZSA 3MEKA 4LS3A 3AXSA 4RVDA 4Y2XA 1RABA 1W0KD 5LMUB 2P4SA 1LBTA 3KWMA 2GVIA 2FRXA 1TO2E 3C98A 2SICE 4N39A 1FJXA 1M9NA 2AB0A 5BQXA 3ZDAA 4NULA 4YAIA 2IP2A 2QLLA 4IY1A 4N3BA 5BT9A 3RG2A 2FMUA 2WWRA 1JN0A 2E48A 3D5EA 3PKJA 4FHEA 2R2AA 4EY5A 3FOZA 1T0UA 1LZKA 2QPLA 1KJNA 3IURA 3RS3A 4E32A 1E3WB 3KU1A 2YWFA 3P52A 2Q4TA 2ZPUA 3MSCA 2C3OA 3NETA 2C7VA 5HZGA 4I3FA 3C8HA 4FYVA 3TXAA 3BRCA 3BXFA 3PS9A 5KJEA 3TQCA 3GMIA 4P8RA 2P6AC 1N2OA 3U40A 4M0LA 4DHEA 2VHEA 1A5TA 1DDOA 3VI4B 2QSYA 1J70A 3G13A 2BKLA 3AW9A 3D2AA 1BE1A 1TW2A 1E2IA 1E3LA 1WM1A 3FYHA 3THSA 4CT5A 3UIEA 5A6SA 2H2IA 2AW3A 5DYIA 3Q5EA 4KE8A 1YBMA 1JFRA 1X87A 2PMFA 5GJWC 3RSFA 4POOA 3EW9A 2HPAA 2QMEA 4P82A 5BRJA 5ADVA 5KNBH 1GVHA 3NIWA 3PVZA 3G2IA 2IEGA 5I4KA 5JS6A 1RFLA 2QLNA 3MUOA 3ETJA 1BRTA 3PWKA 4X97A 1EA5A 3PDNA 1MT3A 2F64A 1PBTA 1L7XA 3EEBA 3GH3A 3HM2A 1C7IA 2DQKA 1ZH6A 3PEEA 3BJIA 2HRCA 4M1KA 4J90A 4QICA 1XPOA 1N92A 2QVCA 2VQDA 3N3AC 4UBJA 4DIBA 3QYAA 1QHFA 3FCOA 4IINA 2O0MA 1G8KA 4R9UC 3GBVA 2VDOB 4WLVA 5KDOA 3PA8A 4NI5A 2PSEA 2ZJ6A 3OQIA 1OXKB 2FLVA 2DP4E 2ZB4A 4I5FA 3L7IA 5DTEA 5CDFA 2B5WA 1JL3A 1SB9A 1TK2A 3L0OA 3PFHA 3T1NA 3TSAA 3V4LA 1E2EA 1ZXBA 1FY2A 3H3JA 3R77A 4M8SA 4XYEA 3W78A 2PEYA 4AI6A 2DT5A 1UMCA 3Q6MA 4TKMA 1BQ4A 1XA4A 1EGAA 2F8LA 2GM9A 2X22A 4LXTA 4QL3A 3RFUA 9ATCA 1KVTA 3CN9A 3SXUA 3G68A 5C1DA 1Z7KB 1JHMA 1KK2A 1IWOA 3VC7A 3UA3A 3F4KA 4ZI3A 2WYHA 4Z8XA 2IV2X 4B80A 3O8OB 4GLJA 1TTQB 1VMDA 1T2EA 4HQRA 5DP1A 1HTTA 3RU3A 3MMSA 5SV2A 3T61A 3URMA 4P4GA 3ZV7A 2Q45A 1YFJA 2R84A 4WLEA 1MO4A 3GLGE 1KKLA 4O59O 4O02B 4OJKA 3AVPA 1G2OA 3D9QX 3K16A 1J97A 3KPUA 1J9ZA 1GQYA 1DADA 4EHKA 4DR4B 4MQMA 3WZ2A 2C5HA 2YWJA 2DKNA 3Q7QA 3VJKA 4F92B 4GMGA 3DKVA 2JA1A 1ZRHA 2O06A 1PLJA 4YO8A 1G0OA 3B38A 3F67A 3N70A 2WVAA 4E6PA 5C5IA 5LZ4A 3UVEA 5BOSB 3B7GA 3DEIA 5DGHA 5FLYA 3ZZ0A 1U7DA 2FPSA 5HDBB 1ICEA 3OT5A 3ZWDA 3VZQA 2I9KA 1J8MF 4ZWNA 3KOYA 1VPEA 5JAPA 1G5FA 1YJXA 3VHXB 1R0BA 4URZR 3H2GA 2PGXA 5KUTA 1I4OA 2D7JA 1G8FA 2WABA 5KMGA 2HUPA 2J5RA 3I2YX 4IJUA 1QO0A 4QEDA 4RESA 3HMKA 5KYXA 3R9XB 1V41E 1JECA 2WV9A 4MWGA 4TS9A 4TSFD 5C5EA 3OUUA 4MVJG 1L7PA 4IGAA 4MUJA 5HI7A 1YE3A 2JH8A 1TL7C 2HHAA 5JFTA 4O4LA 1JG7A 1UZUA 2QI9F 2J9ZB 1Y1BA 1YZ3A 2EL9A 4MR7A 3GOHA 3I05A 2RK4A 4QO7A 1XP5A 3D4OA 1ODFA 1ADBA 1IIBA 4NVRA 4E5YA 5BWOA 1JU3A 1Y7TA 3W5VA 2HDWA 1CUHA 5E7MA 2R00A 1N0UA 5JS2A 3I9FA 3PPIA 2BD0A 4RU1A 4TL6A 2X1VA 3ROXA 3UO8B 1DFGA 3EVBA 3DMDA 1Z68A 4U00A 1R6BX 2QTGA 1KEKA 5JC1A 2G1UA 1IRIA 5CIQA 6NULA 4OYHA 4HZUB 1QU3A 4WK4B 3KV3O 3L5KA 2F3RA 3SN6A 2ZWPA 1F0PA 3HCRA 1OYOA 4C21A 1W1UA 2E4WA 4PTYA 1CJTC 4GL2A 1JZSA 2KSQA 4LVCA 3TRFA 2WKRA 3E1GA 3G9ZA 1SCAA 1S1MA 2O1SA 3TOAA 3JQFC 2GETA 2W2KA 4WK6A 5KTMA 2IYPA 3R6DA 3O6VA 2ECFA 4K9OA 2NLOA 2B20A 4BBJA 4PGGA 4B3DA 4OQEA 1H5UA 1PTKA 4FIDA 3IHWA 1PK7A 4X60A 3WKBA 2AI1A 1NVBA 2H59A 4KQKA 3O7MA 3ZIAD 1R9NA 4YBRA 1R0SA 1UBGA 2PH7A 1GSIA 3N2GB 3J80A 2OM6A 3OPYI 4TZ6A 3IP6A 5AHRA 1JLRA 4TUYA 2OBNA 3BTOA 1VB5A 4OXQA 2W6JD 3WKEA 2IHJA 1EESA 1YL5A 4P83A 4K40A 2PIDA 4ZT2A 4CL3A 4AWAA 3ER8A 3W5CA 4DR7B 4IXWA 1JDJA 1DO8A 1YZLA 3G3EA 4DAOA 2FZGA 2X5XA 1DC6A 2X86A 5LQMA 4YCBA 3LBHA 2AL7A 2H1RA 1XZQA 4UCWA 3C4VA 1RYNA 4F5ZA 3VO2A 1G8YA 4JODA 2OO7A 4YP6A 1IQUA 1ESDA 1ONSA 3OOHA 3BH0A 3BFKA 1EUQA 4CUKA 4LBVA 2A67A 2D0IA 1PX2A 2I3BA 4IQ8A 4ESVA 1KDTA 2DBQA 1RZUA 2EP5A 2VTDA 4R8RA 2YICA 2A7XA 2UUPA 3NZEA 1NBME 3UWKA 1CT9A 4XSVA 4E2XA 1ULZA 4EA7A 1QG2A 2NZYA 2CWGA 1QK5A 2XLCA 2ZYAA 3ETCA 3OU7A 3K8QA 5BWBA 2IF2A 1E7QA 1G7CA 1SWWA 1X7DA 2F3QA 1UXKA 3GGJA 1NGSA 3HKBA 4TRMA 2O1WA 2W6CX 3FDXA 4PPYA 4PSAA 2XD9A 1IMJA 3VOSA 5C51B 4KREA 2W6OA 4X8LA 2JVJA 3CNQS 1S2LA 4G97A 4UTNA 2YHSA 1EPUA 3DDCA 2QPTA 4YT2A 4MPIA 2AOUB 2AG8A 2EDCA 2YFHA 3B6JA 3DAHA 2C9MA 4XWAA 2HNBA 2I55A 2IYWA 4J07A 4WDQA 3NP9A 5ED0A 1ZI9A 3RS8A 1B76A 4KB5A 4MUNA 4YJ3A 4CMAA 1YHYA 3ZQ6A 1J0CA 1QHNA 3I1IA 4QPZA 1MHPA 1XCMA 3EOAI 1RLJA 1WEHA 2QZ9A 1M5RA 1BN7A 2PDAA 4JVNA 4TLAA 1Z18A 1IM5A 2QGNA 4WLOA 3SDSA 4B75A 4R3NA 1TPZA 2AN9A 3B6MA 4NCXA 3JD2A 4GBED 2JLUA 2DTDA 4DC0A 4EYOA 3CLRD 3QPDA 2X23A 3F5QA 1YUBA 3UAVA 4CEJA 1SGDI 5KJFA 1B2RA 4GWLA 4M99A 1F2TA 1HE4A 1O54A 2P75A 1G21A 2J46A 4CMBA 3R7LA 3DXFA 4D9BA 3VYWA 3C0KA 1U4SA 1P9GA 1UINA 4CETA 2H1HA 1E1CB 1EGMB 3MJHA 4K8RB 4L5BA 4EJ2A 2PMBA 2QJWA 4PGAA 2PUCA 2BGNA 2E49A 3TLMA 3DHEA 3T9DA 2M1XA 2C9CA 4L5JA 3PCXA 8ADHA 5HKKD 2NP7A 3D8BA 2XXAA 3OIDA 1ZOPA 4JEIA 4HRAA 4G5SA 3ELYA 1CXZA 3CKLA 1ZUWA 2NYUA 3AUJB 4Z7NB 3D2BA 3SHTA 3UMFA 5EA2A 2W43A 2RHMA 1TYEB 4MVYA 3T9BA 2Z8XA 1X0XA 5K0TA 3QYJA 2GSDA 1YUNA 4R7TA 2OXCA 2FHPA 1GA6A 4N5DA 3QIVA 2EWVA 2J32A 4QGSA 1W46A 3N1UA 3THWA 4CF4A 2I8CA 2DWCA 2RHJA 3E3MA 1NURA 1XCBA 5JD4A 4HS4A 4TLDA 1E1LA 2RIRA 1C8BA 3BIFA 3GLKA 5HOEA 2BM1A 1XAIA 2MSNA 3MD0A 4M37A 3GUYA 3DBOB 4TPKA 3SNKA 1SCJA 5FL7A 1Z6TA 5FHQA 1HOTA 3WKCA 5LP6A 1EK2A 2C31A 4RENA 3E05A 4MVJI 1X14A 1OTHA 1DKOA 2MU1A 3ONVA 4LRTB 4LYHA 5I9IA 3EQ8A 2Z6QA 4JKIA 1UBJS 2VK8A 2WJWA 2ZDHA 4LDNA 3RRZA 2H1FA 3EQZA 1QG4A 3JTMA 2OK8A 3ND5A 4AMBA 3DPSA 2DFPA 4UDOA 3ZY3A 2FLWA 4ENVA 1E7RA 1MO5A 2IUYA 5I5EA 2HU5A 3NM5A 3ZH2A 1WXEA 2P3QA 2PT7A 3Q41A 1PZFA 3BICA 3JX9A 4FYIA 1E3MA 2XITA 2ONZA 3LPMA 3VR6D 1YHNA 3PE4A 2HA4A 3RPEA 3W2FA 2I4RA 4EDFA 5C32A 5J8FA 5K2OA 2OO5C 1VJGA 2ZI3A 1JIIA 1NUSA 1P45A 3VOBA 3AUKA 2IIPA 1AKRA 4YUXA 1TUBA 3U1BA 1ZJ4A 5CBPB 5BV2P 3K6KA 4CIYA 3BWBA 3LC0A 2PZ8A 1DP4A 2PZEA 2RONA 4RIGA 4WZAA 4DCTA 1X7WA 4EB6B 1E9RA 1YQ9A 8GPBA 5ELLA 1DT5A 4KQGA 1LB1B 3D0OA 4PLPA 3RRBA 3CONA 1UP6A 3FB1A 4NJEB 4CODB 3KSZO 5G0UA 3L4SO 3FGNA 2QD5A 2WJYA 1KAQA 3BMOA 1E0SA 2BBWA 1U3VA 4F7WA 5T7BA 1ATZA 4KO2S 4NFLA 3NAGA 1T4CA 1MQ9A 1NI4B 2VXYA 4Q9DA 2VP2A 2JLXA 1KZYC 5GM1A 4QELA 1Z3IX 1SG6A 2WT8A 5DHTA 4C43A 3CS3A 3D7LA 1IK4A 4ZV9A 3TRDA 3ZYZA 3ETHA 4CPDA 4OP3A 3K9CA 5JR3A 2H2WA 5JXJA 3DNPA 1SOVA 3PT5A 2RGYA 1M5UA 1I2CA