2B8TA

Crystal structure of thymidine kinase from u.urealyticum in complex with thymidine
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
206
structure length
206
Chain Sequence
IGWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDTRSIRNIQSRTGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFGPIAKLFTYADKITKLTAICNECGAEATHSLRKIDGKHADYNDDIVKIGCQEFYSAVCRHHHKVPNRPYLNSNSEEFIKFFKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the substrate complex of thymidine kinase from Ureaplasma urealyticum and investigations of possible drug targets for the enzyme
pubmed doi rcsb
source organism Ureaplasma parvum
molecule tags Transferase
molecule keywords Thymidine kinase
total genus 54
structure length 206
sequence length 206
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2005-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2b8tA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2b8tA01
3R8CA 5AK0A 5EZ5A 3GEIA 1P2SA 2ZRGA 4JT2A 1XD8A 2CJWB 2ZANA 3GJ3A 2OV2A 4DDUA 3HU2A 4Z54A 1UBFA 1BYUA 4U02A 1IHUA 4BFUA 4JT4A 4AG5A 3DVLA 2REBA 2ROWA 4EPYA 3AUXA 1TU3A 1W0KA 4PC1A 2BKEA 1E79A 1Z0JA 5JBQA 3VX3A 5AUPB 1NL3A 1S3SA 2CK3D 3I32A 4B3CA 1OXXK 1TUIA 4ASUA 4B47A 1NN0A 2P3SA 2PH1A 1HY3A 1OW3B 1CIPA 1GIAA 4A92A 1FOEB 1ZMXA 2IUTA 1R0WA 3Q5EA 2D2EA 3UMRA 4C2TA 1TF7A 1ZIPA 1AM4D 4ACAA 3KTAB 2CXXA 2ASEA 3MLEA 2CL7X 1KJYA 1WRBA 3MFYA 2Q9AA 4QJ5A 1G8GA 4XD7D 2WTUA 3THXA 2NO6A 1DS6A 2ZJ5A 1CTQA 3PUZA 4MGIR 4TZ6A 4EPTA 2BCGY 3FWYA 4GP7A 2BMJA 3Q85A 5FL3A 1TNDA 3CPHA 1ZM2A 4N1AA 4PQFA 4O3MA 3UFFA 1JAIA 1ZCAA 1OH7A 4YMSA 1TTTA 2QMUA 2P5TB 3H1TA 1R0ZA 3E70C 3THWA 1OXSC 1S3GA 4Q9KA 3AKDA 3TSOA 4FWIB 1HTWA 1RRPA 5TXGA 1G3IA 2O0JA 1T6NA 1C4OA 1OKKA 3EAQA 2XTZA 2ZROA 1RRGA 1K8RA 4M9QA 3LQRA 2C99A 2PBRA 4MRRA 3MGCA 4JLDA 1NVUQ 5B30A 1RFHA 4QL3A 1Y63A 4AKIA 1P9WA 2YHSA 4HDCA 4XD7A 1CRPA 2O0HA 4B2PA 2AXNA 1SXJC 2H92A 1LS1A 3I4LA 4BLQA 2Z83A 5FPHA 3LDAA 2GVIA 1G291 1VDZA 4F4IA 1TF5A 3LV8A 3TE6A 4B3FX 3FMPB 2GCPA 1ZINA 2VSXA 4O0MA 3QKSB 4ZDJA 3ZZTA 2ANCA 4UQOA 1G8FA 1KMHA 2WV9A 3LD9A 1ONBA 4O2RA 3QXJA 4PXAA 4LJAA 5BN5A 3CRMA 4GOJA 3MG9A 3NWJA 1JXOA 2AD5A 3EG5A 1HE1C 5LDDC 2G6BA 3SHFA 3MWKA 1IONA 1J99A 4XJXA 2GK7A 3B8HA 3B6EA 4PPNA 4QNMA 3HU1A 1QHXA 2MMGA 2FFAA 2YWHA 2ZRMA 1E2HA 1E2EA 4L4UA 3ZD7A 3PV0A 1P73A 1JB1A 4DKXA 5KNDA 5JJKA 2Q9CA 1R6BX 4HAUA 1EGAA 4IW3B 3TAHA 1LTQA 2WJJA 1H8ED 1UF9A 4TMWA 3U3RA 1GITA 4LWZA 3HR8A 3HWSA 3DOFA 1G5RA 3NC0C 3FPAA 4DCVA 4TL8A 1AQUA 2NQ2C 5SZHB 2JJ1D 3THYA 3O47A 4A36A 2O8EA 1I4LD 3BFXA 4M1TA 3ADCA 1SULA 4Q1FA 1NNEA 5CYPA 4D2IA 1Z6XA 2WVJA 2ZRCA 1US8A 3IGFA 5CDFA 2O5VA 5JECA 4PO1A 4D6PA 4RD3A 2KBEA 2VP6A 4DJTA 5EUMA 3W6OA 3I1FA 1F48A 3N5CA 1AS3A 1YR6A 1KNXA 4PO9A 4TZ0A 3RHFA 4DLUA 2G9NA 2ZS7A 3CZPA 4YMVA 4EFLA 5FUVA 4IVQA 2ZSBA 1IOZA 5BYKA 3QXCA 2CLCX 2ZU0C 3L8ZA 3BFKA 1GNRA 5J47A 2HEIA 4BGDA 2E9SA 1E96A 3T1TA 5JCZA 1KBEA 3AP1A 3C4JA 4JL5A 4M1YA 4PQYA 2QP9X 5AWFC 4WAUA 4X8MA 221PA 3RC8A 4B3XA 1PJRA 4URZR 2FU5C 2YVUA 4RD6A 1W0JA 3KQNA 2FSFA 3EZFA 3RS4A 2XXAA 1W5TA 1HA3A 4GT1A 1P9RA 4DSUA 2ZSFA 4XTCS 5GJCA 4CVNA 4HUQA 1AJEA 5LD2C 5JHHB 2UVQA 1I2DA 2JATA 2GCOB 2B8TA 1K6MA 3K0FA 3AH8A 2QMOA 1NBMD 4IDNA 3B1YA 1Z47A 3CNLA 3HU3A 4A2QA 4B43A 5KSYA 5EXXA 4PAQA 1S4QA 1XDBA 3VNUA 3KUCA 1QHYA 2C77A 1E4VA 4OQMA 5DISB 2H57A 4XWOA 3FDIA 3U44A 1G4UR 2RCNA 4PR0A 1A7JA 3DM9B 3EPJA 121PA 1X86B 3RNLA 4ZCMA 3AVYA 1OB5A 5JRJA 1QHHB 2V7QD 3OEHD 3D6TB 3AKEA 3BERA 1B23P 5A4JA 1ANKA 1E2FA 4K81B 2FEOA 4JSYA 4EJSB 2DB6A 4KVAA 4A2PA 2ZJ8A 2WKRA 4Q48A 3ASZA 4LYHA 4Y0AA 4M21A 2GILA 3ZIAA 4KXFB 1K5DA 2PL3A 2CLDX 1W4BA 4QXAA 1GNPA 1KY2A 3KXKA 4FW9A 5LBIA 3O8RA 1G6OA 4DZZA 2CVHA 4YLGA 3CF0A 3LQQA 1E2QA 2IA5A 3HJNA 4Q4JA 1R5NA 5F98A 1N6RA 3T34A 3SJAA 5CJPA 2QRNA 3U3OA 2JASA 2GF9A 2P67A 4F93B 4CIDA 1S2MA 3K8YA 4OHYA 4IDPA 3BFVA 2GHIA 1VKJA 4RD2A 2ZXUA 2OM2A 4A9AA 2NO1A 1X1RA 4C0SA 1TBOA 1LF0A 4LHVA 1H8HA 3QIAA 1MOZA 2JIZD 1CF4A 2X19A 1XMIA 4TYNA 2J0UA 3WBJA 1M1YE 3K70C 1PTQA 2IT1A 1F2TA 1SZPA 4MRSA 5A5GA 3DO6A 4LYAA 1KZ7B 1Q1ZA 2ODEA 3P20A 4UNQA 4NYIQ 4E07A 3CH5A 1G8HA 1AS2A 3AVXA 2OUKA 3UWKA 3CPJB 3DDCA 3EARA 3UIEA 1L4YA 4OKSA 4QJ3A 1QG4A 3BWDD 2HLDD 4A4DA 4AD8A 4HLUA 3RWOA 4LHWA 3BIFA 2MSCB 3BB3A 4RD0A 5EE0A 5JJLA 2C9OA 3TSWA 2GZDA 2V7QA 2YC4C 1WBDA 1DADA 5HTKA 2A5FA 2JLRA 2XSZD 5TARA 5HCNA 1LV7A 5DGXA 2GJSA 1L8QA 2GEVA 1KJWA 1KK0A 4QG7A 3RDPA 2ELIA 2XZOA 5BN4A 1KSFX 2QQEA 2GJ8A 3NHAA 4H9GA 4ILEA 2RGEA 4WXRA 2QPTA 3VKHA 1R0XA 4M8NE 2UZ3A 2GNOA 1NBMA 4AKGA 3NBZC 3VKGA 2RGXA 3RC3A 1E94E 5EJEA 4CGZA 2Z4RA 4JJZA 4OYHA 4M1WA 2XGJA 1PV4A 4P4TA 1UAAA 3EX7C 3AKCA 4IRUB 1N6HA 3MUFA 2QROA 2PLFA 1MV5A 2H5EA 1NF3A 1HT1E 4G5QA 2OBNA 2IEZA 1KDOA 3OFND 4EJSA 4OQNA 4RCZA 2ZIAA 4RKFA 3SHWA 2B6HA 2GTPA 4BUJA 3CRQA 2QP3A 2WOOA 4HDQB 1ESNA 1HV8A 3HYTA 4HAWA 4HUQB 1P72A 2GJAA 4W5HA 1OV4A 2GESA 3GLFE 3T5DA 1GKYA 4B3GA 421PA 3TR0A 4NTZA 5M04A 4TQ9A 4NE2A 3K9LA 4IOLA 3U7EB 3WBKA 2QTHA 3N70A 1G6HA 2EFEB 3QXHA 2ZRDA 2W2TA 3DPUA 4YQFA 4US1R 4V02A 1GL7A 1KK1A 1VYUA 1OIWA 4KFRA 4ZCLA 3EZ9A 2VIIA 3CWZA 3BB1A 5FH9A 5J4KA 3NC1C 4KODA 3KJEA 3WMFA 1QG2A 5BXQC 1AZSC 1U9IC 2OILA 5E7MA 3CWQA 1Q44A 1H8EA 1LY1A 2I3BA 3BORA 4KBGA 3U60B 1XPUA 3B9PA 1T3LA 2VSOA 1CEEA 1QF9A 4KI0A 5DN6A 1VCIA 2QM8A 1KI8A 2AD1A 1IY1A 4BWYA 1GSIA 4P4SB 4A6PA 1IXSB 3DMDA 4Q47A 3E2IA 1NMZA 4X8OA 3VR2A 5EXTA 5BYJA 1AKEA 1U8ZA 1I2MA 4F4CA 3HR7A 3Q9LA 3TRFA 1CJVC 5DNYB 5CK5A 2PT7A 1KI6B 3NH6A 4IEEA 4DSTA 3SFVA 3U2QA 4RD4A 3KTAA 3THWB 3CB4A 1U90A 2QMHA 3EPKA 2W0MA 1GFIA 5JCPA 3UGDA 2XJ4A 4D81A 4M53A 3KY9A 2J41A 1QVRA 4DEYA 4WZAE 1W36B 3AF2A 3A4NA 4LOAA 3LBNA 5KUTA 5KYKA 4MYUA 1BYIA 3ZZUA 3W3AA 5DIFA 2P0EA 1ZBDA 2WSSD 4MDEA 2SHKA 4CT4B 1S8FA 5CB8A 1G16A 1Y3AA 2NO0A 2ODNA 2VHUA 3QI2A 3R20A 2XOKD 1N5LA 4JLOA 2KB0A 3FFBA 1ZNZA 4D4MA 4MQBA 3TK1A 4R7ZA 4TMXA 4C0LA 4TMKA 3HPQA 3H84A 3TVTA 2GAOA 4N3NA 3UPUA 1UKVY 1Q0UA 1B0UA 2EYQA 3QG1A 5FPKA 4IVRA 5L3VA 1P60A 1CJMA 2EQBA 2JLSA 1LB1B 3A1SA 1SVKA 3AP3A 3L82B 4L16A 3C8UA 1DG3A 4M0LA 2R65A 1DOAA 5C18A 3RRYA 3QPVA 4M22A 4C0HA 2R8RA 2A5DA 4JVNA 2QA5A 1EFCA 4HATA 3KKQA 4NYJR 3R7WA 1SXJB 3BH6A 1KSHA 4Q7KA 4CEJA 3I62A 2FEMA 4Q01A 1W4AA 3GJXC 1Z0AA 1ZD8A 2ATXA 3IQXA 4IDQA 2ZE5A 1XTKA 2PEZA 3AF1A 2VF7A 1L2TA 2V4ZA 2IXFA 5JRZA 4LX0A 4M1OA 4C4PA 1UBGA 3NEYA 1TQ6A 4DB4A 4DRZA 1ZUHA 4DXAA 2ZRJA 2DB3A 4PZZA 2ZM5A 3PEYA 2NIPA 1N2CE 3X1YA 2OFOA 2RGGA 4LJ5A 2R6FA 3GCGA 1G19A 1GILA 3OZXA 2ZRLA 2FPKA 3I73A 4PAOA 2CK3A 5D3MA 2FH5B 4YMUA 4TWZA 1E99A 4MKFA 4A2WA 1CP2A 1EG7A 3CNOA 2EWWA 2CBZA 1XU4A 2YZ2A 1NVXQ 4P32A 2CLSA 4X8LA 1KI6A 3PUVA 2AKAB 2EFCB 4NDZA 1KK3A 3NVAA 1R0YA 1EFHA 1DAIA 1AIPA 4LGMA 4M9SA 4PSAA 1NJGA 3W5IA 3WRXC 1DO2A 1VG0B 1YQTA 4Q4AB 1QBKC 1X8JA 3AGPA 2W83A 5DI3A 2DBYA 2BBTA 1F5NA 2IS2A 5K8LA 1CR4A 2GZHA 4MYCA 4DCUA 4NCIA 2O8CA 3X1XA 4KV9A 3FTQA 4MKGA 4Q4LA 4LBVA 4F92B 4LC0A 4PO8A 3ZQ6A 4Z51A 5UKDA 5L3SB 2ZI6A 1Q1BA 3NIBA 3L2OB 4TSFD 4X8HA 2J7KA 2LCFA 1UEJA 4JLMA 1MO4A 4YXWD 5KPDA 3IIKA 1NBME 3OFNA 3R9WA 1DAGA 4JLBA 1OIXA 2R6AA 4Z8XA 3BB4A 1VYTA 4EAQA 1F2UA 3I3SR 3VNVA 1SHKA 1S1MA 2FOLA 3M1IA 4F38A 2AFIE 2HF9A 3GQBA 2O8BA 3EZ2A 2QQ0A 5FBVB 2HXYA 4PPGA 1W2GA 1WCV1 2BBSA 3BH0A 2PCJA 1EFRD 1FZQA 4B48A 4A15A 3KFVA 2KJQA 2HV8A 1HQCA 3DL0A 1MO3A 2H8KA 5H70A 4BFTA 5KDLA 4ZIRB 3PG5A 1U8AA 1XEXA 4FKDA 2NPFA 1MT0A 3DKPA 4KFTA 5JWHA 4OQLA 3TKLA 3W6PA 4LV8B 4HB0A 4FI3C 2XEXA 4KHZA 3VKWA 2JA1A 1T8TA 4IVPA 1E9EA 4D0NA 4R2HA 2OSBA 4NHOA 2ZETA 2HLDA 4RZUA 1E98A 1EWQA 4HZIA 4URWR 1G3RA 2ZSEA 1QHGA 3V00A 3T15A 3KKOA 3CRW1 1E2KA 4DLWA 4F91B 1SVIA 4G5GA 4HAYA 3IEVA 3LVRE 3UWOA 2ZS9A 3QKUA 1PTRA 1M7GA 2OT3B 4JLNA 1GUAA 2ZVQX 4PFSA 3N2IA 3PR1A 3B1ZA 2ZE8A 2N42A 1WXQA 4Q5IA 3OE7D 4QGAA 1XMSA 4KFUA 4C7OA 3KJGA 3JVVA 4A8JC 1XJQA 3LY5A 2BOVA 1DPFA 3BJIA 2ZAMA 1H8HD 5FOSA 4HB3A 2IWRA 4B33A 1IAQA 4WZBE 1IM2A 2BVNA 4GDFA 2DFKB 1IJFA 1T3HA 1N5IA 1XEXB 3IBYA 4KJZA 4B35A 4UNRA 3MD0A 4Q9HA 2AHOA 3AGQA 5F2EA 4JLVA 5JSZA 1T0HB 4II7A 2OCYC 1UDWA 4BFYA 1ZM4A 1T8UA 3B5JA 2BHRA 3FYHA 4LJ4A 3T5GA 2F1IA 5KHOC 2JLXA 4AI6A 2GDJA 2IX3A 2OAP1 1IN6A 2J0UB 1Z6AA 2E1RA 2ZI5A 3AVTA 2YOGA 3NBXX 5AJWA 4FMDB 1NKSA 2ONKA 3PXGA 5FUXA 2YNMA 3Q3JB 3VU9A 3A4MA 2IYZA 1FFHA 3RANA 2J0VA 4FXPA 4BFXA 4OJQA 2F43A 3QNUA 3QPWA 2W6JD 3ZIAD 3C5CA 2C78A 3S1AA 3CRVA 2XXAB 1MR3F 3GJ4A 1A82A 3LBIA 2ATVA 2IEYA 1NLZA 3SJCA 1CLUA 1NMYA 4D0GA 1BS1A 2ZJAA 5FBQB 2WJYA 1WF3A 4NPHA 3UANA 4PC3A 5IK2D 4ESHA 1FNNA 3IHWA 4UJ5A 4XWKA 3A1VA 3B82A 1J90A 1J8YF 4CZ2A 2AK3A 5CJ2A 1Z0FA 2ZRPA 2X2EA 1FQJA 3PIRA 2QP4A 5FL7A 5B2ZA 2V1XA 1DEKA 4LJ6A 4PHFA 5LPNA 3LNCA 3PEWA 1BKDR 4CT5A 3EIQA 4M2LA 5FR2A 5TV2A 1XTJA 3M0EA 1E9BA 4C9BA 5EZ6B 5K8IA 4OL0A 5AJZA 4WVFA 2GVDC 4D4LA 1XD2A 1S1CA 2QMEA 5TDHA 2QI9C 2NOAA 5BQ5A 1R79A 1YZKA 3QENA 3LWNA 4G1UC 4A0RA 1OFUX 3LX8A 2YOFA 4NCKA 4NYMQ 5EUQB 3H2YA 1G1MA 4HB2A 3KB1A 3D3QA 5FFMA 1N25A 3AEZA 3THOA 4Q18A 4PPFA 3OIYA 2VSFA 4U00A 5H1YA 2G0NA 4XVQA 4G01B 4UKDA 1SXJE 4Q00A 3J81k 1J8MF 1W0JD 1XEFA 1A2KC 4LY6A 2ZRFA 1V43A 1Q22A 1E2NA 2GEDA 5J4HA 5TMPA 2O8DA 1KMHB 2WWHA 3K0FB 5FUYA 1N5KA 3VR1A 1FUKA 4EJSC 1OIVA 4AIIA 1W1WA 4V0ME 2IYLD 3NHBA 2IYSA 2GK6A 4NCHA 1TQ2A 1KKLA 3QEJA 3TQFA 3U44B 1DO0A 1D9ZA 1OYWA 4DCNA 2O8CB 1I4TD 1NG1A 1YRBA 3L0SA 4BLOA 2WJGA 4URXR 1NMXA 4QGHA 2A78A 2KE5A 1YZQA 4FMCB 3CXLA 4QBIA 2DFLA 2ZVPX 4DDTA 2F9LA 1JQLB 1KO8A 2QT0A 3C7KA 3KX2A 3RS0A 2CNWD 1KKMA 2VBCA 3DZDA 4XVUA 1XMVA 4IEIA 4JLAA 1NIJA 4Q9JA 5IHPA 3IPYA 4TYWA 5B64A 2C8VA 4US0R 2RHDA 5TY0A 4RFVA 3WHKA 5G3ZA 2ZUCA 4ITRC 4M1KA 1XFAA 5J4VA 3BS4A 1KAGA 3U6KA 3OEED 2ZRHA 4MITA 3TW4A 2WIAA 2ZR7A 3RRZA 3TJZA 3VX4A 1C9KA 1VIAA 3FB4A 1FMJA 2RGBA 3LLMA 4JVSB 3RRMA 1Z3IX 3AVUA 2AR7A 3IO5A 3TUIC 2D7DA 1G5PA 4R9UC 4DLZA 3G0HA 1II8B 1KDTA 3SN6A 1TADA 1XCPA 2F1RA 3B13B 3KB2A 3MMPA 1OLOA 1TEVA 1TX4B 4RD1A 1NSFA 1GDDA 4JVLA 4RZ3A 1WE2A 1D5CA 1UFQA 1Z5ZA 4BRWA 2Q21A 2W00A 3QKRA 4D4KA 1Y8FA 2YUUA 2JEOA 3V9PA 4Q19A 3KZ1E 3ZS8A 3U7HB 3NKVA 3BAFA 1JQJC 4GZLA 621PA 2QY9A 1BMFA 2XB2A 3EW9A 2QGZA 5EXSA 1DAEA 2XB4A 2O8EB 5E95A 1R4AA 1QHSA 4LYJA 3K0AA 4PPQA 4QBFA 1P7CA 3IBGA 1GL6A 2ZRKA 4ZKDA 1MO5A 1UPTA 4S2EA 4TTPA 4LBZA 5J4YA 3FHOA 2O8FB 3UEJA 1G7TA 3O8BA 4MDFA 4PSVA 1NY6A 4F7WA 3ZH9B 1FUUA 1XNJA 2NMVA 4DWJA 3A36A 5DYGA 2DCUA 4JZKA 2H18A 3OAAD 1PZNA 4G5SA 2D2FA 2EFDB 1YE8A 4QM7A 4P33A 1FAQA 4C3ZA 1BIFA 4RKEA 2IYRA 3QF7A 5C46F 3CX6A 5C4MA 1GRRA 1JPNA 4IOKA 1Q20A 1Z28A 1HURA 1TQ4A 1XJCA 5G3YA 3NEJA 1XXHE 4DSOA 4ZI3A 1G3UA 2QPOA 3R7WB 3ZD6A 1DE0A 1RKBA 3KKPA 3GLGA 1GM5A 1ZP6A 1SXJA 5GVSA 4KLZA 5KNCA 4JKYA 2GXAA 3HYRA 3LW8A 2F1HA 4QKQA 2ZYWX 1U94A 4XIGS 2A5GA 4V03A 4LHXA 2D7CA 5HZKA 4ON9A 4RFSA 2OE2A 4DEXA 2VO1A 1JECA 2W0SA 1OPXA 3PUYA 2BMFA 3UG6A 4D80A 3GMTA 3KQKA 2J5XA 2ZSDA 4GZMA 1RW4A 2HCJB 4KFSA 4U7DA 2FNFX 3T61A 2DY1A 4AG6A 2NPIA 4KLNA 5KO2A 3WP0A 4TT3A 3VR6A 3FKSA 3ZDQA 2J7PA 3GP8A 1S96A 2IS4A 1E79D 2Z43A 4GMXA 3X1ZA 2V55B 2XNDA 1J70A 1E4YA 1KSJA 1W0KD 2FNAA 2IYQA 5GJWC 3RLFA 1FW6A 2G0TA 5C4GB 5AUQA 3PUXA 3QOFA 4GMDA 1RIFA 2VP0A 3ND8A 2ZREA 1YR9A 4K8OA 2ORWA 3BJIC 4FD2A 1P4SA 2X8AA 3A1UA 1TAGA 3CRRA 3K09A 5FBRB 4A82A 3LH5A 5HPYB 1IN4A 2ODBA 2B7CA 4KCGA 3SQXA 2UKDA 3I61A 3B9QA 3VTKA 3JZAA 2HT6A 3LW7A 3UKDA 1TEXA 3KL4A 3OAAA 4WOPA 4DCTA 2AL7A 5JI2E 2BBOA 4QBGB 1A2BA 1UKZA 2AKYA 2DWPA 2NO7A 4OK6A 4D4JA 4DLTA 4FMBB 4N0EA 4WZ6A 4P4SA 3UMSA 2CJWA 3FGNA 2WICA 2NG1A 3LAWA 3EC1A 1D2EA 3ETLA 1JEDA 4E22A 1KTVA 1ZIOA 1VHTA 1ZW6A 2DWQA 2C5LA 2QAGC 3B78A 5K8UA 2WKQA 2WWXA 5KOYA 2JLYA 2Q9BA 3CNNA 4DDWA 1X6VA 3ICEA 5DI9A 5HR5A 3LVQE 1EXMA 3K09C 4KSCA 1A4RA 2ENNA 1XB2A 4FINA 2HF8A 1GOTA 4YMTA 3ZGXA 5JJIA 1QRAA 1UEIA 4QM6A 4B6DA 3RVBA 5B57C 1G20E 1OXTA 4ZKEA 4LHYA 5JS8A 4ZI2A 3K53A 2IS1A 5CM8B 2H16A 2QGNA 4LPKA 1OFHA 3VHLB 3FFAA 1TQDA 3AB3A 3MJRA 5D3QA 3TH5A 4TN1A 1YZUA 4R2IA 1E1QA 2VRWA 2JDID 1OH8A 3E1SA 2W6ID 3LLUA 4B3DA 4DLXA 1XCMA 2QN6A 2VLIA 2EWVA 1SVSA 1ETUA 1N6OA 4TMZA 2FFHA 4OHXA 1MABA 3G5UA 4D26A 3EXAA 4C7OB 2A30A 2FZLA 1BH2A 1XA6A 4OI2A 4HLQB 4XSGA 4DIEA 2O8DB 5GJBA 2PCLA 4JYCA 3U4QA 4I4LA 1N6NA 3A1TA 4BPBA 4HSEA 1JJVA 3WNDA 2OZEA 1JALA 3LBHA 4B3BA 3UMFA 2DFTA 5E4FA 2OCPA 1PLKA 1M8PA 4V0OA 1CULC 1G64A 2GZAA 4H1UA 1QHIA 3MRSA 3PUWA 4MH0R 4L9WA 2NO9A 4NCNA 4PANA 5FOWA 2WWYA 3I8SA 2G77B 2FSHA 3RABA 1EK0A 3ZS9A 2BCJQ 4BZQA 3K70D 1M6NA 4LSGA 1NVVQ 2BEKA 4LV6A 2ORIA 2J59A 3A37A 5FOUA 2HCBA 5JLJA 2IHYA 4EDHA 4MUBA 4DSNA 1E2PA 1QHNA 2FGKA 1CJTC 1F2TB 4Q1BA 2VEDA 2FF7A 4WW0A 3AVWA 1U0JA 1G7SA 1KBFA 1JBKA 1ELOA 4IXMA 3HDTA 2WAXA 2BWJA 5FUWA 4K46A 3SZRA 4B2LA 3RS3A 6Q21A 2OCAA 4JLPA 4KYUA 1AKYA 1N5JA 3VR5A 2OLKA 2AX4A 4DLVA 5DSZA 3SJZA 1E9FA 2ZUDA 1ZM9A 3QJYA 1NI3A 4GFDA 2OFXA 3OIVA 2ERXA 2WKPA 2WMOB 3REGA 4GSYA 1HE8B 2BJWA 5DH9A 2CHVA 2ZI4A 5A0FA 3UXMA 5K8TA 2QENA 1OHHD 4BASA 3C5HA 3ZLJA 2GRJA 3W6NA 2AK2A 2IL1A 2YOHA 1VG9B 2ENZA 3RS5A 1E1RA 1W2HA 3GJ7A 2ZRIA 3IO3A 3K70B 2ZI3A 2C04A 1Z0KA 2LWIA 5L3QB 3WNCA 2A2ZA 1GAJA 2J45A 1ZUNB 4Q1CA 1NIPA 4Q9LA 3TGPA 1ZAKA 4CEHB 4GPTA 5AJXA 2FX3A 2F3TA 4HLUC 3LFUA 2IS6A 1E2IA 3H4MA 1E69A 2CCJA 2OXRA 2PMDA 3ONWA 1N6IA 1OB2A 1E1RD 4MYHA 3TIFA 4GOKA 2OBLA 2NZJA 2C2HA 1N6KA 1Z2AA 2XJ9A 4Q4AA 1Q21A 4Q4HA 4ACBA 4EPVA 5IK2A 1K5GA 2I4IA 5LB2A 4TLAA 3REFA 1XMJA 5KSPA 1HYQA 5H8WA 2IHBA 4HAVA 2BM0A 4GOXA 1LF5A 3K9HA 3TLXA 3IDQA 3W8NA 4DT1B 3GJ0A 1XEWY 1M7HA 2VP9A 4Q7JB 3WXMA 2RMKA 4GBMA 3MWYW 1OE0A 4A0FA 1TPZA 3EPHA 3QQ5A 1M34E 2GETA 2LKCA 3ZYCA 4IDHA 4PX9A 1E9SA 2XZPA 5HE8A 4RZ2A 3GPLA 1E9DA 2WBLC 3V4FA 2BMDA 1P3JA 3CUEF 3FMOB 2A5JA 1YZNA 5LB4A 3TW8B 2RGNC 3P32A 4CEHA 4XTRA 3KFXA 3MWLA 1ZM3A 1GG2A 3KKNA 4ZIRA 5KSOA 1NLYA 4TLCA 4PC7A 4EFMA 3QY0A 3SE0A 3LXRA 4MKHA 5CB6A 1SKYB 3U4QB 2W2VA 3GFOA 4RVCA 3WMEA 1LS6A 4HLDA 4OI4A 1OF1A 5ANRB 1U99A 2ECKA 4Q4HB 1W36D 2AWNA 1XWIA 1WBBA 4CEIA 1KIMA 1MRNA 3BRWD 2FPLA 4HI0E 4HZUA 5KPJA 3W34A 5FOXA 1ZRHA 2HUPA 4M4SA 2B92A 3AF3A 3M6AA 1KI2A 1Q3TA 1W4CA 1COWA 3L0IB 2H1LA 1Z6TA 2OBMA 1LW7A 4CF7A 4DBLC 1A1VA 1RYHA 3DOEA 3RAPR 1US8B 1D2MA 2G1KA 4J0QA 2XITA 2P2LA 1G17A 1KI3A 3BGWA 3MAAC 821PA 4QHTA 1S0UA 2Z0MA 4ZV4A 3F5FA 1XXHB 2BC9A 2R6CA 3T1QA 2GA8A 1X3SA 3K0EA 3UG7A 3BE4A 2CCGA 3R9IA 2XTNA 2X77A 2YYZA 3TNFA 3IKJA 5JMTA 2JLVA 1RJ9B 3WYFA 3LXXA 2REOA 3SI7A 1OH5A 1VYVA 5DO9A 2IYVA 3NBFA 4P3YA 1ZC4A 1JR3A 3M4YA 4QJ4A 1C1YA 2RKOA 4JBWA 2C03A 2FE4A 5FTKA 5IDVA 1WMSA 4IKEA 1KI9A 2ZJOA 2GXUA 1XRJA 4WIAA 1CR2A 2A3RA 4LC1A 2QM7A 4LK2A 2FFBA 1P2VA 3CF2A 1XCGB 4L15A 3BK7A 4B71A 1Z2CA 3PVSA 1ODFA 4Z1MA 2ONJA 5J5CA 4ESVA 4H1VA 4EQ6B 4B73A 3QF4B 1GTVA 3DMNA 3PENA 4QOSA 5CIQA 2IYXA 4AY2A 1KO4A 4MRVA 2ORVA 5AJVB 5JEDA 2V54A 2QE7A 3EASA 1XPOA 2GVZC 1EX6A 2HYDA 2YWEA 5FR1A 4QC2A 3GJ6A 3SDZA 2GXSA 3VFDA 4F4JA 3T06B 3IIJA 4A6XA 3SS8A 4QGFA 3RSLA 4IXNA 4PZYA 2ANBA 2QORA 3ADDA 1Q1EA 3NH9A 4TL7A 3SYNA 3ICQB 3R9XA 3AKYA 3I5XA 2DHRA 4AYTA 2VTKA 2PZEA 2QTFA 2V9PA 1YJ5A 3FVQA 4UNNA 5AUNB 1FL9A 3Q8XB 3T35A 4NYIR 3A1WA 4LCBA 1XEWX 2NZ8A 1NN5A 1R2QA 3L8YA 2ZUBA 4ZDWA 4LBWA 3X2SA 1RVDA 2WSMA 4WA7A 1W4RA 1BO6A 5HKKA 1G9XA 2ZPTX 3ND9A 2B7BA 2CDNA 1VG1A 3PCRB 4R98A 1VCMA 5FOVA 1T0JB 4JIMA 2CE7A 2C9YA 1TUEA 5CM9C 3AVOA 3UGLA 3KUDA 1OYYA 3CPEA 3DHWC 4PQRA 2IUUA 1E9CA 5JWOA 2RB4A 4BLTA 4Q03A 2J7PD 3FKSD 2Q3HA 4CW7A 3KXLA 3BXZA 2A5YB 1E2MA 4PHTA 3GLIE 1PVOA 2FJUA 3C15C 3UATA 4IFEA 4C2UA 1P61B 2PZFA 2YV5A 2VHJA 3P26A 2G1JA 2BEJA 3QUSA 2QEQA 1PLJA 1GKIA 1W46A 4TL9A 4JYBA 3AUYA 3GLGE 2ZJYA 3GFTA 1CKEA 1JJ7A 1NKTA 3BBPA 4UXHA 2AN9A 1KI1A 4FMDF 4JMPA 4MRNA 3G82C 3SFZA 3FKQA 2IC5A 1G21E 4QHSA 2E73A 5JFGA 2ZR0A 1F6BA 2IYWA 4AKEA 2MSEB 5FPSA 1SXJD 3FHTA 4PSKA 4NL4H 4GI7A 1XJ0A 2ZR9A 3AP2A 3I92A 3X1DA 1T4GA 2R44A 4KAXA 4QGGA 5DLQC 4P4UA 3THYB 1LVGA 2ZQ5A 2HJGA 5P21A 5SZIA 4I81A 1E32A 1II8A 3QKTA 4BZPA 3CLVA 4D0LB 4O2LA 4OK3A 1RRCA 1SKQA 1ZUIA 5HKKD 1I4DD 1L4UA 3BC1A 4MGKR 5F9HA 2RAPA 2FZ4A 5CDFE 5KU1A 4PAMA 1TMKA 4IJMA 3HP1A 4KBFA 5LD2B 1G8YA 3PFIA 1RC8A 1CR0A 1UKEA 2FV8A 2RHMA 4KO8A 4BFZA 4XOIA 3MCAA 3TVDA 3QBTA 3DEFA 1NVWQ 4URYR 3MSXA 2XOKA 1GRNA 4JS0A 4Q02A 3RS7A 4AYXA 5BN3A 1E2DA 4C0KA 1AZTA 3GFPA 2CMKA 3D31A 1SQ5A 4HZUB 3W3ZB 3TUJC 3OESA 4CEIB 4XWAA 3QVUA 1BMFD 2Z5FA 2EFGA 1NP6A 3E5HA 2WAYA 1OJLA 4LDJA 4AURA 2JLWA 2JJ2D 1IXZA 3F0TA 2WJIA 5GVRA 3LRPA 4Z1MD 2EW1A 3SU8A 2FSIA 4RFSB 3SC3A 4BLRA 2VHQA 3CX8A 5HZHA 2GJKA 4TQUS 5FTJA 1Z6GA 3GLFA 1ESMA 1FP7A 2ZRNA 5FI0B 2GJ9A 1M7BA 1SHZA 2YWGA 1Z07A 4TTQA 1EX7A 3OIUA 1JR3D 3OEEA 4P31A 1LNZA 1V5WA 2V8OA 1WP9A 5DN6D 1S9HA 1T5LA 1HQYE 2PMKA 4HDOB 5FTNA 4FMCF 1RFLA 1ZNXA 5CK4A 3TUZC 1J7KA 3IUYA 3AVVA 5L3RA 4UXIA 4UNPA 3K0AB 3SNHA 3K0SA 2D06A 4KYIB 5CYOA 2CNWA 3GEHA 4A1FA 1E6CA 2J0QA 2NGRA 3A6PC 4L8GA 4ZPXA 1Z0DA 3T1OA 1YU9A 3WRYC 3GLHA 2IW3A 1G4AE 2DPXA 2Q3MA 1XTIA 4QBHA 4E03A 1RPZA 2RGNA 1DAFA 4WXPA 3W90A 1KHTA 4EQ6A 2J0SA 2IK8A 4JLJA 3U3JA 3WY9A 2R2AA 4OQFA 3U7FB 3IQWA 4JJKA 1COWD 1VG8A 1KZGB 5EQTA 2X2FA 1IN5A 1MO6A 5B58C 3UGIA 2FDCA 1XBTA 4BLPA 2F6RA 1KYIA 2VP5A 3PEVA 2QAGA 1Z0IA 4B75A 4TLEA 3SEAA 1T91A 1NRJB 5SZJA 4EIWA 1PLLA 4PZLA 4V0KA 1L7VC 1E2JA 4FWTA 1DARA 2VP2A 1PUJA 4BLSA 2QTVB 3A8TA 3EWSA 1DBSA 1IN8A 1FTNA 3CW2A 2IF0A 1YVDA 3QKRB 2QUZA 3N2EA 5J4LA 3TAUA 5FPTA 2GCNA 2IYTA 3K9NA 4DUGD 1W44A 1JI0A 4W9MC 4MGZR 4NYJQ 2YKGA 1SVLA 2CHQA 3TSZA 4ABYA 5KTYA 3B2EA 4BEBA 1G7CA 2VH5R 4TTRA 1U9IA 2OCBA 1KSGA 4BEJA 1WB9A 4FCTA 5F3WB 1KY3A 3NG1A 3KDSE 2A7QA 4OJKA 5C2JB 1ZJ6A 5HE9A 4EFNA 5E7IA 1P9NA 3S1AB 4A8JB 4ZCIA 1SGWA 5JHGB 2NTYC 1VECA 2XSZA 1O87A 2BMEA 3L0OA 4L9SA 2VHCA 5FL7D 2F55A 4Q4JB 2QL6A 1P2UA 4GRAA 4Q21A 4EUNA 2YWFA 5AUOB 1FPMA 3KQUA 4L9MA 1KI7A 2VA8A 4PTLA 2GXQA 5EP4A 4B76A 3IEUA 1KO7A 3H86A 1M2OB 2MMCA 1UADA 2GBLC 2E87A 2OXCA 1NY5A 5FTLA 1KDPA 2JLUA 2AWOA 3EZ6A 4MUAA 1NN1A 3ADBA 2HXSA 2QPAA 2BJVA 4B32A 2DR3A 1IXRC 2J3EA 2W6JA 3ZJYA 1TL7C 3SQWA 3VAAA 1ZNYA 2GEUA 2VP4A 3BH7A 1AK2A 2OFWA 1GZSA 4POAA 2QSYA 3TQCA 1G18A 3OHMA 4TMVA 2PLRA 1YR8A 1KK2A 1W5SA 2WIBA 4URUR 4W5WA 3NXSA 3AF0A 1OT3A 5KNBA 2FFQA 4BFSA 4DUGA 1JXMA 2CEAA 1R10A 2CHGA 2DWOA 2ZITA 1UJ2A 3C16C 4LI0A 2P6RA 4TYYA 1CU1A 4TL6A 1NLFA 2EVWX 2UZIR 2I1VB 3H0KA 3FHCB 4FCVA 4JKIA 5DHFA 1VIYA 3VMFA 3X1WA 3BOSA 5H68A 1MABB 4MRPA 1D2NA 4RCYA 1TU4A 3OE7A 1D9XA 3VR4A 2XAUA 1GRQA 2TMKA 3AQ4A 1J2JA 2JJ8A 5EXPA 2F7SA 3Q7QA 3VR3A 1W47A 4YDSA 2Q3FA 2CL6X 3P1JA 4A8JA 4HUTA 1KO1A 1Q57A 1Z29A 2BBWA 2FPMA 4FN5A 1ZVQA 4W5JA 4KSBA 1F2UB 1AN0A 5FBLB 3W5JA 3WHLA 3WYGA 1II0A 2IBMA 4S35A 1R8SA 2FA9A 3VQTA 3L0PA 1W49A 5JWRA 4DLRA 2ZE7A 5DE3A 1DAKA 2BM1A 2HYIC 2OEPA 4I1VA 1Q12A 4N0DA 5L3SA 3I5YA 1ZM7A 2WWFA 3B60A 2PJZA 5L8VA 2O8BB 5JZVA 1E0AA 3RS2A 2ZJ2A 4LHZA 1XPRA 2Q0HA 3ASYA 2JAQA 2Q6TA 3B7GA 1Z06A 2QU8A 5BWMA 4GP6A 4B74A 1U81A 3B1VA 2O52A 1R8QA 1XZQA 1ZCBA 2QG6A 3QBVA 1ZU5A 4DC9A 1ZC3A 2F9MA 2MSDB 4BECA 2F43B 3EPLA 3NBYC 4Q1EA 4PC2A 2FMXA 1EFRA 2C98A 1JNYA 1G5TA 1RE0A 3EA0A 4HAZA 2J1LA 1YZLA 4OI1A 3KQLA 3A4LA 3ADKA 2J87A 1ZD9A 5JSZB 1E1QD 3TMKA 1DAHA 4GNKA 4LJ8A 4ERNA 5JEEA 3WNBA 2OESA 3FOZA 5HCIA 1CJUC 2IXEA 4NP6A 3Q5DA 4LZZA 3WMGA 5G40A 2JJ2A 3GJ8A 3SJBA 2EYUA 4DLSA 4YXWA 1Z22A 1F60A 4E09A 4Z8YA 3F3YA 1E2GA 4D25A 5AR1A 1DG1G 3EZ7A 1X8KA 4QRHA 1YZGA 5C1BA 1UBEA 4LYFA 5FBWB 1QDEA 2ZJZA 4OHWA 4EPRA 4JSTA 3IPXA 3D8BA 2QAJA 3CZQA 3Q7PA 4LJ7A 3GLGB 1IY0A 2PEYA 4ARZB 5EP3A 2D4HA 1TF2A 2ERYA 3CBQA 4JBYA 1CXZA 1QHHA 3NDBB 1TBNA 1KGDA 1VMAA 2GCOA 2XX3A 3GLFB 1UDXA 1WDTA 4KU4A 1JEEA 4IOJA 4B2IA 1EWRA 2JJ1A 4TQAA 1YHNA 1IQPA 1FNMA 2GAAA 3EIHA 4LJYA 4Q1DA 1T9HA 2N46A 2ZAOA 3MJHA 3ZVLA 3QSYA 4UNSA 3B1XA 5KDOA 3KQHA 4A0GA 1X1SA 1X8LA 2VYFA 1XD9A 721PA 1KOFA 4CYMA 1JAHA 4M1SA 2G3YA 4Q9IA 4AC9A 3CR7A 3VHXA 4AK9A 2CVFA 2WJVA 3ZVRA 4AWXA 1DVRA 4DIDA 4MA4A 3QF4A 3CM0A 2PT5A 4DB2A 2YC2C 1E9RA 2GKSA 2XNDD 5EP2A 2C9CA 2O0KA 1CR1A 5ELXA 1YRAA 1MH1A 4C30A 1JPJA 4GL2A 4TT3D 5E3HA 2ZSAA 1GNQA 3AF4A 4NYMR 4KITB 3PITA 4Q66C 4Q7MB 4URVR 4LRWA 3D7MA 1U0LA 4HB4A 3GLIA 2CCKA 4JBXA 2JGNA 1XF9A 2OLJA 2BKUA 3CH4B 1UBCA 1GL9B 1M74A 1NVVR 3UEYA 2AFHE 4LBYA 3RYTC 2F3RA 2J9RA 1U2RA 2DFNA 4A0HA 3W9YA 5EE5B 4V0LA 2ZI7A 4NCJA 5FPYA 5DI3B 1W36C 3FE2A 2GWHA 2ZYVX 3CO5A 1FX0B 3GLIB 2D62A 5DHAA 1NSTA 1FX0A 4B6EA 1QZXA 3L43A 2JLQA 3IILA 1OKKD 2BIFA 2ZYTX 3ZQJA 3WP1B 2KI5A 2G88A 4PHHA 2BDTA 4XVRA 1N3BA 2GBLA 3CX7A 1AA9A 3ZVMA 4XH9B 2ODWA 2WSSA 3K0CA 1MKYA 1FMLA 2J46A 3GEEA 1XXHA 2W58A 2LKDA 3GD7A 4CDGA 1E2LA 1MRSA 1UM8A 4M9ZA 4MYTA 5AJYA 1VHLA 2QE7D 5JS7A 4RY2A 2ZRAA 3B1WA 2EFHB 2ZYUX 2VF8A 4HYYA 3NDPA 3JVUA 3I72A 2VPPA 1RRFA 4IHQA 3PQCA 5DYIA 3P27A 2PJRA 2XZLA 2ZRBA 2F1JA 3RRNA 1G41A 3U5ZB 4NKRA 3T1VA 1Z6YA 2ZJBA 4IFBA 5BW8A 1ZD1A 1D8TA 3FMFA 1KJZA 4DLYA 1N6PA 1IBRA 4JVMA 5EP1A 3IHLA 4ASUD 2VHTA 4C0AC 3U3MA 4BZXA 4BFWA 3SR0A 5JI3E 3EIEA 4OBEA 3TBKA 4BQSA 2O8FA 2WMNB 1CBUA 1EFTA 1S9DA 1SKYE 2OO7A 4Q7LA 2RH5A 3BD9A 4DT1A 2FN4A 3CF6R 4G5RA 4TMTA 3EWAA 4FCWA 1XX6A 2GF0A 2ZE6A 5EE1A 3CKLA 1H65A 3P4XA 2W2XA 3O8CA 1N0WA 1GVNB 1Z83A 3OF5A 4OK5A 5GJVC 4M1MA 4BE7B 4HAXA 1R5BA 3LO5A 4OI0A 2P65A 3KKMA 3R8FA 2WHXA 1ZYUA 4MGYR 1E0KA 3GLHE 2QBYA 4I99A 1VCOA 4RJLA 4G0NA 1OFIA 2DYKA 1SVMA 2FWRA 4O25A 2QT1A 1E3MA 2HDNB 1AS0A 1VPLA 2ZEJA 1XP8A 1EFUA 3THXB 4OQXA 4M9XA 3SOPA 1RJ9A 5CLLA 1W48A 2B21A 3SYKA 2QSZA 2WWWA 2D74A 4NMMA 2I1QA 1KI4A 3DKVA 4QFMA 1FQKA 2V1UA 3FMIA 4D82A 2HT1A 1WQ1R 2PX0A 4TYPA 4YC7A 1W7AA 1YZTA 3U61B 4PHGA 1UKYA 1P62B 5EE9A 1R7RA 1FP6A 3OIWA 4WBSA 1PUIA 4L5BA 4I1OA 1II9A 2YINC 1G3QA 2P5SA 1G3MA 1IJEA 1VTKA 3C41J 2V6IA 4YDHB 2QZ4A 4DVGA 4DCSA 4RSGA 3U7GA 3LA6A 1VCNA 3SYLA 1CS4C 5EE3A 5KDDA 4DDVA 2FG5A 2IYUA 4IDOA 3VU9B 1T5IA 1HT2E 1CJKC 5KSZA 1XTRA 3HPRA 4YONB 2Z6VA 4I1SA 2X1VA 4QNRA 3UK6A 4ARZA 1T3SA 3K9GA 2L0XA 4OHVA 3CIOA 3QE0A 5E7JA 2HJVA 5IF9A 2K5UA 1NG9A 2V3CC 3KXIA 3EA5A 2WWGA 3LX5A 2WWIA 3ZZ0A 2RGCA 4NH0A 5IRCD 1P6XA 4P0TA 2ZS8A 4Y0VA 5IT5A 5CITA 2VQSA 4IOMA 3GLHB 2WJHA 3GJ5A 2R6GA 1HEIA 1U98A 1OHHA 1DAMA 1SVOA 4LUCA 4JL6A 1DELA 2JIZA 2V6JA 2BV3A 1XD2B 4US2R 2JLZA 3V4RA 1XTQA 1IN7A 4MKIA 4C0QC 1N0UA 3I8XA 4RZXA 2ZTSA 2R62A 3B85A 1F3OA 1CRQA 4TLBA 3SBEA 4C0BA 2WZQA 1YR7A 2WPDA 4NBSA 1U0HC 3U6BA 1HUQA 1ZU4A 2WPDD 4G5OA 2REXB 1QVAA 2WM9B 4I1UA 3EC2A 3QPUA 4NONA 4TLDA 5FOTA 1WA5A 4B6FA 4AKHA 4NZYA 1G8PA 3DZ8A 4BRUA 2R6DA 3TR5A 1XZPA 4ZDKA 1N0VC 5SZKB 4JLKA 3W8RA 1N6LA 3C14C 1RYFA 4BFVA 5L3QA 3QEOA 2ZU6A 2ZI9A 2PX3A 2XNSA 1Z8FA 4OHZA 2RGDA 8OHMA 3QG5A 3PEUA 2CE2X 3OEHA 3NTUA 5G53C 2PZGA 1RZ3A 1DTSA 4NU0A 4JL8A 521PA 4B34A 2Y8EA 1JR6A 1NN3A 4C0JA 2IYYA 3KJIA 1YKSA 2A9KA 4W7SA 1KDRA 1Q1QA 5J40A 1P5ZB 5TVKA 1AGRA 1OH6A 2XTMA 1NJFA 1E0SA 2IF2A 4LJ9A 3WYAA 3P4YA 2Z4SA 2IUSA 1XTSA 4UXJA 1OSNA 2VL7A 1GP2A 1E0JA 3JZMA 3CR8A 2H17A 2FGJA 2W6IA 4QHYA 2JDIA 2QAGB 3ECCA 2QBYB 5F9FA 3SBDA 1D6JA 2WOJA 4ZDIA 3QXSA 2R9VA 2IXGA 1OXVA 4XSHA 4YMWA 1O3YA 4R71A 1U8YA 4CRWB 1AGPA 2FSGA 4EKDA 1Z63A 4UJ3A 4ZO4A 2P6UA 1IY2A 1OFTA 5GADl 2RGAA 2IWHA 1FARA 3K1JA 3RWMB 1E9AA 1P2TA 1R5OA 1HH4A 2CL0X 2D3WA 3QVVA 4HEJA 1GWNA 3AVQA 2OHFA 4V0MA 5FI1B 2KWIA 2AXPA 1JR3E 3DM5A 3F8TA 3A58B 4AYWA 1BOFA 3QXXA 1AQYA 4FIDA 2VRWB 3T12A 5G41A 2QNRA 1LFDB 1KMQA 3IIMA 3K0CC 2B8WA 1KNQA 1G7RA 3O8DA 4E5UA 4PC6A 3KJHA 4LV5B 4EPWA 5FTMA 2YJTD 2C95A 2KSQA 1SVWA 4EPXA 1Z08A 4Q1AA 2OG2A 3MWJA 3ZVNA 4DHEA 4CEJB 3AV0B 2P6NA 5D3MB 5TB5A 2H7VA 3AM1A 4TSFA 4HLCA 3U3KA 3AVPA 1OXUA 1KO5A 1Q3HA 2N1BA 2OAQ1 4LPSA 5CLQA 3QKSA 3CONA 4U5XA 3PJRA 4TYQA 1GKUB 2EU8A 4KVGA 5CIWA 1P75A 1KAOA 3Q72A 2QRZA 1A5TA 2KBFA 2JCSA 3RSOA 4B44A 1EESA 2C96A 1ZNWA 2G83A 4V0NA 1FTSA 4G3XA
chains in the Genus database with same CATH superfamily
1Y8QA 2W9XA 3DP9A 3EZXA 4GUAA 3SAJA 3GEIA 4F3KA 3QMWA 4EL5A 3R4VA 2R8YA 2ZANA 2OHHA 1Z4QA 2QWXA 3ZK7A 1UBOS 3EIUA 1UBFA 2HNKA 4L02A 4ZI5A 4MB2A 2AW3A 4F8JA 5KVQA 1TAUA 1EJ2A 3V9AA 3OZSA 1YDFA 4YRLA 2HD4A 1VI6A 4O4IB 3LHFA 5FUMA 3TO7A 2NTEA 3K8ZA 4EPYA 3PQ2A 4RKYA 1NW9B 3QUBA 4JXXA 4GOND 3UAGA 4ARUA 5ALHA 3CX3A 1QO7A 2C5FA 4PR3A 5AM5A 1GR1A 3DZGA 4U3JB 1WTCA 4EHIA 5JZBA 4YH1A 4ZYLA 1X7XB 2ECOA 1L4LA 3MOIA 4M6WA 3H18A 4HRAA 1OXXK 2FG6C 3AB8A 2P11A 3K1YA 4CM4A 4D8UA 4B47A 2AN5A 1NN0A 1J09A 3RUPA 3KXPA 4BVHA 4D8XA 1TT5B 4B17A 1MBZA 3DMHA 4Y6OA 3W5DA 1OW3B 1CIPA 4Y2HA 4A92A 4ZVKA 1FOEB 3E9QA 1H3FA 4P80A 2D2EA 1ZPDA 4JC5A 3UMRA 4C2TA 3W04A 1O9GA 5TE9A 4M36A 3TVYA 3S1SA 3T94A 3MFYA 2Q9AA 4KGDA 2IYNA 4XD7D 3TQOA 3WC4A 3H7AA 3HN2A 1Z63A 2VZ9A 1PJ8A 1CTQA 3F3SA 2DHCA 4EPTA 2IKSA 1MQ9A 3ZTWA 5LA6F 2QTLA 5LP6A 9MHTA 2PKYX 3GOHA 4RLHA 1T1JA 3ELBA 4GP7A 1CW2B 2WAOA 2BMJA 3IUPA 3Q85A 5BR4A 1NV9A 1KYWA 1ZM2A 3AESA 3GGSA 4N1AA 3UGQA 4B0PA 5TQJA 1T0UA 5JAMA 3OIFA 4X6UA 3AHHA 2NT4A 3ESRA 3PFGA 2HQSA 3H1TA 3P2KA 3UFXB 4DV3B 1ABEA 3P9KA 4Q9KA 2CUNA 4I2NA 2I71A 2OV6A 3AKDA 4ZTBA 3IQHX 1G3IA 1OFGA 3AR7A 1WVMA 2E1PA 4OP2A 5LQKA 1K8RA 2RAUA 2LV8A 2P3LA 2PBRA 4KN6A 1SK8A 3DE0X 1L8LA 2OK8A 1RHRA 3MUEA 4DA8A 3MGCA 1NVUQ 4X60A 3WWDA 1RFHA 3KBOA 5HDBB 3S99A 1M34A 4POOA 3H04A 4AKIA 4E5MA 1MOSA 4HDCA 4YJGA 5DPMA 2O0HA 1VKRA 2ZIGA 3ORYA 4B2PA 3TW6A 5AIBA 1HI9A 5AESA 2BUBA 4W1RA 1KPHA 4G0OA 5FPHA 3H8SA 1VDZA 2O7SA 4N0MA 3LV8A 3TE6A 3UJ6A 1F14A 4FLFA 3DCYA 4OXKA 4O0MA 4WEQA 3ERCA 1D5WA 5B6PA 4OUDB 3O3OB 1X87A 4GD3Q 4UQOA 3RU2A 1C1HA 3TOXA 1RRVA 4MW4A 1HE2A 3KTOA 4JP3A 3V48A 5K0GA 1CY0A 1AXGA 4K1LA 2WF9A 3CRMA 3MG9A 1DIAA 4BQPA 4LC9A 1IBLB 3NWJA 1JXOA 1E7SA 2ZR8A 2AD5A 2EG5A 1HE1C 2W2KA 3MWKA 3NNDA 4MV5A 2GK7A 3B8HA 3B6EA 4UCFA 5JC1A 3ITDA 4QNMA 3A6HA 4XSVA 2IPAB 3OD5A 2MMGA 4HFNA 1QQ5A 2HPZA 1AQJA 1BRMA 1W93A 2AR0A 4PBRA 1P73A 1JB1A 2WSLA 5AOBA 3VPHA 4WD3A 3ZXXA 1ADCA 4J43A 3R5FA 4DRYA 5KNDA 1ISSA 1J0CA 2Y9MB 3D7NA 4PNPA 4NARA 1H8ED 1D4AA 3CLKA 4TMWA 2H1RA 2CD9A 4QPJC 4AMZA 4LWZA 1LGYA 2JARA 1SPBS 3DOFA 5JH7A 3DCNA 2WEKA 1USWA 4KDRA 4P34A 4DCVA 2R1VA 2E18A 3UBMA 5SZHB 4EABA 3LKDA 1XZDA 1V4VA 2WRZA 4AX8A 4C6RA 1ESZA 4CQMB 1QCZA 1A4XA 4FDTA 3BFXA 1MP0A 2I34A 1KFCB 2QLBA 3H0EA 1QONA 1ULNA 2BZ0A 2XYVA 4Q1FA 4UTZA 4AZ0B 4IGEA 4W7IA 5E1DA 3OE1A 5C7IO 2XRYA 3OMXA 4X6XA 5JECA 1Y7IA 1G1AA 4PO1A 1JKXA 2BL4A 4JKOA 3ZHOA 3H5AA 4DR5B 5CFOA 2DEUA 2OZVA 1W5AA 2R8PA 3I1FA 3FOFC 4NBVA 1KNXA 4JX8A 4TKUA 5E3JA 1K7CA 4NAUA 3RARA 5AVQA 2FP4A 2JVKA 4AM8A 4B4DA 2HX1A 3GY0A 5EKUA 5HIIA 4NU8X 3D7SA 5DLDA 3UOGA 5D1NA 4D9JA 3RYCB 2EAUA 2ZU0C 2HFKA 3WOVA 2I6SA 3C24A 4DA6A 3BFKA 3QVKA 5AK3A 3CLRD 1C3XA 1P81A 2A9JA 2HEIA 3TCXB 1HPTA 4BGDA 4RVNA 3BMNB 2X5NA 4BE9A 2P2DA 1C9DB 2PN1A 3AP1A 3G9TA 1ONSA 1RP1A 1V7QA 3HKCB 3PUJA 2QP9X 3PUIA 4FP9A 2HWYA 5SYAA 1KMMA 3RC8A 1XU9A 4LTNA 5ICEA 2H2GA 2YVUA 4EUFA 1YCDA 3C1UA 5C5DA 3S2FA 3V42A 2XXAA 5EZYB 1HA3A 4DSUA 1P9RA 5JDIC 3ZGZA 4BO2A 3E9RA 4QU0A 2F8MA 2GYWA 1I2DA 3E05A 1ILEA 1V16B 1YI0A 3RB8A 5AVSA 2IJGX 4IMPA 4Q3BA 2EJVA 4MPRA 3TVDA 2QMOA 1NBMD 4IDNA 3VVBA 4QWMA 1I1OA 3B1YA 2C97A 3JCZA 3BWXA 4A2QA 2Z1MA 5B7QA 3U3DA 5EXXA 1ECJA 1VMIA 1XDBA 3VNUA 3VC1A 3SEZA 1QHYA 2C77A 2Z5VA 4OQMA 5TS3A 3VU8A 4XWOA 1TECE 2FEWB 3DM9B 2VNAA 3EPJA 1MTZA 3S28A 4HDSB 4ZCMA 1VSQA 1IEWA 3IUJA 1OB5A 1C3JA 4G0YA 5JRJA 4TGLA 3WX0A 2DLDA 1TYBE 2YASA 2BI4A 5KCMA 3U6KA 1YUBA 3KYDA 1E2FA 3LP5A 4J49A 1J0AA 3SGLA 1LNSA 4J0CA 4EY8A 3ZHVA 4JSYA 1PHPA 4EJSB 3M7IA 5D2CA 3AUJB 1ZEMA 3B7PA 2YWBA 1THGA 4A2PA 4ABTA 2HI0A 2OQIA 2C42A 2Q2VA 3ASZA 5K45A 4UBMA 4Y0AA 2DUJA 2YFQA 4E5DA 4KMOA 5FLEX 3MGKA 3I6ZA 4G2NA 3GRCA 3DAYA 4Z9AA 2WA1A 4Z1MD 2F3SA 4FN4A 1VHWA 4MQ6A 4HADA 4KXFB 3LRXA 4R2LA 2CLDX 4UMEA 1V1IA 1W4BA 4QXAA 3LZ6A 4ZU3A 1YIDA 3R24A 4EW2A 4KXWA 5A2GA 3NEPX 5IJ9B 4NK5A 2VPTA 1KY2A 3MUNA 4WCDA 2OL4A 3O8RA 1G6OA 4XUGB 2CVHA 3ZKAA 1ZEJA 1SQ6A 3T7SA 3CF0A 1TEHA 4JEMA 3R7DA 1YE3A 2IA5A 3H5RA 2AG0A 3ADPA 3HJNA 4Q4JA 4ZQHA 1DC6A 2JD0A 4ZVLA 5CYGA 3NOVA 3PP8A 2WU0A 2JASA 3PDCA 4MVJM 4B8ZA 2EBWA 5BSWA 3K8YA 1YFLA 1J8DA 1P5RA 2XODA 3PWTA 3WO0A 2OM2A 4A9AA 4C20A 4MV9A 4C0SA 1LF0A 1KBQA 2A84A 1MOZA 1UIMA 2C29D 2JIZD 4NNJA 1H2RS 2J0UA 3VYUB 4S1TA 2BFWA 1NP7A 3AQIA 2AFIB 2I6QA 2IT1A 3F1LA 4WFIA 1F2TA 2YWDA 4MRSA 5JPDA 3TSCA 1YWGO 3ESDA 1DINA 3DO6A 3KQVA 4LYAA 2I62A 2G04A 2HPAA 3L04A 3WBBA 1Q1ZA 3HUTA 1C3LA 2QUJA 2CUZA 2O3SA 3LUHA 5ICFA 2O2CA 3C6XA 4JI0B 2C5SA 1AS2A 3CNEA 5HS6A 5HJ7A 1SR8A 2WJPA 4YJHB 4HDNA 1RHQA 3CPJB 2EKQA 2OPBA 1XJ5A 3EARA 2VT6A 3HFJA 4OKSA 2G72A 3HB0A 3VVCA 4QJ3A 3BWDD 4N7BA 2FPSA 4XASA 4AD8A 4MKXA 4MQLA 1VE7A 2MSCB 3BB3A 2OQ2A 4O4LF 5EE0A 2ACEA 4JJIA 1O2DA 2B34A 3TSWA 4GW3A 3ZJUA 4L6CA 5HTKA 4HDKB 1I2ZA 2CFOA 5TARA 4X7BA 3V8PA 3TSYA 5TQ2A 4QDOA 1UC9A 2CFRA 5JBNA 1L8QA 3Q41A 1R4MA 2QJOA 4QG7A 4ZV9A 2IEBA 5LJIA 2Y66A 2E7ZA 1KSFX 2QQEA 4OJNA 3U81A 2RGEA 4H77A 2GNOA 1SXIA 5KTTA 5LU8A 4MNTA 4UOQA 1W581 1PE0A 4XB1A 3VKGA 3DTVA 2F3UA 3RC3A 1B1AA 3FSYA 4B84A 2EW2A 3AY0A 1TZBA 3JR7A 3OU6A 4L5JA 2F1OA 4ZGGA 3RYHB 3EDCA 2YIDA 1A9YA 1C81A 4KWCA 4F1KA 5ERGB 3AKCA 4Y2RA 1FUIA 3GVIA 3H17A 2QROA 4YRRA 3KS9A 2MYPA 1MENA 1MJ9A 1MV5A 2H5EA 4BIIA 3DNFA 1A98A 4E4YA 2OBNA 1KDOA 3DE2X 3DKIA 2WU1A 1Z73A 3P19A 4CTKA 1QWSA 4EJSA 4UM9B 1H6BA 1CDOA 4DWVA 4H4DA 2J9GA 3MTQA 3PVCA 5BWCA 2BTEA 1BROA 1XFDA 2GTPA 1DJOA 5KQMA 3CRQA 4CMJA 4FFRA 2QP3A 3AL0C 4DR4B 2CLEB 5U1PA 2V7TA 1Z6ZA 3HYTA 4DV5B 5K8CA 3WGKA 2XQFA 2YYAA 4FFOA 4BP3A 2EGUA 2XUFA 2GESA 1XR3A 2A86A 3AERB 3QVOA 2O07A 5LQSA 1OZFA 1OC4A 4NTZA 3TR0A 3NTOA 4BVKA 3FJ1A 3PS9A 1GUZA 2BMVA 3JSAA 4OBBA 3LPDA 3LT4A 2P8SA 3DVAA 3E03A 4OFZA 3U7EB 2XAAA 1G55A 1Z45A 4L2IA 4ED9A 1T9CA 3HKEB 3OIDA 4Z4EA 1HYHA 1QHFA 5K20A 1Q3KA 1KK1A 1BXGA 3HZZA 4Z9XA 1JDNA 4HR7A 3R7BA 2NACA 4AJLA 1E9VA 2I6GA 3DNPA 5CVVA 2VQFB 2NZUG 5T4BA 3BB1A 1KDZA 1Y1QA 4G89A 3GNLA 3C1OA 1FFXB 3WMFA 5CYFA 3C45A 1IZ0A 3ANMA 3QFTA 4P4NA 4DOMA 1E3JA 1MQAA 2RARA 2WR8A 1O54A 2I3BA 3H0CA 4AJIA 2WYIA 2P5UA 4E08A 2VSOA 1T4DA 2VN8A 2AD1A 4BWYA 1GSIA 4WXEA 3HJRA 2XBMA 1OGYA 2YQPA 1SEPA 3DMDA 3HZHA 3E2IA 1GZHB 2QRUA 5EXTA 1NXXA 4O29A 4D0RA 1OMUA 3HR7A 4WLEA 2JRLA 3MWGA 1RWBA 3GPDG 4JBHA 3TRFA 5DNYB 4CM8B 2J32A 4ZAVA 3ETJA 5TPWA 2GRUA 1ZIYA 3NH6A 1XZCA 3OPMA 2CFTA 2PGJA 3U2QA 3N0TA 3W06A 3THWB 2H1OA 3I9OA 4F3NA 4UM7A 3NBMA 2BEWB 3MTDA 1VSBA 4FWBA 3OZRA 4C4SA 4ZMSA 1O95C 2G40A 2XJ4A 3KLNA 4M53A 4Z3OA 3R5AA 2J41A 4V3CA 5BORA 4KREA 4XGIA 3TEFA 3ZCQA 5KYKA 5AM0A 4MYUA 3Q8KA 1ZJ5A 1X7XA 5EKXA 5DIFA 2A59A 2QMZA 1NHGA 2QN7A 1YFKA 3NW9A 2ZZNA 1EAYA 3EEQA 4QUEA 1RM5A 1S8FA 3EUWA 4ZMBA 4KL8S 4V2UA 1YBAA 3UW1A 2FHPA 2NO0A 4MKZA 4B80A 1DKQA 4RY8A 4TRNA 3KKZA 5KVCA 3WYBA 4CMAA 1LX6A 1T5TA 3ICOA 1ZNZA 1XNHA 4D4MA 2AZDA 5L4LA 2CY0A 4CIYA 1NF2A 3K9CA 4YGXB 3PNYA 3ROPA 3IJPA 4C0LA 3U4CA 1SZJG 4ZT2A 5KKNB 2FQWA 4L74A 4OPMA 3TVTA 2VYQA 4Q4DA 5JFTA 2EYQA 3VPCA 5FPKA 4RIGA 2DMRA 1RLJA 3OEYA 3PI7A 4FBLA 4L76A 5CHEA 1IU9A 1CJMA 2D0DA 2QJRA 2AZTA 3AP3A 3VPXA 1SVKA 5JTTA 4RHYA 1I3OA 5C18A 4AX4A 4EYKA 4M22A 3MMZA 3H75A 4NJMB 3S68A 1T5BA 4JVNA 4UAGA 1IHOA 2QA5A 1H5UA 1DKMA 1ULTA 2GI4A 2IYEA 2W2MA 4OB8A 3V8MA 3DFFA 4Q7KA 1CY8A 3X2FA 2P40A 4CEJA 2QXUA 1O6FA 1W4AA 5A9RA 1Z0AA 1K7SN 2ATXA 1ODLA 2ZE5A 3G5AA 4R0NA 1KY5A 1FJ2A 1YV9A 1C0LA 4HFJA 2BHTA 3DUWA 4FD3A 1L2TA 1SUSA 4KQIA 1PW7A 1YNSA 3FTDA 4LX0A 1Q83A 1G9SA 2GARA 1TQ6A 3D8NA 5DN9A 3VYWA 4DB4A 3KZKA 2XXJA 4F1JA 4YRZA 2ZRJA 5C8DA 3KSZO 4Z3KA 2DB3A 1F0NA 2BEUA 2ZM5A 3Q5GA 2ZTVA 4WL0A 1BVHA 1N2CE 3X1YA 5KNLA 1KXZA 5CNMA 2RGGA 3GCGA 1C7FA 1G19A 2WF6A 3HDJA 1XZHA 2JBHA 2E0IA 3OEWA 2ZRLA 1LPPA 4K28A 4MTLA 4NZ9A 4R05A 4EJ2A 2CN1A 2CK3A 4JK3A 3ZQKA 1WZIA 3DSRA 2FH5B 3IVCA 4E3ZA 4YMUA 1UJ5A 2ZCJA 4A2WA 4Y7DA 1EG7A 2Z2XA 3CNOA 4P32A 2YZ2A 2QIPA 2CLSA 2ZBUA 3F9RA 2L19A 2P9YA 1LSSA 2VBGA 3HUDA 2AKAB 1U9ZA 3PUVA 3DZIA 5FUBA 4MWCA 4MI1A 3WLMA 2EFCB 4F04A 3CZMA 2PE5A 1W88B 4QT4A 3NVAA 1TJ5A 2R96A 5HK9A 3EDMA 3WRXC 1A2OA 3V1MA 4K6FA 1L9XA 1SCBA 2EQ5A 1QHEA 3HBFA 1F3LA 1X7ZA 2DPLA 2SNIE 3AGPA 2D5AA 3JAWA 3L8DA 3EVBA 3OO1A 4H0NA 5DI3A 3FWKA 3PNKA 1TVKB 2DBYA 4WDRA 4BMNA 4UM8B 5I7WA 1XCBA 4ND2A 1MU0A 2IS2A 4IUYA 2WF8A 1G2QA 2R7LA 4IJWA 1CR4A 1SELA 2SGPI 1SOUA 3PRYA 4ZK6A 4E6PA 5EJ6A 4P0QB 1T9AA 4XR4A 4DCUA 1SD1A 4QE3A 3BIWA 3L7IA 4Z7JA 1P7VA 5JD6A 4KV9A 3CBGA 3KQWA 2AZ4A 5CVCA 4MKGA 4LOHA 1YJ8A 4F92B 3DOJA 4EDFA 4U8HA 4WBNA 5GINE 3NHWA 3TDKA 1Q1BA 1CYDA 2J6IA 3GUHA 4E1AA 3VUFA 3QEMB 3LT1A 1T25A 4AS2A 2DSTA 5JSHA 3O4IA 4FR5A 4JLMA 4YXWD 1W8DA 3K7EA 1NE2A 1TMOA 1Y4AE 3O8LA 3R9WA 2RG1A 2R6AA 1A9ZA 3JD1A 3V1YA 1TCBA 4PYOA 2C2GA 4Y9UA 1W4LA 1VYTA 1F2UA 5KYNA 2GR9A 2CLHB 2Y4NA 1SHKA 3E4CA 4N7JA 3FAZA 3QELB 5IMSA 5NULA 2AJCA 1XJWA 1XCJA 2BR3A 3TE7A 1T24A 3M82A 1N2EA 4AO6A 4ZAYA 3RF6A 5KX5F 4HGNA 1ZITA 3ACCA 3OZWA 1LQ2A 5D5PA 5FBVB 1RWWA 2OECA 1VI2A 1WCV1 1RYDA 3G7SA 5HK8A 2PVSA 2QN9A 1EFRD 2IDKA 4CXMA 2FLWA 4CR6A 1V96A 3HM2A 3KFVA 4A15A 1WUKS 2HV8A 3IQIX 1DWQA 3Q7IA 1MO3A 5EJAA 3SXJA 1CQPA 3I45A 4QOIA 2BFBB 3BDIA 5ALTA 2V03A 1AKMA 1XEXA 4TMYA 1YS9A 4KFTA 3ZUPA 1HM5A 1ZL0A 1U2DC 2EIHA 4LV8B 5BUZA 3IKTA 3UVEA 3RYHA 3A6KA 5K0EA 3VKWA 4IGKA 1H23A 1SBZA 4G6ZA 4P7GA 1UR5A 2H5IA 1HDCA 4COKA 3BPSA 2ZETA 4NCAA 1E98A 3URMA 3FHJA 1YL5A 3LA8A 4OGLA 4AN1A 2GHRA 2X3FA 1DOZA 1G3RA 1QHGA 2E6UX 2WHPA 3QW2A 4URWR 1NE7A 1R8YA 1RP7A 4EM6A 3KKOA 4OIMA 3CRW1 4IUBS 1E2KA 1N13A 4IDBA 4M8IA 1J5PA 4X1IA 3H8VA 1Y5LA 2CXHA 3A3NA 4G97A 1AJEA 1OR8A 5HI7A 1RWNA 3IEVA 1NU8A 3LVRE 1VE6A 1AC5A 4XYBA 9WGAA 1BQ4A 3QKUA 2OT3B 4ZT7A 5C81A 4JLNA 3WQHA 2ZVQX 4AY6A 4KR3A 2PFKA 2ZSUA 1P0MA 3B1ZA 4TXLA 2EBUA 4AECA 2N42A 1SXQA 4Q5IA 1E63A 1TZKA 3OE7D 3QVXA 4PHCA 4OFXA 2O0LA 2JAHA 3CZRA 1AK1A 4M7OA 2DT8A 1DPFA 3FBWA 3QK7A 3AFHA 3TOZA 3A1DA 5KB3A 5AQEA 5FOSA 3NM4A 3QOYA 3V1NA 1IM2A 2DFKB 1WB5A 2ETXA 5F7JA 3FXAA 5CCBA 4U7TB 4HO1X 2GPNA 2PS9A 4P98A 1PCEA 1NJ1A 5D5HA 3L40A 3I9MA 5BV8A 3AGQA 5T64A 4JLVA 3UHPA 3GDHA 4IHJF 3Q8LA 3I64A 3ZXIA 1F6WA 2OZKA 1GG8A 1Q77A 1FYBA 3AR2A 3QLTA 2BHRA 2RGWA 3D2CA 4LJ4A 1PQWA 3BXOA 1NZDA 2W6CX 3QPDA 2J0UB 4KIJA 1F0KA 1O95A 4KIFA 2ISCA 3QYFA 4XYMA 5AJWA 4FMDB 1VHJA 3VU9A 5JPIA 5HF8A 1BN7A 3ANLA 3LC2O 5TJHA 2CVPA 2J0VA 3TLEA 1UXGA 3VJLA 4OJQA 3QPWA 2WIJA 1ABBA 2PO5A 4KDEA 3QWIA 3IP6A 4WMLA 4HNTA 4CUKA 1P0FA 3LBIA 1BDMA 2ATVA 4RF2A 4MVWA 1NLZA 1TAQA 3QVGB 5AJUA 5EMHA 1BS1A 1C9JA 2C5EA 3RJTA 1V7CA 3SJCA 3VOSA 4D0GA 2B4YA 2XCIA 4N5DA 1FNNA 4O2BF 2H00A 1YQWA 3B82A 3BCRA 3EQ2A 4QSMA 4B4KA 1J8YF 4P83A 4HQLA 5EJIA 3W3AH 1MOQA 5AVYA 1A5SB 4JGIA 5AVTA 3ZBPA 3KVVA 5F3DA 1B8UA 1Z0FA 5THQA 3UAVA 4AFNA 2X2EA 4BQIA 4B6RA 2QP4A 1UQUA 3KHSA 5DW3A 4H35A 3L1HA 1FYEA 2J08A 4DQVA 5J9FA 4BNLA 4R5MA 4CT5A 3EIQA 4BMSA 1IXYA 3LUJA 2X6TA 5TV2A 2FP4B 3M0EA 4CODB 3NRBA 5ICSA 1AE1A 2OMEA 5K8IA 1P3Y1 3RREA 2GVDC 1S1CA 3BEOA 3Q12A 4MLDA 3UXEA 1R79A 1YZKA 4U63A 4DMMA 1OFUX 2P9JA 2ZIWB 2WFMA 3I0MA 4OY3A 3ROGA 1BHSA 2JI4A 2Z2ZA 3VC7A 3H2YA 4DNXA 1WSDA 1FS5A 4HB2A 3C48A 3ZJ5A 5CLFA 3AEZA 1M1NA 4IZ6A 5LQJA 2R1TB 1YQXA 1CYEA 4NATA 5H1YA 5AJHA 1SAYA 3CGWA 2Q8NA 2Z9CA 1CIVA 3OY7A 3CVXA 4KEAA 3IERA 3G13A 5BV7A 2I66A 1YB4A 3NEAA 3RQSA 1BEUB 1XIVA 1HDIA 4IWNA 3R3VA 3FOEC 4AQDA 3HJHA 2C0QA 1VJRA 1T6ZA 1Q22A 1VMDA 2GEDA 3IXQA 3N7AA 4HJRA 4AS1A 4KHPB 2B5VA 2I67A 3K92A 2GJ4A 3L8CA 1TC1A 3K0FB 3M3DA 4L7VA 5FUYA 5ALDA 1NAIA 2G8NA 3NHFA 4EJSC 4R2KA 2TECE 1W1WA 2XMCA 4V0ME 1HFEL 1IUOA 1CT9A 2ILTA 3FYUA 5FAXA 2IIVA 4D9GA 2XE6A 4BVAA 3C97A 1L4KA 2WNIA 4KP7A 4OHUA 2I2BA 2ZJ3A 3NAZA 1IEQA 2YJGA 2HF7A 3TQSA 1DO0A 1JHVA 1FS6A 1OYWA 2NN3C 2OFPA 4BGVA 1XRPA 4KQFA 1YRBA 4URXR 3NT2A 3SJUA 1JE0A 2HWWA 2KE5A 2FCAA 4ENQA 2Z95A 3EEIA 4RTMA 2PBZA 4Q93A 5CA0B 4L08A 3KYDB 5E0OA 1X9IA 2DFLA 5GM2A 2CBXA 4Q3AA 3SHTA 4L8YA 1MB2A 3RKRA 1OLXB 1KO8A 1ID8A 1G9TA 3C7KA 3KX2A 4ZCRA 2XEDA 2CNWD 3DOIA 3AXSA 2YW2A 3BG5A 5IHPA 4IEIA 1NG9A 3EWIA 4Q9JA 5CG1A 3X1JA 1R74A 3U3XA 2C8VA 4L28A 2PLNA 2CNLA 4F06A 4BCDA 5P8WA 2IYOA 1IVYA 5HF6A 2IP1A 6PFKA 1OJ7A 5H3LA 4UC0A 5G3ZA 4JI1B 4H7PA 2P62A 4EVRA 1ZVVA 1QFMA 2K9HA 1KAGA 4D9MA 1E60A 3ZU4A 2ZRHA 3RYFB 2WIAA 3VAAA 4JEIA 3VX4A 4WBNB 1X4SA 2QRPA 4R01A 3RPEA 2B99A 1C7IA 1U1EA 2P2CA 3GRAA 1VCHA 1W76A 2XOEA 2W6OA 3IO5A 3GEPA 3OSUA 4GX1A 2CWDA 4QXQA 2D7DA 1U0RA 3RYCA 4M8KA 4RD1A 1U7HA 2ZT8A 1XKLA 1TX4B 1QP7A 4RHCA 1Z3CA 1D5CA 1VE5A 2VHEA 4LRXA 1NTRA 4D4KA 2YUUA 1KJ9A 3MA0A 3V9PA 4ZICA 3FUCA 2DPMA 1SCNE 4Q19A 3DLAA 5EWLA 3ZS8A 1A5BB 4RDHA 3MLAA 3BAFA 2FQXA 4CIWA 3WDSA 2IE8A 2C83A 3B8EA 5DIZA 1U7TA 2J31A 4RGBA 1KTIA 2QGZA 1N75A 5HYVA 5ALEA 3P94A 2XB4A 3UENA 2F3PA 3WYDA 1RNLA 1R4AA 5JNWA 2DTDA 3IBGA 4OB7A 1TUSA 4BBZA 2GFHA 1GL6A 2XGGA 2W6NA 3DZCA 1UPTA 3VKHA 5B1SA 5J4YA 3WIEA 4ZI7B 1O94D 2H63A 2IFTA 4XEUA 5KQRA 1NTOA 3VZBA 4IO1A 2J3IA 2NZVG 3TS1A 5JAUA 4QPNA 1DMSA 4WOKA 1Y1RA 1IE3A 4L9RA 1FUUA 1IOVA 2RI6A 2VNSA 8GPBA 1F0YA 5IG2A 1YFJA 3OZGA 1JFLA 3A36A 3RTCA 4FKZA 4D9BA 5DYGA 1U9JA 2H18A 4BVLA 4G5SA 4PZ0A 2D2FA 2EFDB 5JARA 4QM7A 4J3JA 1Q6YA 2ZK7A 1FZTA 1YGYA 4C3ZA 1BQ3A 1PJBA 3A31A 2IYRA 1OWLA 5L6MB 5KYWA 3CX6A 4PCUA 1JBQA 3QTBA 4HX9A 5C4MA 1JPNA 2QD3A 2DUMA 1XJCA 1IRIA 2Y0PA 4YAWA 1ZK3A 4JJ6A 5JAOA 1DUSA 1G3UA 4LGVA 3WLKX 3UJPA 3ONDA 4RLQA 1LDNA 1IBKB 1SXJA 10MHA 1TYEB 5K1ZA 3PHJA 1NC3A 2VT3A 1Y3BE 4FZVA 1NVAA 2A5GA 1X1TA 5AK4A 5U4QA 1EBFA 3IYLW 3QRWA 4LHXA 4WNAA 1D1QA 2OE2A 4RFSA 5ILOA 4DEXA 2PY6A 2VO1A 2W0SA 2BMFA 2JHGA 1N2ZA 3Q3GE 4M60A 1B41A 3GMTA 2VPXA 4NBKA 3SR3A 3HDVA 1XROA 1MOPA 2J5XA 3T9EA 3CURA 4DNFA 4DPMA 1BE0A 2RJ3A 4Q34A 1IPEA 2WINI 4MQUA 1L1EA 1QRDA 2H6EA 5K6AC 1H0ZA 3WP0A 2BEWA 2HHAA 1ULHA 2QN3A 3FKSA 4TT3A 3VR6A 3ZK8A 3GP8A 3IEMA 2IS4A 1BCRB 2XUHA 1Z68A 1XHEA 2Z43A 2F90A 4I4IA 4R31A 1WKXA 1ISJA 1KSJA 1WMFA 1LDMA 2IYQA 3I34X 4YMHA 3GP5A 1K0FA 4YRDA 4MMXB 5AUQA 2BGMA 4KMMA 2I87A 4QBTA 4YLEA 1PZMA 2ZIZA 4U2DA 2W6ZA 2B8EA 3EHEA 1U7DA 3D6AA 3L7AA 3OZCA 2CVQA 4N9QA 4E88A 3R3YA 4FD2A 4EKNB 5AI4A 1PK7A 1ZH4A 3HZOA 3CR3C 2H1IA 3K09A 4NPAA 1KZ4A 5FBRB 1KP9A 4A82A 5J63A 1FFCA 4N8SA 1T10A 1IN4A 1B2RA 3ILXA 1GLGA 1T9ZA 3DOUA 3OM1A 4O4HF 5HPYB 2R1UA 1YKFA 1N1MA 2WUEA 4BCCA 5I4IA 1JHXA 3KVNA 3IMEA 5HOQA 3B12A 4DCTA 4YPVA 3NGMA 3KT6A 2P79A 1TLFA 5I7VA 1A2BA 1RRMA 1UKZA 2DWPA 2G4VA 2YBEA 2Z1NA 3B36A 3CJQA 3Q4GA 1ZXBA 4DLTA 4N0EA 4WZ6A 3GA7A 4JUFA 1RM0A 3UMSA 2CJWA 2NU9A 3L06A 3LOUA 3ZQUA 2ZXEA 3LECA 3EC1A 2B8NA 5MN5A 2VJNA 3PUHA 1FC0A 4O8ZA 4PV7A 1ZW6A 3H5WA 2DWQA 2C5LA 2QAGC 1Q2XA 5IBCA 1NJ2A 2WWXA 4ETWA 7REQB 1NUHA 3TD2A 3TIXB 5FAKA 2JLYA 4OSPA 4E2WA 3ICEA 1DGQA 1VGQA 4HH1A 2IY8A 4ZOLA 2A0XA 2QUIA 3BF7A 5DI9A 3VUEA 4AP5A 4IJQA 1R1DA 3FUWA 2WWRA 4YVFA 5EVCA 1W30A 3N1UA 5JZ9A 1B14A 2ZBFA 4G56A 2BDUA 2DM6A 4IMRA 4HEHA 3V4LA 1L5RA 1P8AA 3V7UA 3OURA 1WCXA 5B57C 1OXTA 5IC4A 2QZPA 3QV1A 4ZI2A 5DSXA 5REQB 2YIVX 2RG7A 1MHTA 1M1YB 1KEEB 2QW1A 2ZWMA 4I7EA 4Z86A 1LR9A 1TQDA 1V4BA 2CXUA 3J7AC 3MJRA 3RSZA 1X1EA 3DTTA 4O4JA 1O7JA 1UUFA 4PZPA 3TH5A 2DPYA 4IVNA 1TQ8A 2C3PA 1YZUA 1D1SA 1E1QA 1UXHA 4B3DA 3VDUA 1JP7A 1W94A 3EXFB 4RVSA 3WK6A 3A7DA 3JYOA 4ZA2A 2QN6A 2WWTA 3L4EA 3L8GA 1U5BA 2EWVA 3ZDXB 1GAEO 4J3NA 1ETUA 5LN1A 3IPCA 1MABA 1NW3A 3KV3O 4HL6A 2SCUA 5CAEB 1DHTA 4NEHB 4OIFA 1KZ1A 3INTA 1BH2A 4WINA 4CF4A 2ZUFA 1SVNA 4DIEA 2O8DB 1CT4I 4JYCA 4I4LA 1WUYA 4R1MA 1JJVA 3WNDA 3UV7A 1BKYA 2PXHA 1H5NA 1QE0A 2FMFA 3K94A 3O4FA 4ZVOA 5LMNB 3QWBA 5B36A 3U62A 4E11A 1STOA 4IIGA 1QFJA 3L7BA 4L4YA 4MW1A 2DR0A 1PP4A 4HVLA 3GEBA 3KUKA 5YASA 4P84A 5EPOA 1JU4A 2GHQA 4NCNA 2WWYA 3NCHA 4Y67A 5IULC 3W8DA 4UCXA 4XWWA 4X63A 1GGFA 3EDOA 5K0NA 3N9IA 2ORIA 3QE3A 4LV6A 3UMMA 1U11A 3M34A 4H7EA 4IX1A 2BT4A 1CEQA 3VAZA 2FGKA 1WEHA 1CJTC 1YL7A 1HZZC 1M1NB 2VEDA 4WW0A 1AKWA 3PGA1 1ZN9A 2O57A 3E7WA 5IHXA 3F6SA 1XL0A 1G7SA 5IUNC 1KRHA 3VH2A 1DDGA 4IXMA 3VZSA 3RW9A 2HIAA 1VSUA 4F12A 3FOBA 4NZMA 3E9MA 4K46A 3IPAA 4TTJA 1U1DA 1QH0A 3SZRA 4A91A 2R6HA 3KM0A 3ZU5A 4DLVA 3VR5A 2OLKA 1A7UA 1Q0LA 5AI0A 5L7YA 1E9FA 3GVHA 2ZUDA 3SHOA 3MBKA 1ZM9A 4Q16A 5JALA 4GFDA 5ALYA 1K1EA 1J4AA 2AEEA 1RKXA 2ERXA 2ENWA 1FXUA 2WKPA 3HRHA 3IIIA 3OIVA 4G63A 5A0FA 1HE8B 5DH9A 3REGA 2GKTI 1W59A 2CHVA 2AJLI 2UVPA 1KJJA 4BASA 3G2QA 1I7SB 3RAEC 3LY9A 3LKVA 1XLUA 3BN3A 1TT7A 4I6GA 1VG9B 4EL0A 4R0VA 4YWJA 2HHLA 1E1RA 1XYGA 4H0FA 3MMXA 1ITZA 4MLPA 1XAGA 5I7HA 1W2HA 3GJ7A 2DERA 3KB6A 4U0JA 2XLBA 2ZI3A 2Q3LA 2C04A 2C07A 2LWIA 2C58A 4UFOA 4JCVE 3O9VA 5JYEA 1I7DA 1PWYE 2J45A 1KA9H 2RCYA 4H7JA 3MT7A 2M6KA 4Q9LA 4ZWNA 1Z4KA 4ZHQA 5C5IA 4O63O 5F1OA 4YREA 5AVWA 3LFUA 1VRVA 2CCJA 3L7CA 3HNPA 4BIMA 1LTHR 1H2FA 2I76A 1N6IA 3QZUA 3UUFA 3NP7A 6CHYA 1N2HA 1OB2A 3L7OA 1E1RD 2E6KA 2GM9A 4JWTA 2A3NA 4GOKA 2OBLA 2XCOA 5EIAA 3TIFA 5I47A 1U8FO 1LBEA 1W96A 1XQ1A 1ZVJA 2C2HA 1Z2AA 2XJ9A 3D6FA 3GK3A 4TKZA 1DAPA 3VISA 2XE7A 4P58A 4DIKA 4EPVA 4EYOA 1PL0A 5IK2A 5LB2A 1IFXA 2HRRA 2Q6KA 1Q7RA 5ICMA 4FOPA 1W4ZA 3OX4A 4OKNA 1XMJA 4TLAA 1HYQA 1KBZA 2Y6UA 1U04A 4HAVA 2HMAA 2KHZA 4NZOA 1CZNA 3S4YA 1N2CA 4LDPA 3K9HA 3IDQA 1I7LA 4IIHA 3VR5D 2Q4DA 4DT1B 3BVPA 4EA9A 2VP9A 3HJTA 1IVSA 5GM1A 1LSUA 4YTEA 4Y9RA 3O8OB 2A1UA 4FYYA 4D1YA 1W87A 1C3OB 1M34E 4J9VA 1EZ4A 2XZPA 4H7IA 1P31A 3UV3A 5JATA 4C01A 5LQAA 3V4FA 4N3BA 1P3JA 1QZ3A 4IIBA 5E9AA 4A23A 5K0TA 2HF2A 1OZGA 1YZNA 1SOVA 2A1TS 1N9ZA 3M89A 2FMIA 2RGNC 2XQKA 4FI3F 4XIYA 5LB4A 5B1YA 1EWTA 2HMWA 3MWLA 2CZGA 4C29A 5LXTB 4IWYA 4C76A 1OA1A 2O23A 3NYIA 2R1TA 3B7WA 2YCLA 4BEVA 4EFMA 4AUNA 3PGKA 2BM8A 3RKSA 4RIEA 1QPZA 1CUEA 4RTOA 5CEJA 2LGJA 3JYNA 1UODA 1OF1A 1RM3A 2LEOA 2C4HA 2IOFA 3R2JA 4OCZA 4R54A 5ANRB