2B8TA

Crystal structure of thymidine kinase from u.urealyticum in complex with thymidine
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
206
structure length
206
Chain Sequence
b'IGWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDTRSIRNIQSRTGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFGPIAKLFTYADKITKLTAICNECGAEATHSLRKIDGKHADYNDDIVKIGCQEFYSAVCRHHHKVPNRPYLNSNSEEFIKFFKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidine kinase
publication title Structure of the substrate complex of thymidine kinase from Ureaplasma urealyticum and investigations of possible drug targets for the enzyme
pubmed doi rcsb
source organism Ureaplasma parvum
molecule tags Transferase
total genus 54
structure length 206
sequence length 206
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2005-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2b8tA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2b8tA01
2DYKA 1AGPA 3U2QA 1A1VA 4HB4A 3A4NA 4JZKA 1JJVA 3DDCA 4TSFA 4P4SB 1NP6A 2QPAA 2X77A 4TMTA 3CPJB 5E95A 3KFVA 3B78A 1SKYE 2CVHA 2OAQ1 4UXIA 2IS1A 3Q7PA 3QEOA 5JZVA 2OXRA 1GITA 2XGJA 1GNQA 3OESA 2RGGA 3FPAA 3EX7C 1NMXA 3ZDQA 2BOVA 2GK6A 4CT4B 1IXZA 5AUNB 1UDWA 3KX2A 4G3XA 5H1YA 1WDTA 2VSXA 4KFRA 4U5XA 1R6BX 2X19A 3I5XA 1N6NA 4JMPA 2O8CB 2MSCB 1VMAA 3I8SA 4NPHA 3ECCA 1R8SA 5SZJA 1D8TA 3B1ZA 3EZ9A 1QHNA 4GP6A 4JJKA 3E5HA 4NCNA 4RY2A 3LLMA 2EQBA 1X6VA 5IK2A 1XF9A 1PUIA 3KQUA 1CJVC 1QG2A 3R9IA 2BDTA 3DKPA 3NBYC 2CMKA 3MUFA 2BHRA 2O52A 1VCOA 1GVNB 2NIPA 4QHTA 1Z63A 3Q3JB 4CZ2A 3RAPR 2J9RA 5H70A 1ETUA 2RKOA 3M4YA 2HYIC 1TU4A 3B82A 5DSZA 1A7JA 2I1VB 4IXNA 2JGNA 4NH0A 5KPDA 2ZE5A 4DT1B 2A78A 3A1UA 1XCMA 2ZJZA 1HE8B 2XNDA 3GFPA 3AB3A 3IPYA 4NTZA 2IYVA 2XZPA 3RC3A 4LBVA 1YU9A 3W6OA 1W48A 2P65A 4TZ6A 3LBNA 1XEWY 1NSTA 5CYOA 3ZZUA 2EWVA 4OI0A 1N5IA 1E2EA 3K8YA 4LC1A 4FMDF 4HAYA 4MRPA 4P4SA 3VTKA 1M7HA 1HT1E 4AI6A 2J7PA 3SU8A 1E0JA 1AS3A 3CM0A 3OEEA 4NU0A 3I61A 2JLUA 2GJSA 3GJXC 4K46A 2MMGA 1NN0A 1IBRA 2OV2A 2GETA 2KSQA 1ZCAA 1N5JA 5EUMA 3ZVLA 5EE1A 5JBQA 1R8QA 3FMIA 3SEAA 2XOKD 3ZD6A 1I2MA 1X86B 4GSYA 3VQTA 1N0WA 3CH5A 1KDRA 2B8WA 1WP9A 3PCRB 3R7WB 1VTKA 2GVDC 2ZRBA 1T0HB 4FIDA 3X1DA 5DN6A 1KNXA 2QZ4A 4QGAA 4D80A 1OHHD 1Z6GA 2C95A 5BQ5A 1L8QA 2QBYA 4QG7A 4PQRA 1SVWA 5SZKB 1F6BA 3U3KA 3SHFA 1CR2A 2ZJAA 2RGNA 5EE0A 4ZIRB 3TUIC 3I8XA 1W44A 1S8FA 2VHUA 2Q0HA 1FUKA 4NYMR 4TMZA 2FE4A 2ZS7A 2WJVA 5CK5A 4GMDA 2XB4A 3QF4B 3CRW1 4P32A 3DO6A 1Z0JA 2ZYUX 3TW8B 1E1RD 1IONA 1U9IC 4OQFA 4C4PA 1RRGA 2FSGA 3TAUA 1SQ5A 2ZR0A 2W2VA 1Z6AA 4V0MA 2VA8A 4D82A 1FW6A 1UEIA 2V1UA 4R71A 5FBWB 3T06B 1O87A 2WAXA 2YVUA 3B1VA 1CBUA 4TMWA 221PA 5GJVC 4JLPA 3DM9B 1DG1G 3IEVA 4GZLA 2IYLD 4URXR 2IEZA 1ZU5A 3DEFA 3QKTA 4UNNA 4URYR 4URWR 1XPUA 4JS0A 1G21E 3AVTA 4LOAA 1TEXA 2XTZA 2CLCX 3B7GA 3IQWA 3OAAA 1E6CA 1YRBA 3P27A 4G01B 4NHOA 2C77A 3UWOA 1YHNA 1ZC3A 4LJ9A 3A4LA 4LC0A 1VG8A 2OCBA 3TQFA 1CTQA 3AF2A 3JZAA 2ZRNA 3FFBA 4V0OA 2R6FA 2FFAA 1SXJD 1HH4A 2ZRIA 2JLYA 3SNHA 2V9PA 2CLSA 3R9WA 1D9ZA 4DLRA 1X1SA 2E87A 3KQHA 2G0NA 5FUXA 3R7WA 1U0HC 2ZI4A 5B57C 1TTTA 5JJKA 5G3YA 4FD2A 4OQMA 2FG5A 4UXHA 2B7CA 2RGEA 4PSAA 1G8YA 3QVVA 3WBKA 1OJLA 1A82A 3RDPA 5L3QB 5JI3E 1KSGA 1Z2AA 1N6OA 1NVVQ 1D2EA 4O0MA 2C2HA 3PR1A 3KJGA 2O8FB 1OKKD 4G1UC 4EKDA 2YKGA 4AK9A 4PC1A 1QVRA 2F6RA 2QPOA 3QF4A 4C30A 3S1AA 3U61B 4K81B 2BMDA 3A1VA 4DZZA 2D2FA 1KBEA 1KJZA 3P4YA 3QJYA 3WP1B 4ASUA 5JEEA 4N1AA 3SBDA 5HZKA 1U0LA 1CRPA 2V7QA 3K9HA 1DAHA 4GRAA 2R9VA 3L0SA 3TRFA 1XX6A 2FA9A 2ORIA 4B33A 2QU8A 5A5GA 1W49A 3CBQA 1XXHB 2FEOA 2HCJB 4BLOA 3NDPA 1XTIA 3AVXA 4C3ZA 4OHYA 1VKJA 1YZQA 1E9SA 2J45A 2Q3FA 2XSZA 4HAUA 4HYYA 2YOFA 4G5RA 5HCIA 2ORVA 4BZXA 2CEAA 3C15C 3OE7A 1XPOA 4MGZR 2VP9A 4NYJR 4TLCA 3K0EA 5C1BA 3GLIB 1HUQA 3FKSA 1JEDA 1S9HA 1YJ5A 1NLYA 1S9DA 2QSYA 3LRPA 4EDHA 4QJ3A 2O8EB 4JLAA 4PHHA 2QL6A 4PZYA 2PEZA 4DIEA 3QUSA 4E07A 4Z1MD 3KKPA 4Q4HA 4TMXA 2ZUDA 4WAUA 1OXUA 2WWHA 3NTUA 5CM8B 2IC5A 2VIIA 3GQBA 2LKCA 4LHYA 1Z22A 2H8KA 2F9LA 3GFOA 3GEHA 4QBIA 3LBIA 3MWKA 2JJ2A 4CEHB 4TZ0A 1G5PA 2CK3D 2EFGA 3KXKA 1PUJA 3OIVA 3L0OA 4KYIB 2P5SA 4BEBA 5A4JA 1H8ED 3RS5A 4I99A 3OF5A 2YWEA 4IDOA 2H18A 4Q4JB 3W34A 1IXRC 3DPUA 1IN7A 3EG5A 1OIXA 1M2OB 3CF0A 4MQBA 3VR4A 1I4DD 4V0KA 1DO0A 3CRVA 1P61B 5FBVB 3RABA 4LJ6A 3BB1A 3TUJC 2FF7A 4EPXA 1N0VC 2I3BA 2IXFA 2WVJA 1OW3B 2H1LA 1TQ2A 3FKQA 3CUEF 1M6NA 3U7FB 2PZFA 4LYJA 2AWNA 2FV8A 2OBLA 3C8UA 2FDCA 1HY3A 4BFZA 3E2IA 2CNWA 3IO3A 2YWFA 1Y8FA 2P3SA 3RVBA 3ZJYA 4AYXA 2VLIA 1XXHA 4I81A 1W2GA 2FU5C 3D31A 3IHWA 3P20A 2CL0X 4IOLA 5FL7A 2VYFA 3K09A 1JR6A 1D2MA 4RZXA 2CHVA 3ASZA 5BW8A 5HZHA 3KQKA 4JL5A 1SVKA 5J47A 3T1VA 4M9XA 3GLGB 2DCUA 2OO7A 1E79A 4OJQA 2GZHA 1UBEA 4MGKR 3PQCA 4JL8A 2OEPA 2ZROA 3WMEA 2FZLA 5FBLB 4LHVA 2O8EA 4LJAA 5KUTA 1GL7A 3FB4A 1XTRA 4Q7JB 1JAHA 1YZLA 1QBKC 3PIRA 4JVLA 2YUUA 1W36B 4JL6A 2QT0A 4NYIR 2AD5A 4B47A 1NLFA 5DYIA 1VHLA 2QNRA 4M1KA 4TL7A 3TJZA 2WPDD 3K0SA 1CIPA 3QPWA 4NCIA 2ZETA 2RCNA 5KSZA 5HTKA 1AGRA 4MKHA 2IYSA 4PC2A 4YXWA 3VNVA 1UDXA 3WNBA 1WCV1 1E9DA 3M6AA 1H8HD 4GDFA 3B8HA 2HJGA 2G0TA 4B3DA 1Q21A 3HYTA 1EFCA 3UWKA 4OHZA 1CKEA 3WHKA 4Q47A 4C9BA 3T35A 4Q4JA 4XWKA 5KSOA 4ZPXA 4KU4A 5JS8A 4TTRA 3BK7A 3LV8A 4PC3A 5DO9A 1G4UR 5HE8A 2FJUA 3TSWA 2SHKA 2WV9A 3QPUA 4OQLA 5BYJA 4AURA 4XVQA 1FTSA 1ODFA 4OK3A 3V9PA 5J4VA 2XJ9A 2OUKA 1J70A 1ZM3A 2IYRA 1AK2A 2VO1A 4QJ5A 2WICA 1XTQA 3TVTA 4DLZA 1JPJA 2OLJA 4ZCMA 4A8JB 4JT4A 4FMCF 4D2IA 3HYRA 2IXEA 4JT2A 4LBYA 4Q19A 3OFND 2FH5B 3GLGA 2DFKB 4EJSC 4LDJA 1P2SA 1ZD9A 5GVSA 1C4OA 1TF5A 2WWFA 1QHSA 1E0AA 5FTKA 4F93B 3ZIAA 2BEKA 3IHLA 4EAQA 1EFRD 1ZRHA 1CR0A 2GCPA 1IN8A 1NG1A 4JJZA 4LJ8A 3VAAA 4MA4A 5EZ5A 3U6BA 1CR1A 1GZSA 4WXPA 2VH5R 4XJXA 2C03A 4RD3A 5CJ2A 4BWYA 4G5SA 1RYHA 2CDNA 2YV5A 3FMOB 4D81A 4J0QA 4M2LA 1GSIA 5FL3A 4C2TA 4LJ7A 1N2CE 4KO8A 4A6XA 4B6EA 2ERYA 2PMDA 1T8TA 4BUJA 2PH1A 4C2UA 4B3XA 2ODBA 5FTLA 3LWNA 4HLQB 2I1QA 3PUXA 4FCWA 1X3SA 1E0SA 4CVNA 1MO6A 1NBMD 3NXSA 4IFEA 3U3RA 4ZKDA 3BH6A 1KMHB 2A7QA 4E5UA 5K8IA 1ZUNB 2J41A 3THYA 3K9GA 3FE2A 1COWD 2VP5A 4U02A 2ZXUA 2VQSA 4RD4A 4P31A 4DSOA 2IK8A 2EFEB 1QHIA 2Z83A 1AS0A 1UF9A 4PFSA 1Z47A 421PA 2ZRDA 2IUTA 2HXYA 2IXGA 2R65A 2ZRCA 2NGRA 1LVGA 2GJAA 1AKYA 4A15A 2VBCA 4PR0A 1YR6A 2VF7A 3K1JA 4WZBE 1XRJA 2QA5A 5JWRA 4YDSA 1OH7A 1II9A 4Q4AA 2WOJA 4IEIA 2F1IA 2WKQA 3BD9A 3KKQA 1G7SA 2OCPA 3B13B 4PAQA 2RGAA 2V3CC 3ASYA 3HR8A 3KXIA 4Q7KA 4L15A 4QBGB 4OKSA 2VSOA 4QOSA 3EPJA 2D06A 1ZIOA 1U0JA 2VHCA 4PHFA 2IYWA 3KJHA 5TV2A 4C0KA 2J0SA 1OXVA 1OPXA 4MDEA 3K9LA 4D4JA 1M7GA 2QN6A 2C96A 1GNRA 2XOKA 4QBHA 1JQJC 1Q3HA 1SXJB 4Q5IA 4BLPA 1OE0A 1ZVQA 1F60A 1N6KA 4BLQA 4BPBA 5FFMA 3PEYA 1KAOA 4O2RA 4KSCA 2GJKA 1OHHA 4DLSA 1UADA 2GESA 3F3YA 3T1QA 4E09A 2IF2A 1XBTA 2CE7A 4HDQB 4HZUB 1I2DA 1KI3A 2ENZA 1KI2A 1SZPA 1RRFA 3DOFA 4X8LA 4TTQA 4KAXA 2J59A 1XCGB 3G82C 1U81A 3HPQA 1NNEA 4FMBB 3LW8A 1II0A 2J0UB 4MITA 3WP0A 5KO2A 1W0JD 4RZ3A 1K6MA 4V0NA 2CE2X 1E1RA 1VDZA 1XXHE 4WOPA 1J8MF 2BJWA 2ZRMA 4WW0A 4A82A 1Q1BA 2R2AA 3N2EA 4TN1A 2XAUA 3RYTC 1XEWX 2A9KA 4B3CA 4DDUA 2RB4A 4B71A 3EZ7A 4HUQB 2EFHB 4GBMA 3GLIE 4UQOA 4Q4LA 1PLJA 4KSBA 4RD1A 4GL2A 5AWFC 1YR7A 1N6HA 1NSFA 3LAWA 1J90A 5G40A 2CJWB 3K53A 3C7KA 4Q7MB 3B85A 1X8KA 4B6FA 3D7MA 2W6ID 3QENA 2QRNA 4ACBA 3A1SA 2AK3A 3VU9A 3UMFA 4YC7A 4ZV4A 1D9XA 1GTVA 1U99A 4C0SA 3THWA 2VHQA 1E9BA 3FHCB 3RS3A 3UEYA 2P2LA 1ZUIA 2ZRKA 5JMTA 3GP8A 1NG9A 1T0JB 3RNLA 1Z0FA 5KNBA 1KTVA 4YONB 1J2JA 1ZMXA 3QXSA 2EU8A 1SXJA 1KO4A 1JECA 1TMKA 4WA7A 5FOVA 4D25A 4TMKA 2E1RA 1TNDA 2WOOA 4II7A 1A2KC 3THXA 3TLXA 1Z08A 1YE8A 3EZ6A 4JBXA 4PZLA 4DDTA 1MT0A 3WMFA 1RW4A 3ZQJA 5K8UA 4DDWA 2ZIAA 3UGIA 1SVIA 3AH8A 2GCOB 1LV7A 2ZSBA 3MLEA 2XX3A 5IDVA 3HDTA 3SYNA 5LDDC 2NO6A 1C9KA 1G3MA 4BECA 4HZUA 1VECA 5TDHA 1E94E 3K70B 1OKKA 1PV4A 3DMDA 5J4LA 2FSHA 2O8BB 2ZYTX 1JALA 3A58B 3VKWA 4B6DA 2QMHA 2YOGA 5FI0B 5H8WA 2UZ3A 2WMNB 3ADKA 4M1TA 2AK2A 2FN4A 2J0UA 4R9UC 4B3FX 4OHXA 4HB3A 3W6NA 1W4AA 5K8LA 4B43A 5E3HA 1BS1A 5AJWA 4LV5B 1AIPA 2OFXA 1G5TA 2REOA 1U94A 2W2TA 4ZCIA 1I4TD 4YQFA 2JLRA 1QF9A 3GLGE 1NMZA 4GI7A 5EP1A 4ZI3A 4BLTA 4AIIA 4L8GA 1S2MA 2C99A 1KDOA 5FH9A 2PX3A 5F98A 1CRQA 2PLFA 5FPTA 2WWXA 3QXJA 4V02A 3RS7A 2IL1A 5EE9A 3BOSA 4LHWA 1YZTA 2D7DA 2FMXA 4IOJA 1N6IA 4HAWA 2XXAA 4D0GA 4L16A 4PZZA 3K0CA 3EPKA 4MKIA 4KBGA 3MWLA 4C0BA 1P4SA 4C0JA 1T3HA 3NH6A 1ZUHA 5CLQA 3QXCA 1Q20A 5HKKD 4LUCA 1II8B 4TTPA 4BEJA 3GEEA 2IWRA 3AF0A 4Z1MA 2QGNA 2DWQA 1ZP6A 1KK2A 1N6LA 2Z4RA 3F8TA 3KXLA 4HSEA 3WXMA 2LCFA 5KSPA 3R9XA 3AVQA 1MABB 4S2EA 1XNJA 4Q9KA 2D74A 3U60B 4HLCA 4IFBA 4XSHA 2CK3A 3UEJA 5LB4A 3UIEA 3CWZA 4LK2A 3UGDA 3JVVA 2A3RA 2GCOA 5FR1A 5TXGA 5KTYA 3KKNA 4Z8XA 1KSFX 2FEMA 2R62A 2WAYA 4G5OA 4KV9A 4LJYA 1KK0A 3EAQA 4BFUA 1DVRA 4A36A 1P60A 2GXSA 3I3SR 4W5JA 3C41J 4BLSA 4PPFA 3A6PC 4ZDWA 2O8BA 4LI0A 3U3OA 1OXTA 2ZJ8A 1W0KD 5TARA 4DVGA 4M9ZA 2JEOA 3UGLA 2FX3A 1U8YA 1K5GA 5CB6A 4D4KA 1E9EA 5TY0A 1FUUA 1N6RA 3CLVA 2JDIA 3LA6A 1Z5ZA 3RWOA 3SHWA 2HT1A 5DHFA 1KHTA 2GF0A 1KO5A 2QBYB 4OL0A 3SS8A 4B2IA 2Z6VA 4CRWB 3GJ8A 3ZZ0A 1AN0A 1FL9A 4OHVA 5J40A 5HCNA 1GP2A 2UVQA 2GDJA 5DGXA 3I62A 2F1HA 2R6DA 1SULA 4Q1DA 1W4CA 2X2FA 1T3LA 4PSVA 5TB5A 4JYBA 1DEKA 2CBZA 1GNPA 1P2TA 1JEEA 2RGDA 1EXMA 3Q5DA 1MV5A 4EPYA 5EE3A 1JR3A 1V43A 3HJNA 3EC1A 2EYQA 1ZD8A 2JIZD 4V0LA 3GLFA 4D26A 4MUAA 1II8A 1NN5A 3BFKA 4IDPA 4PQYA 4US1R 5KHOC 1KY3A 2JASA 4A2WA 3PV0A 3CKLA 4MRNA 1YZUA 1ZCBA 2NOAA 1UFQA 2QG6A 1Q12A 2IA5A 2WPDA 4LZZA 4P0TA 4D4LA 1FAQA 1KY2A 2Q9BA 3DHWC 1GWNA 1MABA 2OCAA 2F7SA 4L9SA 3TKLA 2XTMA 3MWJA 4WZ6A 4JIMA 1Z6TA 1KI7A 4Q1AA 1XD9A 1H8HA 4KCGA 2RAPA 3IIJA 4AC9A 5J5CA 1OB2A 1IXSB 4QGGA 4A2QA 1OFUX 4OK5A 3BRWD 4MH0R 2ANCA 3DZ8A 3EW9A 1DOAA 4Q9HA 1DARA 4Q21A 1WXQA 1KYIA 2ZYWX 1S1MA 1ZYUA 3EA0A 1K5DA 3ZH9B 4MKGA 3N2IA 1QHGA 3SJBA 1X1RA 1R0ZA 3SYKA 3P32A 1GM5A 2G83A 2PJZA 1NI3A 3SI7A 4N0DA 2WIAA 3AQ4A 2HV8A 2X1VA 4I4LA 1NY5A 3PG5A 4YLGA 1HQYE 4PO8A 2XNSA 2WM9B 3ICQB 1SXJE 1EFHA 2AXNA 3OFNA 1KNQA 1SHKA 3C16C 4URZR 2QT1A 521PA 3VR5A 1G9XA 1R0XA 1L4UA 4GP7A 1P7CA 4OI1A 3EPLA 4AKGA 3S1AB 2ZITA 1CULC 1EFRA 2WSSD 2GEDA 3DOEA 4F4IA 1U8ZA 3LQRA 5JLJA 1AKEA 4ERNA 5DI9A 2C5LA 1DO2A 3TSZA 2G1KA 2WSMA 2GVZC 5JEDA 1ELOA 3U7HB 4JLBA 1KZ7B 4DDVA 4R2IA 5BXQC 4HZIA 2WWGA 2FGJA 4H1UA 4KHZA 3CO5A 2GXUA 4RD6A 1TF7A 4MYHA 1U9IA 3THOA 4JBWA 3B1WA 3MJHA 3WBJA 1N5KA 1G64A 3BS4A 1RFLA 4TMVA 2P0EA 4DCUA 4EUNA 2NZJA 1Q3TA 4RJLA 3AF4A 2WJHA 1PLKA 2EVWX 2IYXA 1UBFA 2ZAMA 1GAJA 1NBMA 3EPHA 3REGA 1E4VA 1DPFA 2A30A 4QFMA 1AZSC 2GXQA 1V5WA 4W7SA 4ARZB 4MKFA 4U7DA 5AK0A 2J5XA 2IWHA 2ZJYA 1COWA 3GJ3A 1E9RA 4HLUC 5EXPA 3SQWA 4RFVA 1G8FA 2ATXA 2VTKA 1RVDA 2ZRLA 3FGNA 3A8TA 3AP3A 3QKSB 4LRWA 1G19A 1ZM4A 3DZDA 4Q4HB 4WZAE 2FWRA 4DSNA 1WB9A 5H68A 3LVQE 4EFMA 1F2TA 5FTMA 1Z29A 1RJ9B 3LDAA 1E2KA 2HCBA 3EWAA 3L43A 2R6GA 1ZM9A 3JVUA 1N5LA 1DAEA 2HXSA 1XEXB 4EIWA 1J99A 2OHFA 3AGPA 4KXFB 1R10A 1QHYA 2FPKA 4GNKA 3EARA 821PA 1GL6A 3KB2A 4LWZA 4WIAA 1BH2A 3ND9A 2H7VA 4DC9A 2O5VA 4OHWA 2ZI9A 3K0FB 3LLUA 1MOZA 4PPGA 1BMFA 2ZUBA 1NLZA 5JECA 5F9FA 1FNNA 4P4UA 4M0LA 3RS4A 4TQAA 4FN5A 1XDBA 3B6EA 3TK1A 1Z6XA 4NONA 4QKQA 3BB4A 3TUZC 2IT1A 3GCGA 2C8VA 2ZRHA 5EP2A 1R0YA 3VR1A 5DNYB 3B60A 5C4MA 3SQXA 3MWYW 2C9OA 2VL7A 1OF1A 1GKUB 1X8LA 2QUZA 4IKEA 1KMQA 4OI2A 1U90A 1R0WA 3A1TA 4ILEA 2OT3B 3AP2A 4R7ZA 2C04A 4CEIA 5DE3A 4ARZA 2EWWA 1KI6A 1W0JA 4EPRA 1XPRA 1U8AA 3M1IA 4Y0VA 1GKYA 2ODWA 5JRZA 3L2OB 5JWOA 2ANBA 2A5JA 2QPTA 1G5RA 3RSOA 3QKSA 121PA 1YR9A 2BCJQ 2HT6A 3CRMA 2AX4A 4D0LB 4LV8B 3H4MA 3UANA 1XMIA 1M7BA 5DLQC 2DB3A 5LPNA 1RRCA 2UKDA 1RJ9A 4URUR 2OM2A 4GOJA 2HLDD 5JWHA 3SN6A 1JR3E 1TX4B 3H1TA 3X1ZA 4ACAA 1G41A 2A5GA 4GPTA 4Q9LA 3ZGXA 2D62A 1E96A 2O0HA 4YMSA 3AUXA 3GJ4A 4S35A 1XEXA 2W6IA 3NDBB 4Q01A 1AM4D 4C0HA 5LD2C 3HU1A 1E1QD 1Z0KA 4HDOB 1QDEA 1Z6YA 2A5FA 3BFXA 5HPYB 5J4YA 3LFUA 3EXAA 1HV8A 2PLRA 1CS4C 2BJVA 4Q7LA 2ZSAA 3K0FA 5KU1A 1XJCA 2YZ2A 2GF9A 3T34A 4DEXA 4NKRA 1TU3A 1YZKA 1TUEA 2FNAA 3QVUA 3TGPA 2F43A 4FWTA 1NIPA 5EXTA 4PANA 1VYUA 3VR3A 1NY6A 3AVOA 4L9MA 2WZQA 4RVCA 3UXMA 3PJRA 4B76A 4DCTA 1XTKA 5EUQB 1KSJA 1OH6A 3W5JA 4O3MA 1B23P 5G41A 1XMSA 5IT5A 1PJRA 4B34A 2FNFX 4B3BA 2GZDA 2ZM5A 3NG1A 4EJSB 1SKQA 3I32A 3SJAA 4I1VA 3BJIC 1NF3A 2KBEA 4LSGA 5LBIA 3X1XA 1F2UB 4B2PA 1JAIA 1G8GA 4TYWA 4Q1FA 3FDIA 2QP4A 3TSOA 2ZAOA 3PEVA 2R6AA 1IN5A 2BBOA 3KFXA 1EWRA 2ZE6A 4BZPA 5CIQA 5FTNA 2WTUA 1GUAA 1C1YA 2D7CA 3G5UA 4TLEA 4DLUA 1DTSA 2QMUA 4QHYA 3U4QB 3HU3A 2RHMA 1W5SA 1Z07A 2ZEJA 2ZS9A 2FGKA 3DKVA 2JJ1D 2ZR7A 4DWJA 1NMYA 1KI1A 2NO0A 4DUGD 3W6PA 3VNUA 4V0ME 1FPMA 3AKCA 1E98A 5AUPB 1JXOA 1J8YF 3EASA 3TR0A 3THYB 4PTLA 4TYYA 4MRRA 4X8MA 1S96A 2HDNB 1UKYA 3CW2A 5KDOA 1FP6A 2QAGC 3CX6A 2ORWA 2IUSA 2ONKA 4V03A 5AUOB 4BRWA 1XD8A 4Q9JA 3T1OA 3Q8XB 2ZRJA 3LW7A 5D3QA 5E7JA 4XOIA 1XB2A 2ZU6A 1TBNA 3OEHD 2HF8A 4NDZA 3AVPA 1KI4A 1TAGA 2GEVA 1DAMA 2IYZA 6Q21A 2QRZA 4DLWA 2QENA 1GOTA 2EYUA 2ECKA 1KJYA 1L7VC 4Q4AB 2CVFA 2B92A 5AR1A 1HE1C 5B30A 2ELIA 4POAA 2YWGA 3CRQA 3CZQA 1QHXA 3PXGA 1W7AA 2J1LA 3LQQA 4FW9A 1T3SA 1S4QA 4DXAA 5FBQB 1E2HA 2OCYC 3X2SA 2ZI3A 3BERA 1W0KA 1E2PA 4MYTA 2QE7D 4EJSA 4BFXA 5L8VA 5FUVA 2CHQA 1F2UA 2AR7A 2JJ8A 4M1YA 4M9QA 2RHDA 3NBXX 4C0QC 1FMJA 1Z28A 2DB6A 3RS2A 1G3IA 2OSBA 3FVQA 2WKPA 1G7TA 1GRQA 3BE4A 4M1MA 3ICEA 3RHFA 2V55B 4HEJA 1OV4A 3ADDA 2Q21A 2J46A 2OFWA 1JB1A 3OIUA 4X8HA 2ZSDA 2BCGY 3T15A 1P3JA 2PCJA 4KLNA 3U4QA 1IQPA 3W5IA 1QRAA 4Q1CA 4R98A 1Z83A 1AA9A 2GTPA 2BBSA 4MRVA 4OQXA 2BKUA 4IVRA 1BOFA 1GKIA 4Q00A 3N5CA 4BFSA 2JIZA 1IY0A 3T1TA 1EG7A 1CP2A 1OYWA 3DMNA 1G17A 1KO1A 5KDLA 4ZDJA 5ELXA 1T5LA 4A6PA 1KI8A 3MD0A 1NKTA 2V6IA 4LV6A 1FOEB 1OT3A 1PLLA 2W58A 4GOXA 5C4GB 3V00A 1E2FA 1LY1A 1KI9A 4QNMA 1XA6A 3IEUA 1FARA 3ZS9A 3W8NA 1JQLB 1GFIA 3PFIA 1SHZA 3CPHA 3GJ0A 2KWIA 4CGZA 4ITRC 1T91A 3KDSE 3KL4A 4JKIA 1WBDA 3U44B 1T5IA 5E7MA 2GBLC 3VU9B 4Q18A 3W3ZB 3THWB 2WHXA 3O8DA 2IYQA 4FWIB 4JSTA 3NC0C 1KDPA 1YRAA 2V1XA 3B1YA 3LBHA 4C0AC 1G6OA 3GMTA 1RRPA 1TEVA 4MYCA 2ZRAA 2JATA 4A8JC 1ESMA 4XVUA 3KQLA 1DAIA 4PAOA 2B7BA 3WYGA 1E9FA 3THXB 4TYPA 3NEJA 4EFNA 5JCPA 2W00A 2JLVA 3CZPA 2N42A 3EA5A 3OIYA 3EWSA 5F2EA 2YC2C 1G3QA 1ONBA 2UZIR 5BYKA 2QI9C 2RH5A 4LX0A 2FPMA 3BC1A 2QY9A 5FOWA 1P2UA 5D3MA 5BN3A 1CJMA 2IHYA 1VG0B 2ZI5A 4TQ9A 4ZCLA 2KB0A 4G5QA 4ASUD 3P1JA 2OG2A 4JVSB 4MRSA 4LBWA 4QM7A 3BH0A 5CJPA 3K9NA 3I4LA 3ZVMA 4GFDA 1CJTC 3E70C 1TL7C 4NMMA 4Q66C 2WSSA 4DLYA 1VYTA 1HA3A 721PA 2OLKA 4R2HA 2GJ8A 4TYQA 5GJCA 3B9PA 3AVWA 2F1JA 3IQXA 2PJRA 1GG2A 4JLMA 3WYFA 2W2XA 5FPSA 4CYMA 2NPIA 4DB2A 3LX5A 1EGAA 4TL8A 1CR4A 4AG6A 1IAQA 1QHHB 5CB8A 1GDDA 4X8OA 5DI3A 2PZGA 1VIYA 1Z8FA 2GAOA 1ZIPA 2VP6A 4F92B 1SVLA 5JRJA 3QBTA 1JPNA 2REBA 5SZHB 4JVMA 2XXAB 1TQ6A 2EW1A 5DH9A 1YZGA 2K5UA 4B2LA 3A1WA 3U44A 3MAAC 3T12A 4JLVA 4U00A 1MKYA 1KK3A 4MGYR 3KUDA 1OYYA 1Q1EA 3K0AB 1FP7A 4YMVA 3J81k 1IM2A 1Y63A 2YHSA 4I1OA 2X2EA 4WBSA 2KJQA 3VX4A 3AKYA 2JJ2D 2OXCA 4ZO4A 1MR3F 2GJ9A 3JZMA 1SVMA 5ANRB 2DPXA 1X8JA 2NG1A 1IN4A 3MSXA 3U7EB 3GJ5A 3HPRA 2VP2A 1G3UA 3PITA 2GRJA 3TE6A 5FOSA 4B74A 1XMJA 5FPKA 1Q22A 4BE7B 4CT5A 1DELA 1UBCA 3O8CA 2IYUA 1MO4A 1ZM7A 1ZC4A 2V54A 4TT3D 1T6NA 2ONJA 3CR8A 3NHBA 5M04A 2IS4A 4QBFA 3B9QA 1LW7A 5DHAA 1TUIA 3CRRA 1T4GA 2QQ0A 1WQ1R 4OJKA 1NRJB 2O0KA 2WWWA 2REXB 2F9MA 2XZOA 2WJGA 3U3MA 1E69A 2ZI6A 4Q02A 4AG5A 2GZAA 2GXAA 2F3RA 3FMPB 3HU2A 3NVAA 4IOMA 5FR2A 3NBZC 2G1JA 3A4MA 2VHTA 1UBGA 5FI1B 2YOHA 4QRHA 1WF3A 5HR5A 2B8TA 1CJUC 4B75A 1H65A 3H0KA 4GOKA 4ABYA 1QHHA 2XZLA 5GJBA 2HYDA 1E2JA 2GNOA 2NO7A 1M8PA 1QVAA 2H16A 3E1SA 3RWMB 4AD8A 2L0XA 5AJZA 1FTNA 1ZBDA 3TVDA 4YMWA 2ZUCA 3GPLA 5FPHA 3VKHA 3D3QA 3AV0B 2PEYA 4Q48A 3UFFA 4TWZA 4BFTA 1RC8A 3IIKA 3SFVA 5KNDA 3GLFB 4Z54A 3SJZA 4CDGA 1M74A 4DLTA 3K0AA 3QF7A 4M1SA 2AWOA 1LB1B 1PTRA 1E2GA 1HEIA 3W8RA 3U5ZB 2ZRFA 3I1FA 5KNCA 4RD0A 1OFHA 1P72A 2RMKA 1NVXQ 1N6PA 4KFUA 3HR7A 2GAAA 1CEEA 4LJ5A 3SE0A 3CNOA 5EZ6B 4RD2A 2Z0MA 4LJ4A 1L4YA 3ZYCA 4HATA 2HLDA 3WNCA 4KFSA 2AN9A 4XVRA 2ZE7A 1DAFA 1NL3A 4W5HA 2O0JA 1WRBA 2Q3HA 2VHJA 3SFZA 1H8EA 4KBFA 1NIJA 3QKUA 1IJEA 4KVAA 4A1FA 1TF2A 4HAVA 3O47A 3ONWA 1EX7A 4PQFA 3TH5A 4PC6A 4US0R 2JAQA 1G8HA 1LF5A 1NVVR 1UAAA 3CB4A 4HAZA 4O2LA 1OFIA 4AKEA 4Z51A 1D2NA 5JHHB 2O8FA 5JI2E 2HF9A 1MRNA 3K70C 3AVYA 4LCBA 4B35A 4FKDA 2BEJA 1N0UA 3QI2A 1G8PA 2VF8A 2YYZA 4YDHB 3IPXA 1D5CA 4IRUB 2DWPA 3C14C 4F4CA 2AL7A 3CX8A 4JLOA 3ZIAD 5EP4A 1RE0A 2FFBA 4H1VA 1ZW6A 3CF2A 3NIBA 2VPPA 1B0UA 1R7RA 2OFOA 4PO1A 1RPZA 4IOKA 1MO3A 4PHTA 1W36D 3TR5A 1W5TA 2Z4SA 1VCMA 2QP9X 5UKDA 2GVIA 1TPZA 2E9SA 2ERXA 2QM7A 1KK1A 4KJZA 2J0QA 2IUUA 4HDCA 2ZJBA 4IJMA 4M1OA 1ZINA 1ZU4A 2BIFA 2KE5A 4UNSA 1EFTA 1R4AA 2ODNA 5FOTA 1KKLA 4LHZA 3BORA 3IBYA 1DAGA 3CWQA 1T8UA 1AZTA 2CLDX 3SOPA 2JJ1A 2QP3A 1K8RA 3QPVA 1IY2A 1XEFA 4IXMA 2V4ZA 2PT5A 2QROA 4DUGA 4DRZA 4LHXA 3SZRA 1P5ZB 1XMVA 3BBPA 2ZANA 4LGMA 3CPEA 2ATVA 2IX3A 2ASEA 3QY0A 2DFNA 2DBYA 2VSFA 5L3SB 4YMUA 4NBSA 2TMKA 1FMLA 4JVNA 3KZ1E 4B48A 2BWJA 1E2IA 3F5FA 4PHGA 2QQEA 1Z3IX 2A2ZA 1Q1ZA 2LWIA 2QTVB 5K8TA 1E2LA 4N3NA 5IF9A 2H17A 4DIDA 2JCSA 1F2TB 3LD9A 3OEHA 1HQCA 2H57A 3TW4A 2PX0A 4M22A 3MFYA 3FHTA 2W6JD 4P33A 4XD7D 4P3YA 3IO5A 4A0GA 1P9WA 4HUTA 1CU1A 4O25A 3VX3A 1E9AA 3Q7QA 1HTWA 2DY1A 3Q72A 4PPNA 1S3GA 4B73A 4JLJA 1TADA 4HLDA 2AD1A 4PO9A 2QAJA 3AVUA 1OXSC 4L5BA 3AP1A 3ZS8A 1SVOA 2V8OA 3TIFA 4AKIA 1OXXK 3QBVA 1AQYA 5P21A 2PCLA 4NCKA 3WYAA 4PSKA 3KKMA 2P6RA 2QE7A 3U7GA 2O8CA 3ZD7A 2RGNC 1FFHA 1E2DA 2IBMA 4E03A 4JSYA 2GKSA 3MG9A 4PC7A 5FUWA 2IYTA 3A37A 2IYYA 3CH4B 2E73A 3MMPA 3UPUA 2Q9AA 2ZQ5A 3LNCA 1M34E 4TLDA 1OFTA 1S1CA 2R6CA 3ADBA 4CF7A 3I72A 1LS1A 3MCAA 3ND8A 3FMFA 1VIAA 1ZJ6A 1BKDR 2YINC 3KJEA 4RCZA 2Q3MA 3Q5EA 5L3RA 1EK0A 2JLSA 3VMFA 1G7RA 1OIWA 5EQTA 3U6KA 3QIAA 5CK4A 3LVRE 1TBOA 4CEIB 1UJ2A 3CF6R 3QEJA 4H9GA 4DKXA 1ZD1A 1KI6B 1UKZA 4BFWA 2OZEA 2QGZA 3AF3A 4KODA 4LYFA 4DLXA 4BRUA 1NJFA 4DT1A 3T5GA 1XZQA 1ZAKA 4Q9IA 3TMKA 2ENNA 4OYHA 3DVLA 3Q85A 4RZUA 5L3SA 2ZE8A 1WA5A 3PUWA 3W3AA 2AHOA 4HLUA 4N0EA 1W1WA 1N25A 1WMSA 3R20A 5EXSA 4AY2A 1VCIA 4FMDB 5AJYA 2BM1A 1XTJA 2VP0A 2FFHA 3MRSA 4ZDKA 2OILA 2CCKA 1XP8A 5G53C 3H86A 1Q57A 4LY6A 3W90A 4AKHA 3PENA 2CXXA 3NH9A 2IS2A 4F38A 3H2YA 3IUYA 4JYCA 3GJ7A 3FYHA 3R8CA 2H5EA 1BYUA 3IDQA 3X1YA 4QNRA 5KOYA 1UEJA 2GA8A 3PUZA 2GILA 4I1UA 8OHMA 3UG7A 1F5NA 1Z0AA 2PMKA 3L82B 2WKRA 2F3TA 1LNZA 4KI0A 5G3ZA 5LD2B 2QMEA 4EPWA 1KKMA 5CLLA 2J0VA 2NO1A 4DB4A 2CL6X 4EFLA 4HI0E 5B2ZA 4NCHA 1VYVA 1R5BA 2F43B 3HP1A 3W9YA 1NN1A 1FQKA 2KI5A 4ZIRA 3KQNA 5TVKA 3RRMA 1J7KA 4TQUS 4OI4A 5FTJA 5A0FA 4LPSA 1OH8A 1FZQA 4W9MC 2G3YA 1W47A 1Q1QA 1EWQA 3I92A 4RKEA 3L8YA 2W0MA 1G4AE 3LY5A 4ZDIA 1FX0B 1W4RA 1JXMA 3RANA 4CW7A 4JLKA 4QC2A 1GL9B 1XWIA 1A5TA 1N3BA 2BMEA 5GVRA 2N1BA 2MSEB 1OLOA 2A5DA 3PEUA 4DSTA 4HAXA 2VEDA 3SC3A 3UMRA 2QMOA 4WVFA 3SYLA 4C0LA 2AKAB 5JHGB 2W83A 1IY1A 2XEXA 3I5YA 1KJWA 3FFAA 3V4RA 2GK7A 5DIFA 4UJ5A 1ANKA 3LX8A 3QNUA 2FSIA 2JA1A 2V6JA 3WHLA 3V4FA 3VR6A 3TBKA 4IEEA 3UKDA 1JNYA 3GLFE 4XSGA 2WMOB 4I1SA 3RSLA 3AM1A 4GT1A 2RGCA 2IF0A 1CXZA 4RSGA 3O8RA 4PX9A 3QSYA 2IHBA 3AF1A 3MJRA 3QQ5A 3IKJA 5CM9C 4QXAA 3VFDA 1VHTA 1MRSA 2MMCA 4EPTA 1A4RA 2IEYA 4MDFA 1P9RA 2XITA 4B3GA 4L4UA 2P6UA 2NO9A 3ZQ6A 1P62B 2R8RA 3F0TA 2OBNA 2QAGB 4JBYA 2BVNA 2CHGA 4TSFD 3P26A 1AQUA 1P6XA 1NN3A 2D3WA 2DR3A 4F4JA 2FZ4A 5L3QA 4MGIR 3EIHA 3D8BA 4P4TA 2JLWA 4IDQA 3NC1C 3GFTA 1R79A 2NZ8A 4RZ2A 3OHMA 3K70D 1RKBA 3WMGA 4TT3A 1ZNWA 3LXRA 5SZIA 1WBBA 1OIVA 1YR8A 2WWIA 5E7IA 4QM6A 3ZVRA 2YJTD 5CDFA 5AUQA 1G20E 1FX0A 3SJCA 4G0NA 4NCJA 4NL4H 2HJVA 2JDID 5E4FA 2WJIA 2GCNA 5EE5B 4DLVA 4RFSB 4A2PA 3FTQA 3K09C 3NHAA 2VRWB 3L0IB 3REFA 4QJ4A 1XU4A 4ON9A 1KDTA 2LKDA 1LF0A 2ZS8A 1GRRA 2ZVPX 2YC4C 4NYMQ 3RRNA 5JJIA 1UM8A 1OSNA 2ZVQX 3AUYA 3BJIA 5J4KA 3FHOA 3BB3A 4M9SA 4KITB 5IK2D 2NPFA 2C98A 2N46A 1LTQA 2QEQA 1ZNYA 1WE2A 4NZYA 1JJ7A 3GLHB 5KPJA 1G3RA 3H84A 1CJKC 1DBSA 3GLIA 1OB5A 3BGWA 1I4LD 1LS6A 1JR3D 4IDNA 4BASA 3A36A 5C2JB 4DCNA 3BH7A 5CIWA 2XNDD 1DG3A 1KGDA 5HKKA 2PL3A 4A0FA 3EC2A 5JS7A 5TMPA 2Y8EA 3L0PA 4F7WA 3EZ2A 1KOFA 2QAGA 1NBME 1EESA 4CEHA 3BIFA 5KSYA 2ZRGA 3AKEA 1E0KA 2BBWA 3QXXA 4HB2A 4KYUA 2J7PD 4PXAA 4XIGS 5JFGA 1G6HA 3OEED 5L3VA 2EFDB 5B58C 1G291 5CITA 4CIDA 2I4IA 3PUYA 2FFQA 3TQCA 1E9CA 2WWYA 2Z5FA 4CEJB 4YMTA 5DYGA 2NTYC 5AJXA 3X1WA 1CLUA 3CNLA 4XTRA 1BYIA 1SKYB 4UKDA 2XTNA 2JLXA 5C18A 2CCGA 2ODEA 1KO7A 3P4XA 4F91B 1W4BA 1KO8A 4M53A 2ZYVX 2XJ4A 3SR0A 4KFTA 1P2VA 5F9HA 2AKYA 5DN6D 3G0HA 4RFSA 1T9HA 5BN4A 2VRWA 2RGBA 2MSDB 2W0SA 1RFHA 2ZU0C 5JCZA 5EXXA 4BGDA 2OESA 2QSZA 1FQJA 4XTCS 3VHLB 2PT7A 2ZSEA 2C9YA 1YVDA 2QTHA 4JLNA 2Z43A 1US8B 3UMSA 2BC9A 3C5CA 4NP6A 4B32A 4B44A 2G77B 4E22A 4JKYA 4A9AA 3AVVA 1M1YE 3BXZA 2PBRA 1MH1A 3GLHA 4M21A 3B2EA 4L9WA 2DFTA 4EQ6B 3GEIA 1BO6A 1S3SA 3EIEA 5D3MB 3U3JA 5JSZB 1LFDB 1W36C 4HB0A 3I73A 2Q9CA 1UKVY 1IJFA 2HEIA 4RCYA 2H92A 4JLDA 3QG5A 3QOFA 1E99A 3BAFA 4OK6A 5AJVB 3OZXA 3LO5A 3CNNA 4ESVA 3C5HA 4LYHA 4MUBA 4NYJQ 4XH9B 4DCVA 4US2R 5EP3A 1CF4A 1AJEA 1Z2CA 3UG6A 1Y3AA 2CL7X 2G9NA 1E4YA 2J3EA 2Q6TA 1E2MA 1R5OA 3B5JA 3CX7A 5DI3B 4RKFA 4TLAA 4PPQA 1DE0A 1U98A 1MO5A 4GZMA 5GADl 3GJ6A 3OAAD 1UKEA 4K8OA 4CEJA 1VPLA 4QL3A 2GHIA 1GRNA 4KLZA 2ZSFA 2QTFA 1Z0IA 2FSFA 3UATA 621PA 3R8FA 4M8NE 3NBFA 4UXJA 1PVOA 1IN6A 3IGFA 3ZVNA 1RIFA 2XB2A 3KKOA 2HUPA 2C9CA 5FUYA 1A2BA 2GBLA 1VG1A 4EPVA 1GIAA 5BN5A 4A0HA 1PTQA 1JI0A 2IW3A 2F55A 3AGQA 2ZR9A 2PZEA 3VR2A 3MGCA 1KSHA 4A8JA 4FMCB 3B1XA 4DHEA 2BMFA 3PEWA 1US8A 2W6JA 2AFIE 4XD7A 3ZZTA 1VCNA 1DADA 3ZLJA 4TL6A 2AFHE 2X8AA 4UJ3A 2D2EA 1P75A 4A4DA 1BIFA 4EQ6A 2DHRA 3UK6A 5JJLA 5JSZA 2BBTA 1YQTA 2BMJA 3ETLA 1W2HA 2G88A 3M0EA 3SDZA 2WJJA 1BMFD 2ZREA 3FWYA 4LYAA 4OQNA 3WNDA 2JLQA 4IDHA 5KYKA 2V7QD 1TQDA 1E3MA 2QM8A 4FXPA 4TLBA 4Z8YA 5FOXA 1ZNZA 5LB2A 2P67A 3CR7A 4Y0AA 2OBMA 2FPLA 4ESHA 2KBFA 2RGXA 3RRZA 2VP4A 3QXHA 4C7OB 4FCTA 2XSZD 2YNMA 1ESNA 1EX6A 5GJWC 5CDFE 3OE7D 1XJ0A 2QORA 2DFLA 1NJGA 3CIOA 4NE2A 1EFUA 2ZJOA 3IIMA 1G18A 4NYIQ 2J87A 5C46F 1KMHA 2DWOA 2ZJ2A 3FKSD 3KTAB 1SVSA 3L8ZA 1XD2B 2BKEA 2WBLC 3GD7A 3NWJA 4KVGA 2O8DB 3LXXA 4W5WA 3BFVA 2ZTSA 2F1RA 3RS0A 3IILA 4DEYA 2NQ2C 5CYPA 3BWDD 2CCJA 4GMXA 2P5TB 4Q1EA 1HYQA 1UPTA 4IHQA 2ZRPA 3PVSA 1XFAA 1L2TA 4UNPA 1QG4A 1P9NA 4G5GA 4Q03A 2BV3A 1TQ4A 1SGWA 4XWAA 2R44A 3NKVA 5KDDA 1E2QA 3OIWA 4DJTA 1G7CA 1S0UA 1FNMA 1GILA 1XZPA 4TL9A 4QHSA 3VKGA 1XCPA 5FBRB 3QKRB 3TNFA 1W46A 3CXLA 1YKSA 1P73A 2JLZA 4BQSA 1Q44A 1DS6A 3N70A 1ZNXA 1PZNA 2D4HA 3DL0A 3KUCA 2C78A 1SXJC 3CONA 3SBEA 4OBEA 3RRYA 1NVWQ 2WJYA 2B21A 3ADCA 5EJEA 1OH5A 4BZQA 1QZXA 2GWHA 4UNQA 1JBKA 5B64A 3HWSA 3WY9A 2GEUA 3KJIA 2G6BA 3WRYC 1D6JA 4A92A 5HE9A 1NKSA 3Q9LA 3C4JA 4XWOA 2CNWD 2AXPA 1DAKA 3LH5A 1HURA 5FL7D 4DSUA 5F3WB 4C7OA 4WXRA 4TYNA 1IOZA 4UNRA 5IHPA 3O8BA 1E79D 3QE0A 4ZKEA 1KAGA 2J7KA 2NMVA 2B6HA 1RYFA 4QGHA 2ZJ5A 3KB1A 4MYUA 4BLRA 1IHUA 1E32A 1YZNA 2YWHA 1R5NA 3EIQA 3KTAA 4D4MA 1XD2A 4FI3C 4AWXA 2O8DA 1VG9B 1NVUQ 4M4SA 4AYWA 1KIMA 1Q0UA 4D0NA 4ZI2A 4IVQA 2ZPTX 2WIBA 4M1WA 1KBFA 1RZ3A 3GLHE 4D6PA 5IRCD 2EFCB 3T5DA 4HUQA 1AS2A 3AKDA 3VHXA 3KY9A 3K0CC 2BM0A 4PAMA 3D6TB 4QGFA 4BFYA 2OAP1 2FOLA 4Q1BA 3RLFA 3TAHA 4BFVA 5FOUA 2ZI7A 3NEYA 5FPYA 4YXWD 1G16A 4A0RA 3RC8A 1HT2E 2IS6A 1R2QA 1XJQA 5BWMA 1XTSA 2CJWA 3DM5A 3QKRA 4FINA 4LBZA 1F3OA 4LPKA 3T61A 4IW3B 2ROWA 1KZGB 1G1MA 5J4HA 1O3YA 1F48A 4IVPA 4AYTA 3PUVA 3QG1A 5DISB 2A5YB 3IBGA 4DCSA 3WRXC 1U2RA 3EZFA 3AEZA 3FOZA 1ZM2A 2P6NA 4DBLC 4FCVA 1Z06A 2OE2A 1E2NA 1Z0DA 1E1QA 4URVR
chains in the Genus database with same CATH superfamily
1MTOA 1O96A 1WZIA 3KTDA 3OZIA 1ORDA 3WRXA 3U2QA 3K73O 4JJ8A 4GYWA 4KL8S 5D1HA 4M6WA 4HB4A 4QIHA 4DJEC 3NWPA 1PJ2A 5CCDA 3WIUA 4P4SB 3SLKA 4GOMD 3RADC 2C2GA 4XXHA 3CPJB 3FOEC 3M3PA 4NU8X 3T7DA 3HVJA 4RF3A 4HV4A 4J1TC 4UFPA 3A9UA 3QE3A 2A0XA 2PUFA 1J9EA 1M2VB 1XO1A 2ST1A 3KEMA 3Q7PA 1ZDMA 4F72A 2IS1A 5JZVA 1UQRA 1IWBB 1XZFA 4GS5A 3OESA 2IP2A 1Y8RB 5AOVA 4CI0B 5LSAA 3JSXA 2HUNA 4ZJPA 3S4YA 4PGHA 2Q5EA 4A8TA 4OV6B 3ZDQA 1BKYA 4NG4A 2EQAA 1KEZA 5TPWB 5AUNB 1X1AA 4ZXPA 4U5XA 3I0NA 4KMOA 2FPXA 1N6NA 3EY9A 3HZHA 2XBLA 3LPAA 2PUJA 1V9LA 2MSCB 4NPHA 1U02A 1XLUA 1ZXLA 3WFJA 3ZZ1A 5JCXA 4GP6A 5GP1A 3C3AA 2PKRA 1LEHA 1YL5A 1GGHA 1PFYA 1YS7A 4GQAA 4J29A 4MUHA 3OZRA 1OV6A 4NCNA 4RY2A 2QTZA 4D0RA 4R1NA 5AW7A 2J3DA 4CIVA 3V7YA 1J24A 1CJVC 1DBWA 1RYZA 3IHKA 3WJ2A 2BDTA 5FWAA 4GGPA 2D1SA 4FDLA 2BHRA 3H9GA 1BRMA 4QHTA 1P77A 2V5VA 4WUTA 1ZD5A 3KVYA 1CFZA 3LRTA 5FF9A 1Z63A 4WACA 1WKCA 2SKCA 4V3CA 1U8TA 3AG6A 3V48A 4FGZA 4UARA 2VDWB 4P84A 4TLLB 1NVTA 1K1EA 1JL3A 4IZIA 1NFQA 1PS8A 1A7JA 3DEHA 3DZGA 2I1VB 1CUZA 3FMGA 3G2QA 4HDKA 4IXNA 3B2QA 3H2HA 2JGLA 4GUAA 2OFPA 4UUBA 4AAYA 3X1MA 4D79A 2A78A 2WJZB 2GHRA 3A1UA 1XCMA 4QTYA 2ZJZA 1EUZA 1I8TA 2QN9A 4J0DA 5C7OO 3D5QA 5A9SA 1BCRB 2IYVA 2Y1XA 4LBVA 1EIWA 3W6OA 1HRDA 4TZ6A 5FEUA 4AN4A 1SEVA 3LBNA 3G2PA 4BDTA 5CYOA 2QRVA 5JMPA 1PP4A 1IEVA 4R1TA 3Q98A 4PNPA 3ZE8A 2R4UA 4H7FA 1E2EA 1GQQA 3REQA 2Y6VA 1AUPA 1U6IA 4KQMA 1YDHA 1FNCA 4GLOA 1OGJA 2HBRA 5EEGA 2J7PA 2XMPA 3FTPA 3JY6A 1RJGA 3CM0A 4NU0A 4KAJA 3O93A 2W4MA 2JLUA 4JMLA 3IS3A 3LUKA 3CR3C 1R9GA 4CETA 3LWZA 3KBOA 4HXGA 4RWZA 2I6QA 3QU5A 5F5XA 5TF0A 1DEOA 4X6LA 1A88A 2Y1OA 2R7NA 4DC1A 2JCVA 4OF4A 3ETEA 1N5JA 5A6SA 3WGLA 2DUJA 2VBIA 1PJ4A 2ZWIA 4IX1A 3COWA 1E58A 2CVPA 4QPCA 4S3MA 2PTHA 1BCSB 3UYLA 4WY2A 1ODIA 4FNAA 4GSYA 1IOLA 4UBLA 2Y77A 1PL6A 1O89A 1WP9A 3E2PA 3SIXA 4FIDA 2HIGA 1OA1A 7AT1A 1X9HA 1UL1X 3R5KA 3KR2A 4LDQA 3SPXA 1KNXA 3ABRB 3L77A 3A26A 2F3SA 3L0YA 2C95A 4OHOA 1L8QA 2MDTA 1TD9A 4PQRA 1XRQA 1FS5A 4DDKA 4J3NA 4RPJA 4AG3A 3U4MA 1H9AA 3PXXA 3I83A 2ZJAA 4HS9A 2RHOA 2LEOA 1M6VB 1WB6A 4H6WA 5JD6A 3EEIA 3IMEA 1M0EA 1W44A 1S8FA 2FFRA 4G36A 5ALEA 5HF5A 2V4UA 3QWBA 1XMPA 9WGAA 3OL0A 1DWQA 1XXLA 1R0RI 1THTA 3WLLA 3NLLA 3PPXA 1RHQA 3CVYA 3K9QO 1PYOA 1HK7A 2ZYUX 2GGSA 3LBAA 4PX5A 5FIUA 3TW8B 4Y2SA 4UQLA 5DFAA 2FWPA 2NXCA 2R1ZA 4FYMA 4OQFA 2FSGA 4IDAA 2PQMA 3L6CA 1AV7A 2ZR0A 4MV7A 4WCFB 2PMEA 1GU0A 1Z6AA 3DLTA 1XQ6A 1FW6A 2G8NA 3T06B 1BGWA 3PFKA 5IVKA 5DHRA 1E60A 2P2YA 2YVUA 3GLVA 1CZHA 1Z7EA 3FPFA 1HE3A 3PDUA 4CBVA 3SZ3A 1BWSA 221PA 5GJVC 3DM9B 4ZO7A 3IEVA 1S7GA 4G41A 2CNDA 4KK4A 4IQ0A 4R51A 1T4CA 3RT7A 3U13A 4FONA 1TM7E 4URXR 5AM3A 1VSQA 3CF4G 2Q4OA 3GVXA 3ZDYB 2GPAA 3EXIA 5ICMA 3QKTA 4FB4A 1N1MA 1U31A 4AY3A 1G21E 3OZUA 1X7XB 3ND6A 3EDCA 3IQWA 3LIPA 4LVNA 4NHOA 3C8DA 4PX2A 4WZBB 2OHJA 3AFNA 3BGOS 3D7NA 1HFJA 2OQ2A 4OHMA 1WWKA 1YHNA 1ZC3A 4O5OA 4OX9Y 2A0UA 3F7NA 4E21A 4LC0A 2IZOA 4H4EA 1BHJA 1VG8A 4WVLA 4UUNA 3GRPA 3AF2A 3KALA 1CYEA 2ZRNA 2JLYA 1ZN7A 2A4KA 2ZRIA 2GM9A 3ZWDA 1EVLA 2WYWA 4DLRA 5DBGA 4MSUA 5L6MB 3KQHA 3R9WA 3DFZA 1U0HC 2ZI4A 2I62A 3COYA 4E1BA 2YXLA 5B57C 1EMDA 1LNSA 3WGGA 1ZH2A 3EA4A 4IH4A 2FG5A 4DC0A 4IHKA 6AT1A 3C3EA 1QYXA 2L19A 3QVVA 5HW0A 5JD5A 4ZTUB 3E15A 3WBKA 1OJLA 2FZWA 3A1DA 1A82A 2H65A 4N82A 5A05A 1ZN2A 2B1IA 4DADA 5L3QB 5BMVB 1KSGA 2P6OA 1N6OA 2ZBUA 3QP9A 2D2IA 5B1DA 3ELYA 3K2BA 3L3BA 1H6AA 4ER6A 5I7AA 4J2HA 4EKDA 2YKGA 5T3YA 1PK9A 3PPVA 1VLLA 3X2EA 4DR7B 1O94A 1KETA 1XELA 2Z56A 3QVOA 5CA1A 1N2CA 2QPOA 3M34A 4UTRA 2Z3ZA 1A69A 1XYGA 3A1VA 2QW8A 4K7JA 3TLYA 1XU7A 5F23A 2D2FA 1KBEA 1KJZA 2YY6A 3DE5X 3MJEA 3P4YA 3QJYA 4M0CA 4RIIA 5C5EA 1QTNA 3AY0A 4N1AA 1TW3A 4LZOA 1JFRA 1DAHA 1UBKS 3ETDA 3UA4A 2A1TR 3HADA 3OPYB 4IDFA 1YMVA 1FX1A 1K88A 1K6JA 3VYVA 1WPRA 3OLQA 4ZI5A 3E7WA 2HCJB 1TVEA 3VSDA 5AKKA 1ZI8A 5H9VA 5IKOA 2J45A 2Q3FA 4HYYA 1SQGA 2IOQA 1NUPA 1V37A 2YOFA 2ZQYA 3EEYA 4IILA 2ORVA 1DJPA 1VSTA 2AX3A 3OE7A 3C15C 4EG3A 2VP9A 1DX9A 3WG9A 5BR7A 1LPNA 4TLCA 5EGNA 2CY0A 4IJQA 1UBUS 3SM3A 1PS0A 1YKGA 1RHKA 1LDEA 3GX1A 2JJMA 4UUMA 3RH0A 1ID1A 1RWMA 2Y4NA 3EJ6A 4YP0A 5A3QA 4MVJG 3L7DA 1S9HA 2BP7B 1S9DA 2XMBA 4M99A 4BVHA 4QJ3A 1EK1A 5FFNA 4MIKA 1NBIA 1FXWF 3HB9A 4IWYA 5D84A 4QT4A 3EIWA 1UJ4A 3HP4A 1CY4A 4J4TA 1QFJA 3IC5A 2D54A 2HO4A 4URHA 2A8YA 2FSVC 3KKPA 1CF9A 4Y2VA 3STTA 5C52B 3N3BC 2F48A 5CM8B 3JQ6A 2IC5A 2EJWA 5ALDA 1XMQB 1RXVA 5EESA 5BV1A 3JQDA 4MUEA 3R5AA 2H8KA 2F1KA 2XOXA 4QVIA 4L4YA 1UXIA 1SU6A 1L7MA 4RSRA 1T9BA 1S3FA 3VPHA 2CK3D 1YQEA 3BF7A 4H3KB 3E7XA 2R2GA 1PHPA 1EU1A 1PS9A 3VV2A 2BRUC 3MWFA 2P5SA 1OGYA 4WPGA 4BEBA 4MINA 2WWVD 3LCCA 1LU9A 4WLEA 5LBTA 2DPLA 3WWYA 1EDZA 3H6KA 3NV9A 3X2FA 1E1NA 2QRMA 2I76A 4IDOA 4UDNA 2NTNA 3DPUA 4W8GA 4KQHA 3RBXA 1IN7A 2NSDA 5JUWA 3EG5A 1M2OB 4ID3A 4Q3EA 1F2VA 4OQEA 3EF3A 1VL1A 4D43A 3CF0A 4Q12A 1I4DD 1U8EA 3LCMA 1HG1A 1DO0A 1IHYA 3K72B 5JZSA 2L69A 5P8WA 1GG9A 3DMTC 4LJ6A 3BB1A 4MEJA 4X60A 3W05A 1T5OA 3ZWOA 2WLTA 1N0VC 3B53X 3DFUA 2Y1GA 1GARA 2IPMA 4PICA 4ZYZA 3F9IA 2QMYA 1I24A 1MB9A 2A59A 2B94A 2PZFA 2YX1A 2A1IA 2JFPA 3DCJA 3LLSA 4I9NA 3RNOA 1GA4A 1ZOIA 1VRVA 3KCQA 3OQMA 3E2IA 2EOAA 2XRMA 3IO3A 1Y8FA 2P3SA 1K27A 5SYAA 3GH1A 1AZLA 3RVBA 2FWAA 3W7AA 4I81A 3ZHSA 1HMYA 3P20A 2CL0X 3OZAA 1ZEMA 1MUUA 3RJ9A 4C7MA 1D2MA 5KU7A 5HZHA 4I8IA 5BW8A 3M1AA 3O21A 4UPEA 3HCCA 1F8GA 3FTFA 3SG0A 1O97C 3TOBA 1E79A 3AR9A 3N8DA 1XHFA 1PT7A 1QVZA 2QLBA 2OEPA 3Q1KA 3I01M 5HTOA 1YVPA 3SQNA 1GLNA 3UMBA 1KY4A 4RK7A 2UVDA 4LI3X 4GVXA 3W2TA 4KUHA 2QU7A 1XWWA 4LJAA 1GL7A 3FB4A 1CSOI 3GLQA 1BQEA 2WDZA 3VDXA 4JVLA 4TPKA 1KP9A 5FYDA 2AN5A 2FFJA 2H11A 4NYIR 2XCOA 5ALGA 5BO5A 4GI5A 1JPUA 5DYIA 3QPAA 4IKOA 4UHJA 2HB6A 4EVRA 1ZOOA 1JG1A 2WPDD 2XQVA 1M5UA 1CIPA 2P7HA 1OI4A 1FYVA 3LBYA 4IIJB 4KNYA 3R9KA 1VJ5A 4DMHA 2O5RA 2VUSA 3OSZA 4P7GA 3SZLA 5BSKA 3I0ZA 2IVFA 2RI6A 3M6AA 1DX4A 2CF5A 4LXUA 1GPLA 4RIGA 3GN2A 3TWOA 1XMOB 2A0FA 1MH9A 1WOYA 4B3DA 1Q21A 1SAYA 1W6UA 3HYTA 4OHZA 1CKEA 3UWKA 4IP0A 3V33A 1FP4A 3LWBA 3LBFA 1F2DA 4N03A 4Q4JA 3OX4A 2YL2A 3BCUA 4XWKA 3OCXA 5KSOA 2Q0XA 4ZPXA 5KAPA 4F56A 1FTWA 1YT5A 1YAJA 4ALNA 4ZI7B 3LV8A 5ALQA 5HE8A 4BMCA 2HRRA 1U5BA 1SELA 1WEKA 2FR0A 2UAGA 3IOMA 4RLFA 5BYJA 3RV3A 1QQ5A 4AURA 1GDHA 1P18A 1PVDA 4TVBA 1FYXA 1HDRA 1FTSA 2FMKA 3AEQA 1ODFA 3EVTA 5FHRA 2P3QA 1R3DA 3N6XA 4FFOA 4LKOA 2GLTA 4DNFA 3ZJVA 2P27A 4QUAA 3T9AA 3ENNA 2IYRA 2VO1A 3DOCA 4OY3A 5ES3A 4OCZA 3VV3A 1HDLA 4CN9A 2G5TA 2WICA 1GYQA 1W9HA 1VFPA 1XTQA 3TVTA 1KYQA 4DCMA 3IQGX 4YAOA 4OHRA 4A8JB 3K8ZA 4JT4A 3KEQA 4ZCMA 1L5SA 3FBTA 3ANSA 3HWX1 4MCHA 1SBNE 4JT2A 4QELA 2VZLA 1OYVA 2AUMA 3EISA 4Q19A 1XTBA 2CXNA 4EJSC 2ZVJA 3GLGA 4LDJA 1XI2A 4WKPA 2OV4A 4EF4A 3IUSA 4JQZA 5FCDA 1TF5A 2WWFA 2NAPA 1YE3A 5FTKA 3IHLA 5THKA 3RVJA 4EAQA 1N92A 4EWLA 1K9VF 1ZRHA 2JFOA 4QUBA 5AQ1A 3H99A 1Z4PX 3DZCA 4G1CA 1SY7A 4LJ8A 4MS3A 2DT8A 2HF7A 1EUCA 3RUAA 2FVYA 4WXPA 2VH5R 4XJXA 5AJTA 1Z36A 2C03A 3BRCA 3GLTA 4WKGA 5CJ2A 5KYUA 1NQTA 3L01A 3HKEA 1FBNA 1UK8A 3P97A 3JAKB 4QXMA 3ETGA 2FPUA 5I4KA 4UBIA 3ICVA 4D81A 2DQ4A 3UMJA 5D3KA 4LJ7A 5IJ0A 1DZIA 2CWFA 4C29A 3BXEA 1QE5A 4BUJA 4HBGA 4B3XA 2ODBA 5EZYB 3RF6A 1X3SA 3CNBA 1C9NA 1NBMD 3VNSA 4WJLA 1R6VA 3FZNA 4R16A 4YO8A 4ZTBA 3TKAA 1A8SA 2YS7A 3FPKA 3BH6A 5IUKC 3MJDA 1DIHA 3AJDA 2PLAA 4G5XA 4D1YA 3SM9A 1HXHA 3K9GA 3CKYA 3V4PB 1U3CA 2ISSD 5KNDH 4RDIA 4P31A 4EHHA 2X6QA 4E4YA 2FWIA 1CZRA 1SCIA 3PYXA 3TNYA 2OUIA 5BYBA 1RZRA 4YAFA 5B6JA 4Q15A 1BE0A 3LC0A 3H5OA 5F73A 1L3IA 2IUTA 1SB9A 3PXCX 4ZVVA 3VDNB 1IDN1 1VKNA 2IXGA 1MT3A 3P9IA 4YAJA 5A7FA 2JAHA 5BNTA 2HV9A 2H85A 3UJ8A 4RJIA 1EE9A 1ND6A 1LVGA 3DNMA 4RHCA 2VP3A 4EI8A 1NRIA 4KR3A 4EA8A 5AVOA 3AHFA 4J16C 5KIAA 3MJSA 1F1BA 1KVUA 1RRMA 1YR6A 3HEAA 3UWDA 1PZEA 2QA5A 2WPNA 4HNAB 4NFLA 3ZG6A 5JWRA 5EWMA 1KEKA 4YDSA 4ZMBA 3O8QB 1XCLA 1BRTA 1VLJA 2QUJA 3ENVA 2CNLA 2RGAA 3KXIA 4NE9A 3AWIA 4AS3A 4L15A 4QBGB 1C3JA 2YN0A 4LQ4A 2FPPB 2XMRA 5CCMA 1XMXA 3NONA 4RFLA 5AXDA 1KEEB 2PGXA 4QOSA 3RYIA 1Z18A 4DMLA 2VHCA 4LSMA 1V96A 2P8SA 2J0SA 4L27A 4O2AB 5E1MA 3MUEA 4MDEA 3KXDA 3G2IA 3AJ9A 2QJWA 2C96A 2XOKA 4QBHA 1KPGA 4G0MA 4M7WA 1MN6A 3IX7A 1SXJB 2VVTA 2VYNA 4WK6A 1ULTA 4KXXA 4BLPA 1OE0A 1U0NA 1KGSA 1GGKA 1WHTA 1ZVQA 4QXPA 1YS6A 4H15A 4Y1GA 3IVGA 4BPBA 1NT2A 1WB4A 1NVKA 3PEYA 3DONA 1KAOA 5IM4F 3K6SA 2VNSA 4EHKA 1C7JA 2FCAA 4DLSA 1UADA 2GESA 4JBXA 3JATA 1ABBA 3BJZA 1RKVA 1JDJA 1HNNA 1Y5LA 3ZTTA 1T1RA 2IEAA 1K89A 4L3OA 4HDQB 3SQMA 3EAFA 1W6RA 3OLVA 1EVQA 1UPUA 1P8JA 1KI2A 1RRFA 1TU0A 3PTAA 2NU3I 1UK9A 2Q4EA 2PR2A 3PU6A 4UZFA 3O1IC 1Q0PA 4RULA 3HPQA 1B00A 4MITA 5T67A 2JIBA 5KO2A 3DF9A 4RZ3A 3BF8A 4Q3KA 4V0NA 4K9RA 3JWGA 3BMNA 3G0GA 4GC9A 1JU9A 1MX3A 1T0IA 4UREA 1CLEA 4IMPA 4WW0A 1F20A 1Q1BA 1UMDB 5I7HA 4L78A 3SLGA 3QLUA 3RYTC 4GG1A 2DCMA 2PIDA 2Q5FA 2A9KA 4INPA 5TE9A 3IIIA 3V80A 1PNQA 1PU2A 3VVBA 2C1ZA 1RXCA 3W79A 4B71A 2WJWA 4HUQB 4CKBB 1PGJA 5JXJA 2F90A 4HN2A 4UQOA 3KUXA 2N71A 1YR7A 4B6OA 5JRDS 4YJDA 4C07A 2QVGA 4KKVA 5CCEA 2V4MA 4GLLA 1J90A 5KQLA 2PUEA 4HDMA 4U2CA 1GPKA 5E4YA 3VUEA 4K26A 4FJ0A 2I2AA 5TR9A 1X8KA 4PLFA 5E2IA 3QENA 2W6ID 2W48A 1QMGA 1T6ZA 3VU9A 3B2NA 4ZK6A 1QPGA 1S7CA 3PZBA 2QX8A 1QUFA 2VPIA 3FHCB 3WB0A 4YLYA 1MC8A 2P2LA 2JI4A 2Q99A 4IJWA 4QSHA 9LDBA 1T0JB 5JMTA 5KNBA 1XL1A 1KTVA 4QDOA 1KOLA 2VYCA 3H65A 3QXSA 5CVJA 1XR3A 5LZ7A 4M8LA 4ZOAA 5FOVA 2H3HA 2B0JA 1KPIA 1BE6A 4WEOA 4AO8A 1N77A 3LDHA 1HPTA 3HJRA 3OLWA 3TLXA 3V1LA 4NJMB 1Z08A 3CRZA 5DHQA 3KZXA 3OJCA 1MT0A 1QYDA 2NQTA 2KMOA 2R751 3AXSA 1RW4A 1A95A 2Q62A 1TECE 3OLXA 4UHCA 1FFWA 4DDWA 4RA6B 4R6XA 4HGUA 1Z35A 4H3SA 2XODA 1B3RA 3HDTA 3UPTA 2VJNA 3TW6A 3ZHQA 1MAHA 1VECA 4HZUA 1Y8QA 1M33A 4X6YA 5IKMA 1E3EA 1E94E 1WMFA 3WWPA 3EB9A 1OKKA 5KTNA 2Q07A 5JAMA 5J4LA 2X22A 4RESA 1JALA 4DBVO 4L5JA 4D7AA 4B6DA 1F8UA 1NI4A 4HGNA 4LX8A 1FDWA 2WMNB 3MF4A 3TEFA 1O97D 2J0UA 4UM5A 4B3FX 4WGGA 4HB3A 1W4AA 3UUGA 2XDWA 4B43A 3WS7A 4JJ7A 4ZOBA 1OFGA 2X2OA 3MOGA 4QTUB 1IZZA 4YP7A 3C6QA 2XT9A 3T7KA 2REOA 2PS9A 1ATIA 1C3OB 1I4TD 1JSLA 3INNA 4HGZA 4D97A 3WKCA 4GI7A 3RTDA 1C30B 5ILOA 1Y9EA 3N86A 1S2MA 5FH9A 1KDOA 5EIBC 2WMDA 5M3BA 5F98A 1W29A 1TEHA 1UQTA 1T3TA 4L28A 2XQIA 4AY4A 4DV7B 2OD7A 4WZAA 1DSSG 5KTOA 1JX6A 2OM6A 4CF3A 1YGYA 1B16A 2ATCA 3GZNA 4D0GA 4L16A 3K0CA 3R0VA 4KR7A 2I0FA 3RE1A 4FT4A 5ALVA 3EPKA 1RQXA 4G0XA 1JTVA 4E11A 2PUHA 3RFUA 3IJRA 3NHFA 4TMYA 4UAUA 1Z73A 5F12A 4WNAA 2O3SA 3Q3EA 5EKXA 4U7HA 5ES4B 3HMKA 4TTPA 4NU5A 2IV3A 2C2BA 3GEEA 5EIHA 3F7OA 4ZTZB 4O08A 5J5VA 4EUHA 3H2ZA 1DBVO 4J94A 3Q8MA 2UZ4A 1NC3A 5CNKA 3OJOA 1OZFA 1KK2A 2XQGA 4G8CA 1FSZA 2Z4RA 4NY1A 3LTNC 3NDJA 3PI7A 3FR8A 5LXTF 4BN4A 5AHXA 1EINA 1TKAA 1VBFA 3AVQA 2W2KB 2UXCB 1HM5A 1MABB 3K92A 3E5RA 2D74A 4K9DA 1ADJA 4IFBA 1QAQA 4QG3A 5JARA 5LB4A 5JLJA 3CWZA 1J8FA 1JSRA 3NB0A 3UGDA 5KTYA 4Q9AA 2GCOA 4PG6A 3ZEAA 3FY4A 3KZOA 1CHOI 4QICA 1Q0ZA 1OVOA 2BF4A 2FEMA 2J6BA 3VDPA 1E7RA 2C4NA 1VLVA 2EBFX 2R62A 2Y1FA 4MB0A 4TRMA 3BZBA 5DB4A 4BFUA 4EP1A 1GTG1 4ADSG 1ESEA 1GN8A 1U7TA 2YMQA 3GGPA 4ZDWA 2O8BA 4ARUA 4GI1A 3OEYA 3U3OA 4CMEC 1DTEA 1W0KD 3M83A 4GIBA 1SCKA 2JEOA 3UGLA 1VZ3A 2C94A 1KZ4A 2FX3A 3NTQA 4O4JB 4MV9A 5THXA 1GCOA 2W6MA 3P5SA 1XN1A 3UFXB 1PWXA 2UUPA 3DO5A 5CH3A 5FWXA 4RVGA 4OHYA 2JDIA 3LA6A 1B6RA 1NF8A 1Z5ZA 2AF3C 2O1EA 2YZMA 1MCZA 3IODA 3ABSB 3TRHA 1LPPA 4WLVA 1NVAA 4RKRA 4CQLA 4HT3B 1XAIA 2I2BA 2QBYB 2FWNA 5C34B 4B2IA 3LT5A 1G8MA 2CLMB 2CHEA 2Z6VA 3VO8A 1AN0A 4OHVA 2J6HA 2R79A 4P5DA 1IOWA 1GP2A 2P9GA 2GDJA 1MLDA 4JB8A 2F1HA 3UM9A 5BVGA 4BMSA 5LP6A 2UXDB 1SULA 3AC0A 4V39A 2Q50A 2R6HA 3VH3A 2L7XA 1R6XA 4LG1A 5COAA 5TB5A 2Z2JA 3ILYA 4K9QA 1J25A 2RGDA 1DMRA 3DKKA 3Q2OA 5FKJA 2P75A 3SSOA 3V7NA 4EPYA 1XNRB 4P4NA 2P4HX 2FP4B 4L5AA 4NFSA 1JR3A 1V43A 4LTDA 4V0LA 2EYQA 4WASA 3FPHA 4D26A 1JBEA 4MUAA 5FTWA 3BFKA 2QWXA 4ENVA 4KMRA 3P2KA 1KY3A 1HDCA 3K9CA 3C6ZA 4LOHA 4MRNA 5IG2A 2IGBA 3WA7A 3NOQA 1YI0A 1UFQA 2NOAA 1Q12A 4D4LA 4B6QA 4DCGA 3IJEB 4L9AA 1ZSNA 3NNNA 2XPCA 3L6UA 2C54A 4J7AA 4I6GA 5C37A 2OCAA 1RXIA 3IERA 1ZJJA 1KI7A 2E4AA 2PL5A 2F9FA 2HSWA 3ITDA 4LMPA 1QK5A 4N7JA 4R68A 2RAPA 4Y2PA 5CHEA 5A4FS 2QRPA 5JPDA 2HRZA 4QGGA 3I45A 3T4UA 2WQZA 1DJLA 1OFUX 2LW7A 4A2QA 2X9NA 4OK5A 3BRWD 2WUEA 1I7DA 3DZ8A 3QV1A 1DOAA 4REQB 2BE7A 2RD2A 1Y89A 1DARA 4Q21A 2WYOA 1S1MA 4LCEA 5K9ZA 3EA0A 2A1TS 4AMZA 4JU8A 3K5HA 3NWEA 4MKGA 4DYVA 2ID8A 3WYDA 3SJBA 4CWAA 1PGQA 1WY7A 4EMSA 1X1RA 2RHCA 3L02A 1R0ZA 5LYJF 1ZIYA 3SYKA 3P32A 5A0VA 5E4TA 4CCYA 3NP9A 4DQDA 1KMAA 3AERA 4J0IA 1MJGM 1JMYA 4BKPA 2WFMA 3UBTA 2VH2A 3OCVA 4KR0A 4N0DA 1CS0A 1A50B 3EQ9A 2HV8A 2IEBA 2X1VA 1S3IA 3PSHA 2A6PA 4IRXA 3PXDA 1W76A 3PG5A 5ENDA 3L0CA 5HIMA 3LCVB 3DAFA 5REQA 1RBYA 3SSMA 4E2XA 2I87A 2WM9B 2AXNA 3RAGA 4URZR 1E5LA 3VR5A 3VTAA 2OP0A 1MENA 1G9XA 5CNIA 4ER5A 3BILA 1P7CA 4OI1A 1E3IA 3S1AB 3UHJA 1L8LA 2BFEB 1GGFA 1F6WA 3DMFA 2GEDA 2LIVA 3DOEA 1Z4QA 3RK4A 4ARIA 4F04A 1FK8A 2Q7OE 2C5LA 4ERNA 3LOPA 2AF4C 4A0SA 2G1KA 4EYGA 2GVZC 3LUPA 3ICPA 1A9OA 3PYLA 5CTAA 4JLBA 3VAYA 4EDFA 3ZCRA 5IDWA 3STHA 3TPFA 2GKGA 2A9JA 3L6RA 4R2IA 1YQDA 3NAZA 4HZIA 4DDVA 3BSSA 5BXQC 2FGJA 2GD0A 4JQCA 3WYCA 4QGBA 3AF6A 1U9IA 1VHJA 3GVPA 5FUBA 2ZVDA 3KV3O 3M5PA 4EMBA 4JBWA 3B1WA 2HBYA 5HZMA 5INTA 1N5KA 3NM5A 5T57A 4DCUA 4J2TA 1DWOA 4X92A 1IVSA 1VJ0A 4RJLA 2JCYA 1KAHA 1NDHA 3R3YA 3RVDA 2V0GA 1T2CA 4MGEA 2EVWX 2IYXA 2P8JA 1ZRMA 1KOJA 1Z4JA 2QGFA 3I42A 4N0PA 1C7QA 1G0NA 4JHXA 2OPHA 1E4VA 3EPHA 1ODLA 1X0XA 3B36A 3BTSA 1WS6A 3E3NA 1JNXX 1V5WA 5CUQA 1YIAA 4W7SA 4XQCA 4S1PA 3GLSA 5ENZA 4NESA 2WTMA 4K40A 3VGJA 1COWA 1E9RA 1SCBA 1M1NA 1HDZA 4FKMA 3L7JA 3SQWA 2ATXA 4MMYB 2Q0QA 4HP8A 2ZRLA 4OEHA 1EVZA 3DFMA 3FGNA 3PF8A 1PNTA 4Y67A 4EVQA 5C3UA 4PSDA 3EBLA 4DCPA 4KGXA 4D92A 4CLOA 4WEQA 6ABPA 1WB9A 1WXGA 3A4IA 3D4PA 3QSGA 2CFRA 2P2ZA 3JYPA 2AGVA 4R05A 1DINA 1CUSA 1F2TA 5FTMA 4W9NA 4TV9B 1RJ9B 3LDAA 3SHVA 2XQJA 3L43A 1G9SA 3CT6A 4ZC8A 1N5LA 4E46A 1LRLA 4HNHA 4ZOLB 1J99A 1WF6A 3OQHA 1NOIA 4HGRA 4KXMA 4MI6A 4H77A 1JIVA 1QHYA 2FPKA 4QT0A 5TQVA 1UDBA 1EH5A 1MB2A 2J6IA 3FIJA 3OT1B 821PA 5I7EA 1QVVA 2NUAB 5HQTA 1FXSA 1YZFA 2D5CA 1OR8A 2Z6AA 4DBLE 5CG1A 1DXHA 3O1HB 3ZBTA 1BH2A 3EXG2 4ERXA 3PGVA 2HHLA 2VJAA 2X3UA 3B3GA 4C1BA 2CVZA 1NQAO 4LF6B 2AZXA 5HJ5A 5CDUA 3C1TA 2XMCA 1M83A 1CVRA 4EQZA 4OXIA 4K0KB 3RS4A 3O5AA 4FN5A 4TQAA 4MQ4A 1I33A 4F4HA 5TS2A 4QZVA 4KEAA 4HFNA 5LZ9A 3JQAD 5GY7A 5CT5A 4GBED 4EG8A 3CUVA 3TUZC 1KYXA 2C8VA 2PX4A 3B9RA 1O8BA 4LDPA 5T5QA 3B60A 3FZYA 5DNYB 4G0PA 4O8ZA 1BXZA 1Q6YA 2QDXA 1C14A 2N0SA 3RHTA 3FD8A 2A7XA 2YHUA 4LY0A 4ZARA 2C9OA 2I1WA 4KNVA 4AJPA 3SF0A 3JQ7A 4FEEA 4YRDA 2P2GA 3TL2A 5EIBD 4DNOA 5CFMA 2EERA 4OI2A 2JVKA 4W6ZA 5KYYA 3ZV3A 3AP2A 2C04A 4HHEA 16PKA 1D4OA 5E3IA 4ARZA 1UOOA 2Q27A 3KYCA 3LQ1A 4LRQA 3W77A 3EH2A 4F9TA 3VO9A 1XPRA 3KQOA 4NWIA 3FN4A 1MP0A 3DO8A 5LJIA 1JH8A 1GKYA 2YASA 1XC7A 3OZEA 4JK3A 2VTBA 3L2OB 2WWRA 3NTRA 5JWOA 2TMGA 3TLZA 3VRHA 1G5RA 3BZWA 4HWGA 1PR2A 3VBCA 3QKSA 4UW9A 2OMEA 121PA 1YR9A 5ITVA 5EMLA 3KLBA 3HN2A 2HHHB 3HI4A 4P2BA 3H4MA 1XMIA 1EFPA 3H3FA 4IXDA 2GFIA 3IAFA 1RRCA 3F97A 4YACA 2WMYA 2JAOA 4W1SA 5JWHA 1BGVA 1ADGA 3AXTA 1TX4B 2OPBA 3B5IA 2RGUA 1G41A 3KSMA 4C6RA 4YT5A 3KTFA 2O0HA 4Q6BA 1TVMA 3GJ4A 3TZBA 2JI7A 1XEXA 1SC6A 4OFXA 5FA8A 1ESDA 4IIEA 3ZU2A 1HE4A 2R7LA 2YWXA 2DULA 4HDOB 5BV7A 4DRXA 3HVKA 1RYMA 1GV0A 1YDGA 1NXWA 3PPYA 4ZCSA 2V97A 2AFVA 2AUTA 1QGAA 1AK9A 1P5RA 2PLRA 3QX8A 1ISFA 4RV9A 4FS3A 3ZHBA 1PFVA 1SUAA 1V1MB 3MXTA 2PH5A 4NKRA 3WK4A 1YZKA 2FNAA 3TGPA 3G89A 1J0CA 4JC5A 4MGHA 2F43A 2JHFA 2CB0A 5BSGA 4G1FA 3JWHA 4I8XA 5DW0A 5EXTA 4H59A 1VYUA 2P9EA 2YZNA 3CGWA 3VR3A 1SD5A 2H2AA 1Y7PA 3AVOA 1ZI6A 1PJ8A 2D0DA 2FR8C 2MYNA 3KK0A 5CP8A 2PUGA 3DEYX 1QBGA 3UXMA 2I3ZA 3LECA 4B76A 2BUBA 5AVXA 5EUQB 1KSJA 3W5JA 4LZWA 2FR8A 1FY7A 3IXQA 1KYYA 2FNFX 4S0XA 5K1ZA 4B3BA 1CP3A 1WDLA 1M75A 2H1IA 1YHZA 1SKQA 5KQMA 2V45A 3MRXA 4ZVOA 2ZYRA 1PR1A 4TS1A 4DKJA 2XGSA 4AN1A 1G8GA 4FSHA 5BRAA 5FD8A 3D54D 2QP4A 4AFNA 4V1CA 2HMWA 3S5JA 5JANA 1Q0HA 2H4JA 4WKCA 4YRAA 1HLPA 3UV7A 1IY6A 3MMXA 3H5LA 4IEFB 4L8VA 4YJ3B 1O54A 5I4CA 5CIQA 1X8XA 4E5VA 1B8PA 2R66A 1NYLA 2I54A 2VPZA 3ESBA 1DTSA 4QHYA 2JYYA 2ZS9A 1GPNA 2X5JO 2JJ1D 3P45A 2OXIA 2WHPB 1T2DA 3ZDZB 4CIBA 3QX9A 3VNUA 3W4IA 4M9UA 2UUAB 4ZYXA 3D6VA 3EOBI 1E98A 4MR9A 1JXOA 2FTKE 2VRCD 4M0UA 3VVMA 2MIIA 2XBMA 2R8YA 1LDYA 1S96A 3KWFA 1UKYA 1ZLXA 1KBZA 1FP6A 3QMVA 4PYRA 5ERXA 5G0UA 2XUOA 3N8NA 3U49A 1E3SA 1JMVA 2FQWA 4PNEA 1T9DA 3A4YA 3DXZA 4ENRA 3HJUA 1XD8A 3HHPA 4PLCA 1I5OA 2ZWOA 2ZRJA 4ZQEA 5LCXA 5DEOA 4KC0A 1KXZA 2ZT6A 5E7JA 4Y9TA 4FFLA 3AVPA 3FDZA 1QIEA 1KI4A 4TXHA 2GEVA 4LYYA 4BCBA 4WN9B 1SD1A 1GJRA 2QRZA 4BUCA 4UAVA 3UHFA 2ECKA 4L5IA 4BB6A 1IWOA 3G8BA 3RK1A 4N18A 1O5OA 2XT6A 1NF2A 3LP8A 3ZGYA 5B30A 5AXBA 2FQYA 2YWGA 2ZJFA 3F78A 2GRUA 2J1LA 3LQQA 1T1EA 4LGVA 1Q9BA 4TGLA 1S4QA 3NORA 3KQWA 4DXAA 1VBMA 2H63A 2OV1A 4KTTE 3VR5H 3EK2A 2ARKA 3C8MA 3TJQA 3R4VA 2DFDA 3UC5A 1E2PA 3NDRA 1FDIA 1ZNQO 2B20A 4YUYA 3ZNOA 3DBHB 3KAQA 1U8XX 2X4DA 4JD5A 1K4MA 1Z7GA 4M1YA 2PWAA 4JR0A 4EELA 2J07A 2OCLA 2RHDA 1LBSA 1LCIA 3GB9A 3HCAA 4KXLA 5KEIA 1LSOA 1XNHA 4M76B 2DB6A 5EJ6A 3BE4A 1HL3A 2XR1A 3UB2A 2BKVA 4LRSB 2XVAA 2Q21A 3D4NA 4QGSA 1B0ZA 3ZWCA 3A6LA 3OIUA 3OQ1A 3Q6IA 1TUBA 1W35A 1HDXA 4TV8A 2YIMA 4D9MA 2EG5A 3T15A 1EVYA 4DQLA 2DVMA 4KE7A 5AVTA 1E3QA 3KJZA 3TLMA 1FJGB 4DXHA 3W5IA 5DBOA 5EA2A 1SGDI 3BL8A 4YJHB 3WVNA 1YDWA 3FWKA 1NE7A 1Z83A 2XIJA 3PQDA 1RWBA 4EEKA 1OTYA 1SUSA 1TUGA 2QYTA 3DVSX 4IVRA 2AJCA 3O8OA 3H5AA 4MRVA 3LZCA 1GKIA 3UT5B 4HYQA 6NULA 2VJMB 5ALLA 2JIZA 3E2MA 3G6KA 1CP2A 3SCZA 4X1YB