1HJAI

Lys 18 variant of turkey ovomucoid inhibitor third domain complexed with alpha-chymotrypsin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTKEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-CHYMOTRYPSIN
publication title Crystal Structure of Lys18 Variant of Turkey Ovomucoid Inhibitor Third Domain Complexed with Alpha-Chymotrypsin at 2.3 A
rcsb
source organism Bos taurus
molecule tags Complex (hydrolase/inhibitor)
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1997-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1hjaI00
2P6AC 2LEOA 2NU4I 1M8BA 2JYYA 1SGQI 1NUBA 1Z7KB 2SGFI 2XRCA 2KMPA 2V53A 1HDLA 1TURA 1R0RI 1TGSI 2F3CI 1IY6A 1OMTA 1LR7A 1HPTA 2BUSA 3SGBI 1SGDI 1YTPA 1BUSA 1PJUA 1SGNI 2KMRA 1N13A 1CT0I 3QTLD 4GI3C 2GKTI 1M8CA 1H0ZA 3HH2C 1SGEI 2N52A 1CHOI 1UUCA 1KMAA 2QQDA 1TBRR 2M5XA 1CE3A 2N17A 1Y1BA 1PCEA 1TUSA 2KMOA 2ERWA 2KCXA 2NU0I 2NU3I 1SGPI 2SGEI 2B0UC 2SGDI 3OVOA 1IY5A 3SEKC 1IW4A 2SGQI 2NU1I 1LR9A 2GKVA 2KMQA 1UVFA 4HGUA 2N71A 1OVOA 1FYBA 1MT1A 1CSOI 1CT2I 2ARPF 3SGQI 2GKRI 1SGYI 1AN1I 1YU6C 1TBQR 4SGBI 4OVOA 1SGRI 1Y1CA 5DAEA 2WCYA 2QQCA 1HJAI 3TJQA 1TIHA 1PPFI 1DS3I 3B4VC 2JXDA 1OYVI 1OMUA 2NU2I 1CGJI 1UVGA 1CGII 5JHWC 1DS2I 1BMOA 2SGPI 1CT4I 2OVOA 2JZMA 1LR8A
chains in the Genus database with same CATH superfamily
2V1CA 2P6AC 3TO7A 3UEJA 2RIJA 3R5DA 2CWHA 2LEOA 2YQPA 1K7TA 2NU4I 1M8BA 2JYYA 2RC4A 4AMLA 2LUYA 3UGDA 1SGQI 1NUBA 1Z7KB 2SGFI 1Y8FA 2XRCA 3E59A 2KMPA 1KBEA 3UFFA 5HQ8A 2V53A 1HDLA 1WGTA 2ELIA 3FSXA 1TURA 2JW6A 1R0RI 1TGSI 4MPIA 2ORWA 3TOBA 3OXFA 1FAQA 2F3CI 1IY6A 3OXGA 1OMTA 1FY7A 1K7UA 3UEYA 2PQ8A 1LR7A 5J8CA 1HPTA 3R5BA 5CCLA 2BUSA 3SGBI 1SGDI 2E73A 3TO6A 1YTPA 1BUSA 1PJUA 1S20A 1XX6A 1SGNI 5E3PA 2KMRA 1N13A 2FNFX 2J87A 1CT0I 3QTLD 4GI3C 1WTJA 2DB6A 2GKTI 2ORVA 1MJBA 1M8CA 1XBTA 5EX0A 3VDUA 1H0ZA 3HH2C 1SGEI 2CJSC 3TO9A 2N52A 2OZUA 1MJAA 3PDNA 1CHOI 1UUCA 1UHAA 3CXLA 1KMAA 4FKDA 2N1AB 7WGAA 2WGCA 2ROWA 1P9GA 2QQDA 1TBRR 2M5XA 3OXLA 5EX3A 1CE3A 3UGLA 1X4SA 3VE5A 2N17A 3FSYA 1X74A 1Y1BA 1PCEA 1TUSA 2E5RA 2YUUA 2KMOA 4DNCA 2GIVA 2DKVA 2ERWA 1TOTA 1V1HA 2KCXA 2NU0I 2NU3I 3RU0A 1SGPI 4E1PA 2SGEI 2DIPA 2L8EA 2B0UC 2SGDI 3OVOA 2X52A 5J8FA 1MJ9A 1W3SA 1IY5A 3SEKC 3KY9A 1IW4A 2V1CC 2JA1A 2SGQI 2NU1I 3E2IA 1LR9A 2K9HA 1RFHA 2GKVA 5FUWA 3BJIA 4A24A 2KMQA 2L7XA 4L9MA 2B8TA 3OL0A 2A20A 1UVFA 4HGUA 2LB7A 3VDPA 2N71A 1NXUA 2UZ3A 3UOEA 1WKXA 1OVOA 2ENZA 2OD1A 5HI7A 1VDDA 4E1RA 1TBOA 1U5KA 1MT1A 4JCVE 1ULMA 3GOXA 1FYBA 1CSOI 1CT2I 2ARPF 3TOAA 3SGQI 5E3QA 3QWPA 1FARA 1R79A 2GKRI 1SGYI 1WGCA 1AN1I 1ULKA 1YU6C 1TBQR 4SGBI 3R5CA 4OVOA 4UXIA 3MEKA 5FUXA 1V1IA 1Y1CA 5DAEA 3D00A 3R5AA 2WCYA 1HEVA 4UXJA 2QQCA 1TBNA 1PTQA 1XA6A 1Z2IA 1HJAI 3TJQA 3FC3A 1TIHA 2QPOA 1PPFI 2ENNA 2OU2A 2X3TA 4WP4A 5FUVA 1DS3I 3B4VC 2JXDA 1OYVI 5CCMA 1Q9BA 1OMUA 2NU2I 1KBFA 4B6DA 1CGJI 1PTRA 2CWFA 1P9ZA 2W0TA 2VRWB 5FUYA 2CWGA 2ODDA 5E3RA 1UVGA 1K7VA 2J9RA 2Y0MA 2WVJA 1ULNA 2OVOA 1CGII 4UXHA 2GVIA 5JHWC 3QAHA 1DS2I 1BMOA 2UVOA 3UGIA 2SGPI 1CT4I 2QQEA 2QQ0A 1W4RA 1SGRI 9WGAA 2JZMA 1LR8A
chains in the Genus database with same CATH topology
2V1CA 2P6AC 3UEJA 2LEOA 2YQPA 2NU4I 1M8BA 2JYYA 2LUYA 3UGDA 1SGQI 1NUBA 1Z7KB 2SGFI 1Y8FA 2XRCA 3E59A 2KMPA 1KBEA 3UFFA 5HQ8A 2V53A 1HDLA 2ELIA 1TURA 2JW6A 1R0RI 1TGSI 2ORWA 3OXFA 1FAQA 2F3CI 1IY6A 3OXGA 1OMTA 3UEYA 1LR7A 1HPTA 5CCLA 2BUSA 3SGBI 1SGDI 2E73A 1YTPA 1BUSA 1PJUA 1XX6A 1SGNI 2KMRA 1N13A 2FNFX 2J87A 1CT0I 3QTLD 4GI3C 2DB6A 2GKTI 2ORVA 1M8CA 1XBTA 5EX0A 3VDUA 1H0ZA 3HH2C 1SGEI 2CJSC 2N52A 3PDNA 1CHOI 1UUCA 3CXLA 1KMAA 4FKDA 2N1AB 2ROWA 2QQDA 3OXLA 1TBRR 2M5XA 5EX3A 1CE3A 3UGLA 1X4SA 3VE5A 2N17A 1X74A 1Y1BA 1PCEA 1TUSA 2E5RA 2YUUA 2KMOA 2ERWA 1TOTA 1V1HA 2KCXA 2NU0I 2NU3I 3RU0A 1SGPI 4E1PA 2SGEI 2DIPA 2L8EA 2B0UC 2SGDI 3OVOA 1W3SA 1IY5A 3SEKC 3KY9A 1IW4A 2V1CC 2JA1A 2SGQI 2NU1I 3E2IA 1LR9A 2K9HA 1RFHA 2GKVA 5FUWA 3BJIA 4A24A 2KMQA 2L7XA 4L9MA 2B8TA 3OL0A 2A20A 1UVFA 4HGUA 3VDPA 2N71A 2UZ3A 2ENZA 1OVOA 2OD1A 5HI7A 4E1RA 1VDDA 1TBOA 1U5KA 1MT1A 4JCVE 3GOXA 1FYBA 1CSOI 1CT2I 2ARPF 3SGQI 3QWPA 1FARA 1R79A 2GKRI 1SGYI 1AN1I 1YU6C 1TBQR 4SGBI 4UXIA 4OVOA 3MEKA 5FUXA 1V1IA 1Y1CA 5DAEA 3D00A 2WCYA 4UXJA 2QQCA 1TBNA 1PTQA 1XA6A 1HJAI 3TJQA 3FC3A 1TIHA 2QPOA 1PPFI 2ENNA 5FUVA 1DS3I 3B4VC 2JXDA 1OYVI 5CCMA 1OMUA 2NU2I 1KBFA 4B6DA 1CGJI 1PTRA 2W0TA 5FUYA 2VRWB 2ODDA 1UVGA 2J9RA 2WVJA 2OVOA 1CGII 4UXHA 2GVIA 5JHWC 1DS2I 1BMOA 3UGIA 2SGPI 1CT4I 2QQEA 2QQ0A 1W4RA 1SGRI 2JZMA 1LR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6A C;  2LEO A;  2NU4 I;  1M8B A;  2JYY A;  1SGQ I;  1NUB A;  1Z7K B;  2SGF I;  2XRC A;  2KMP A;  2V53 A;  1HDL A;  1TUR A;  1R0R I;  1TGS I;  2F3C I;  1IY6 A;  1OMT A;  1LR7 A;  1HPT A;  2BUS A;  3SGB I;  1SGD I;  1YTP A;  1BUS A;  1PJU A;  1SGN I;  2KMR A;  1N13 A;  1CT0 I;  3QTL D;  4GI3 C;  2GKT I;  1M8C A;  1H0Z A;  3HH2 C;  1SGE I;  2N52 A;  1CHO I;  1UUC A;  1KMA A;  2QQD A;  1TBR R;  2M5X A;  1CE3 A;  2N17 A;  1Y1B A;  1PCE A;  1TUS A;  2KMO A;  2ERW A;  2KCX A;  2NU0 I;  2NU3 I;  1SGP I;  2SGE I;  2B0U C;  2SGD I;  3OVO A;  1IY5 A;  3SEK C;  1IW4 A;  2SGQ I;  2NU1 I;  1LR9 A;  2GKV A;  2KMQ A;  1UVF A;  4HGU A;  2N71 A;  1OVO A;  1FYB A;  1MT1 A;  1CSO I;  1CT2 I;  2ARP F;  3SGQ I;  2GKR I;  1SGY I;  1AN1 I;  1YU6 C;  1TBQ R;  4SGB I;  4OVO A;  1SGR I;  1Y1C A;  5DAE A;  2WCY A;  2QQC A;  1HJA I;  3TJQ A;  1TIH A;  1PPF I;  1DS3 I;  3B4V C;  2JXD A;  1OYV I;  1OMU A;  2NU2 I;  1CGJ I;  1UVG A;  1CGI I;  5JHW C;  1DS2 I;  1BMO A;  2SGP I;  1CT4 I;  2OVO A;  2JZM A;  1LR8 A; 
#chains in the Genus database with same CATH topology
 2V1C A;  2P6A C;  3TO7 A;  3UEJ A;  2RIJ A;  3R5D A;  2CWH A;  2LEO A;  2YQP A;  1K7T A;  2NU4 I;  1M8B A;  2JYY A;  2RC4 A;  4AML A;  2LUY A;  3UGD A;  1SGQ I;  1NUB A;  1Z7K B;  2SGF I;  1Y8F A;  2XRC A;  3E59 A;  2KMP A;  1KBE A;  3UFF A;  5HQ8 A;  2V53 A;  1HDL A;  1WGT A;  2ELI A;  3FSX A;  1TUR A;  2JW6 A;  1R0R I;  1TGS I;  4MPI A;  2ORW A;  3TOB A;  3OXF A;  1FAQ A;  2F3C I;  1IY6 A;  3OXG A;  1OMT A;  1FY7 A;  1K7U A;  3UEY A;  2PQ8 A;  1LR7 A;  5J8C A;  1HPT A;  3R5B A;  5CCL A;  2BUS A;  3SGB I;  1SGD I;  2E73 A;  3TO6 A;  1YTP A;  1BUS A;  1PJU A;  1S20 A;  1XX6 A;  1SGN I;  5E3P A;  2KMR A;  1N13 A;  2FNF X;  2J87 A;  1CT0 I;  3QTL D;  4GI3 C;  1WTJ A;  2DB6 A;  2GKT I;  2ORV A;  1MJB A;  1M8C A;  1XBT A;  5EX0 A;  3VDU A;  1H0Z A;  3HH2 C;  1SGE I;  2CJS C;  3TO9 A;  2N52 A;  2OZU A;  1MJA A;  3PDN A;  1CHO I;  1UUC A;  1UHA A;  3CXL A;  1KMA A;  4FKD A;  2N1A B;  7WGA A;  2WGC A;  2ROW A;  1P9G A;  2QQD A;  1TBR R;  2M5X A;  3OXL A;  5EX3 A;  1CE3 A;  3UGL A;  1X4S A;  3VE5 A;  2N17 A;  3FSY A;  1X74 A;  1Y1B A;  1PCE A;  1TUS A;  2E5R A;  2YUU A;  2KMO A;  4DNC A;  2GIV A;  2DKV A;  2ERW A;  1TOT A;  1V1H A;  2KCX A;  2NU0 I;  2NU3 I;  3RU0 A;  1SGP I;  4E1P A;  2SGE I;  2DIP A;  2L8E A;  2B0U C;  2SGD I;  3OVO A;  2X52 A;  5J8F A;  1MJ9 A;  1W3S A;  1IY5 A;  3SEK C;  3KY9 A;  1IW4 A;  2V1C C;  2JA1 A;  2SGQ I;  2NU1 I;  3E2I A;  1LR9 A;  2K9H A;  1RFH A;  2GKV A;  5FUW A;  3BJI A;  4A24 A;  2KMQ A;  2L7X A;  4L9M A;  2B8T A;  3OL0 A;  2A20 A;  1UVF A;  4HGU A;  2LB7 A;  3VDP A;  2N71 A;  1NXU A;  2UZ3 A;  3UOE A;  1WKX A;  1OVO A;  2ENZ A;  2OD1 A;  5HI7 A;  1VDD A;  4E1R A;  1TBO A;  1U5K A;  1MT1 A;  4JCV E;  1ULM A;  3GOX A;  1FYB A;  1CSO I;  1CT2 I;  2ARP F;  3TOA A;  3SGQ I;  5E3Q A;  3QWP A;  1FAR A;  1R79 A;  2GKR I;  1SGY I;  1WGC A;  1AN1 I;  1ULK A;  1YU6 C;  1TBQ R;  4SGB I;  3R5C A;  4OVO A;  4UXI A;  3MEK A;  5FUX A;  1V1I A;  1Y1C A;  5DAE A;  3D00 A;  3R5A A;  2WCY A;  1HEV A;  4UXJ A;  2QQC A;  1TBN A;  1PTQ A;  1XA6 A;  1Z2I A;  1HJA I;  3TJQ A;  3FC3 A;  1TIH A;  2QPO A;  1PPF I;  2ENN A;  2OU2 A;  2X3T A;  4WP4 A;  5FUV A;  1DS3 I;  3B4V C;  2JXD A;  1OYV I;  5CCM A;  1Q9B A;  1OMU A;  2NU2 I;  1KBF A;  4B6D A;  1CGJ I;  1PTR A;  2CWF A;  1P9Z A;  2W0T A;  2VRW B;  5FUY A;  2CWG A;  2ODD A;  5E3R A;  1UVG A;  1K7V A;  2J9R A;  2Y0M A;  2WVJ A;  1ULN A;  2OVO A;  1CGI I;  4UXH A;  2GVI A;  5JHW C;  3QAH A;  1DS2 I;  1BMO A;  2UVO A;  3UGI A;  2SGP I;  1CT4 I;  2QQE A;  2QQ0 A;  1W4R A;  1SGR I;  9WGA A;  2JZM A;  1LR8 A; 
#chains in the Genus database with same CATH homology
 2V1C A;  2P6A C;  3UEJ A;  2LEO A;  2YQP A;  2NU4 I;  1M8B A;  2JYY A;  2LUY A;  3UGD A;  1SGQ I;  1NUB A;  1Z7K B;  2SGF I;  1Y8F A;  2XRC A;  3E59 A;  2KMP A;  1KBE A;  3UFF A;  5HQ8 A;  2V53 A;  1HDL A;  2ELI A;  1TUR A;  2JW6 A;  1R0R I;  1TGS I;  2ORW A;  3OXF A;  1FAQ A;  2F3C I;  1IY6 A;  3OXG A;  1OMT A;  3UEY A;  1LR7 A;  1HPT A;  5CCL A;  2BUS A;  3SGB I;  1SGD I;  2E73 A;  1YTP A;  1BUS A;  1PJU A;  1XX6 A;  1SGN I;  2KMR A;  1N13 A;  2FNF X;  2J87 A;  1CT0 I;  3QTL D;  4GI3 C;  2DB6 A;  2GKT I;  2ORV A;  1M8C A;  1XBT A;  5EX0 A;  3VDU A;  1H0Z A;  3HH2 C;  1SGE I;  2CJS C;  2N52 A;  3PDN A;  1CHO I;  1UUC A;  3CXL A;  1KMA A;  4FKD A;  2N1A B;  2ROW A;  2QQD A;  3OXL A;  1TBR R;  2M5X A;  5EX3 A;  1CE3 A;  3UGL A;  1X4S A;  3VE5 A;  2N17 A;  1X74 A;  1Y1B A;  1PCE A;  1TUS A;  2E5R A;  2YUU A;  2KMO A;  2ERW A;  1TOT A;  1V1H A;  2KCX A;  2NU0 I;  2NU3 I;  3RU0 A;  1SGP I;  4E1P A;  2SGE I;  2DIP A;  2L8E A;  2B0U C;  2SGD I;  3OVO A;  1W3S A;  1IY5 A;  3SEK C;  3KY9 A;  1IW4 A;  2V1C C;  2JA1 A;  2SGQ I;  2NU1 I;  3E2I A;  1LR9 A;  2K9H A;  1RFH A;  2GKV A;  5FUW A;  3BJI A;  4A24 A;  2KMQ A;  2L7X A;  4L9M A;  2B8T A;  3OL0 A;  2A20 A;  1UVF A;  4HGU A;  3VDP A;  2N71 A;  2UZ3 A;  2ENZ A;  1OVO A;  2OD1 A;  5HI7 A;  4E1R A;  1VDD A;  1TBO A;  1U5K A;  1MT1 A;  4JCV E;  3GOX A;  1FYB A;  1CSO I;  1CT2 I;  2ARP F;  3SGQ I;  3QWP A;  1FAR A;  1R79 A;  2GKR I;  1SGY I;  1AN1 I;  1YU6 C;  1TBQ R;  4SGB I;  4UXI A;  4OVO A;  3MEK A;  5FUX A;  1V1I A;  1Y1C A;  5DAE A;  3D00 A;  2WCY A;  4UXJ A;  2QQC A;  1TBN A;  1PTQ A;  1XA6 A;  1HJA I;  3TJQ A;  3FC3 A;  1TIH A;  2QPO A;  1PPF I;  2ENN A;  5FUV A;  1DS3 I;  3B4V C;  2JXD A;  1OYV I;  5CCM A;  1OMU A;  2NU2 I;  1KBF A;  4B6D A;  1CGJ I;  1PTR A;  2W0T A;  5FUY A;  2VRW B;  2ODD A;  1UVG A;  2J9R A;  2WVJ A;  2OVO A;  1CGI I;  4UXH A;  2GVI A;  5JHW C;  1DS2 I;  1BMO A;  3UGI A;  2SGP I;  1CT4 I;  2QQE A;  2QQ0 A;  1W4R A;  1SGR I;  2JZM A;  1LR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...