1HJAI

Lys 18 variant of turkey ovomucoid inhibitor third domain complexed with alpha-chymotrypsin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTKEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-CHYMOTRYPSIN
publication title Crystal Structure of Lys18 Variant of Turkey Ovomucoid Inhibitor Third Domain Complexed with Alpha-Chymotrypsin at 2.3 A
rcsb
source organism Bos taurus
molecule tags Complex (hydrolase/inhibitor)
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1997-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1hjaI00
1HJAI 1SGEI 4HGUA 1SGQI 2N71A 3SGBI 1PPFI 2F3CI 1R0RI 3SGQI 4SGBI 1Z7KB 2JXDA 1OVOA 1UUCA 2QQDA 1SGNI 3TJQA 1SGYI 1N13A 3OVOA 1HDLA 2NU1I 2P6AC 1CHOI 1TBQR 2LEOA 2V53A 1DS2I 1CE3A 1TBRR 2QQCA 1YTPA 1AN1I 1CSOI 2N52A 2GKTI 1SGRI 4OVOA 2OVOA 1SGPI 2XRCA 2JZMA 1MT1A 1Y1CA 1UVGA 2GKRI 1IW4A 2JYYA 2GKVA 1SGDI 2KMPA 5DAEA 4GI3C 1OYVI 1YU6C 2NU4I 1TIHA 1IY6A 2NU3I 1CT0I 2KMRA 1TGSI 1M8CA 3B4VC 1TUSA 1TURA 3QTLD 1IY5A 1UVFA 1OMTA 2NU0I 2M5XA 1CGJI 2WCYA 1CT2I 1CT4I 2SGQI 2ERWA 5JHWC 2SGPI 1HPTA 2B0UC 2KCXA 1M8BA 2ARPF 2BUSA 1NUBA 2KMQA 2SGEI 2NU2I 1PJUA 1LR8A 1BUSA 1PCEA 1LR9A 2SGFI 3SEKC 2KMOA 1OMUA 2SGDI 1CGII 1DS3I 1FYBA 1KMAA 1Y1BA 2N17A 1BMOA 1H0ZA 3HH2C 1LR7A
chains in the Genus database with same CATH superfamily
5FUXA 4A24A 1WGCA 4E1RA 1Q9BA 1HJAI 1XA6A 3OXLA 2OU2A 1Z2IA 1P9ZA 1SGEI 1V1HA 1XBTA 4HGUA 1FY7A 1SGQI 2J9RA 2A20A 1TBNA 2N71A 3OXGA 3RU0A 3SGBI 2E73A 3MEKA 1PPFI 2K9HA 1XX6A 3UFFA 2F3CI 1R0RI 5HI7A 3SGQI 4SGBI 9WGAA 1S20A 1Z7KB 2JXDA 4UXJA 1VDDA 3VDPA 1PTRA 1Y8FA 1OVOA 1TBOA 1UUCA 5CCMA 2FNFX 3TO7A 2QQDA 2RC4A 1SGNI 3PDNA 3OL0A 1SGYI 3TJQA 2W0TA 1N13A 3OVOA 1X4SA 1HDLA 2X3TA 2NU1I 2P6AC 1RFHA 1CHOI 1TBQR 2WGCA 2LEOA 1TOTA 2V53A 1DS2I 2OD1A 3CXLA 3TOAA 2OZUA 1CE3A 1TBRR 2L8EA 2QQCA 1R79A 1NXUA 1YTPA 2YQPA 1AN1I 3UGDA 1CSOI 2DIPA 2N52A 4E1PA 2GKTI 2CWGA 1SGRI 2JW6A 3BJIA 4JCVE 4OVOA 2OVOA 5EX3A 4DNCA 1HEVA 1SGPI 1V1IA 2ODDA 2V1CA 2QQ0A 3GOXA 1WGTA 2ORVA 2YUUA 2L7XA 2XRCA 4UXIA 2JZMA 2X52A 3UEJA 1MT1A 1Y1CA 2J87A 3UGIA 2CWFA 1FAQA 1UVGA 2GKRI 2ELIA 2ENNA 2Y0MA 5J8CA 1IW4A 3VE5A 2UVOA 2PQ8A 3FSYA 2UZ3A 2JYYA 3R5AA 5FUWA 1W3SA 2GKVA 2LB7A 4MPIA 1SGDI 2GVIA 1K7UA 2N1AB 1MJAA 2KMPA 5DAEA 2RIJA 4GI3C 3UGLA 3HH2C 1OYVI 1YU6C 1WTJA 2NU4I 1TIHA 5J8FA 1IY6A 2NU3I 3QAHA 1CT0I 3R5DA 2KMRA 3FSXA 2QPOA 2VRWB 1TGSI 2WVJA 1FARA 1M8CA 3B4VC 1MJ9A 2JA1A 1TUSA 3UEYA 1TURA 3FC3A 3QTLD 4AMLA 5CCLA 1IY5A 1UVFA 1OMTA 4FKDA 3R5BA 2NU0I 3KY9A 2M5XA 1CGJI 1KBEA 2WCYA 1CT2I 1CT4I 2SGQI 1K7TA 1U5KA 2E5RA 2ERWA 5JHWC 2SGPI 1WKXA 1HPTA 3UOEA 1ULNA 2B0UC 1X74A 2KCXA 3TO6A 2B8TA 1M8BA 3E59A 1W4RA 3QWPA 4B6DA 2ARPF 2BUSA 5EX0A 1NUBA 2CWHA 3TO9A 2ORWA 5FUYA 2KMQA 2QQEA 2SGEI 1ULMA 1PJUA 2NU2I 2CJSC 2ENZA 5E3QA 1LR8A 2DKVA 1BUSA 1PCEA 2DB6A 4WP4A 1LR9A 2V1CC 4L9MA 4UXHA 7WGAA 1KBFA 5HQ8A 1UHAA 2SGFI 1MJBA 5E3PA 3SEKC 2KMOA 2LUYA 1OMUA 2SGDI 1CGII 1DS3I 3TOBA 1FYBA 3D00A 2GIVA 3OXFA 1PTQA 1KMAA 5FUVA 1Y1BA 3E2IA 5E3RA 3VDUA 1P9GA 2N17A 1BMOA 1K7VA 1ULKA 2ROWA 1H0ZA 3R5CA 1LR7A
chains in the Genus database with same CATH topology
5FUXA 4A24A 4E1RA 1HJAI 1XA6A 3OXLA 1SGEI 1V1HA 1XBTA 4HGUA 1SGQI 2J9RA 2A20A 1TBNA 2N71A 3OXGA 3RU0A 3SGBI 2E73A 3MEKA 1PPFI 2K9HA 1XX6A 3UFFA 2F3CI 1R0RI 5HI7A 3SGQI 4SGBI 1Z7KB 2JXDA 4UXJA 1VDDA 3VDPA 1PTRA 1Y8FA 1OVOA 1TBOA 1UUCA 5CCMA 2FNFX 2QQDA 1SGNI 3PDNA 3OL0A 1SGYI 3TJQA 2W0TA 1N13A 3OVOA 1X4SA 1HDLA 2NU1I 2P6AC 1RFHA 1CHOI 1TBQR 2LEOA 1TOTA 2V53A 1DS2I 2OD1A 3CXLA 1CE3A 1TBRR 2L8EA 2QQCA 1R79A 1YTPA 2YQPA 1AN1I 3UGDA 1CSOI 2DIPA 2N52A 4E1PA 2GKTI 2JW6A 1SGRI 4OVOA 3BJIA 4JCVE 5EX3A 2OVOA 1FAQA 1SGPI 1V1IA 2ODDA 2V1CA 2QQ0A 3GOXA 2ORVA 2YUUA 2L7XA 2XRCA 4UXIA 2JZMA 3UGIA 3UEJA 1MT1A 1Y1CA 2J87A 1UVGA 2GKRI 2ELIA 2ENNA 1IW4A 3VE5A 2UZ3A 2JYYA 5FUWA 1W3SA 2GKVA 1SGDI 2GVIA 2N1AB 2KMPA 5DAEA 4GI3C 3UGLA 1OYVI 1YU6C 2NU4I 1TIHA 1IY6A 2NU3I 1CT0I 2KMRA 2QPOA 2VRWB 1TGSI 2WVJA 1FARA 1M8CA 3B4VC 2JA1A 1TUSA 3UEYA 1TURA 3FC3A 3QTLD 5CCLA 1IY5A 1UVFA 1OMTA 4FKDA 2NU0I 3KY9A 2M5XA 1CGJI 1KBEA 2WCYA 1CT2I 1CT4I 2SGQI 2E5RA 1U5KA 2ERWA 5JHWC 2SGPI 1HPTA 2B0UC 1X74A 2KCXA 2B8TA 1M8BA 3E59A 1W4RA 3QWPA 4B6DA 2ARPF 2BUSA 5EX0A 1NUBA 2ORWA 5FUYA 2KMQA 2QQEA 2SGEI 2NU2I 1PJUA 2CJSC 2ENZA 1LR8A 1BUSA 1PCEA 2DB6A 1LR9A 2V1CC 4L9MA 4UXHA 1KBFA 5HQ8A 2SGFI 3SEKC 2KMOA 2LUYA 1OMUA 2SGDI 1CGII 1DS3I 1FYBA 3D00A 3OXFA 1PTQA 1KMAA 5FUVA 1Y1BA 3E2IA 3VDUA 2N17A 1BMOA 2ROWA 1H0ZA 3HH2C 1LR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HJA I;  1SGE I;  4HGU A;  1SGQ I;  2N71 A;  3SGB I;  1PPF I;  2F3C I;  1R0R I;  3SGQ I;  4SGB I;  1Z7K B;  2JXD A;  1OVO A;  1UUC A;  2QQD A;  1SGN I;  3TJQ A;  1SGY I;  1N13 A;  3OVO A;  1HDL A;  2NU1 I;  2P6A C;  1CHO I;  1TBQ R;  2LEO A;  2V53 A;  1DS2 I;  1CE3 A;  1TBR R;  2QQC A;  1YTP A;  1AN1 I;  1CSO I;  2N52 A;  2GKT I;  1SGR I;  4OVO A;  2OVO A;  1SGP I;  2XRC A;  2JZM A;  1MT1 A;  1Y1C A;  1UVG A;  2GKR I;  1IW4 A;  2JYY A;  2GKV A;  1SGD I;  2KMP A;  5DAE A;  4GI3 C;  1OYV I;  1YU6 C;  2NU4 I;  1TIH A;  1IY6 A;  2NU3 I;  1CT0 I;  2KMR A;  1TGS I;  1M8C A;  3B4V C;  1TUS A;  1TUR A;  3QTL D;  1IY5 A;  1UVF A;  1OMT A;  2NU0 I;  2M5X A;  1CGJ I;  2WCY A;  1CT2 I;  1CT4 I;  2SGQ I;  2ERW A;  5JHW C;  2SGP I;  1HPT A;  2B0U C;  2KCX A;  1M8B A;  2ARP F;  2BUS A;  1NUB A;  2KMQ A;  2SGE I;  2NU2 I;  1PJU A;  1LR8 A;  1BUS A;  1PCE A;  1LR9 A;  2SGF I;  3SEK C;  2KMO A;  1OMU A;  2SGD I;  1CGI I;  1DS3 I;  1FYB A;  1KMA A;  1Y1B A;  2N17 A;  1BMO A;  1H0Z A;  3HH2 C;  1LR7 A; 
#chains in the Genus database with same CATH topology
 5FUX A;  4A24 A;  1WGC A;  4E1R A;  1Q9B A;  1HJA I;  1XA6 A;  3OXL A;  2OU2 A;  1Z2I A;  1P9Z A;  1SGE I;  1V1H A;  1XBT A;  4HGU A;  1FY7 A;  1SGQ I;  2J9R A;  2A20 A;  1TBN A;  2N71 A;  3OXG A;  3RU0 A;  3SGB I;  2E73 A;  3MEK A;  1PPF I;  2K9H A;  1XX6 A;  3UFF A;  2F3C I;  1R0R I;  5HI7 A;  3SGQ I;  4SGB I;  9WGA A;  1S20 A;  1Z7K B;  2JXD A;  4UXJ A;  1VDD A;  3VDP A;  1PTR A;  1Y8F A;  1OVO A;  1TBO A;  1UUC A;  5CCM A;  2FNF X;  3TO7 A;  2QQD A;  2RC4 A;  1SGN I;  3PDN A;  3OL0 A;  1SGY I;  3TJQ A;  2W0T A;  1N13 A;  3OVO A;  1X4S A;  1HDL A;  2X3T A;  2NU1 I;  2P6A C;  1RFH A;  1CHO I;  1TBQ R;  2WGC A;  2LEO A;  1TOT A;  2V53 A;  1DS2 I;  2OD1 A;  3CXL A;  3TOA A;  2OZU A;  1CE3 A;  1TBR R;  2L8E A;  2QQC A;  1R79 A;  1NXU A;  1YTP A;  2YQP A;  1AN1 I;  3UGD A;  1CSO I;  2DIP A;  2N52 A;  4E1P A;  2GKT I;  2CWG A;  1SGR I;  2JW6 A;  3BJI A;  4JCV E;  4OVO A;  2OVO A;  5EX3 A;  4DNC A;  1HEV A;  1SGP I;  1V1I A;  2ODD A;  2V1C A;  2QQ0 A;  3GOX A;  1WGT A;  2ORV A;  2YUU A;  2L7X A;  2XRC A;  4UXI A;  2JZM A;  2X52 A;  3UEJ A;  1MT1 A;  1Y1C A;  2J87 A;  3UGI A;  2CWF A;  1FAQ A;  1UVG A;  2GKR I;  2ELI A;  2ENN A;  2Y0M A;  5J8C A;  1IW4 A;  3VE5 A;  2UVO A;  2PQ8 A;  3FSY A;  2UZ3 A;  2JYY A;  3R5A A;  5FUW A;  1W3S A;  2GKV A;  2LB7 A;  4MPI A;  1SGD I;  2GVI A;  1K7U A;  2N1A B;  1MJA A;  2KMP A;  5DAE A;  2RIJ A;  4GI3 C;  3UGL A;  3HH2 C;  1OYV I;  1YU6 C;  1WTJ A;  2NU4 I;  1TIH A;  5J8F A;  1IY6 A;  2NU3 I;  3QAH A;  1CT0 I;  3R5D A;  2KMR A;  3FSX A;  2QPO A;  2VRW B;  1TGS I;  2WVJ A;  1FAR A;  1M8C A;  3B4V C;  1MJ9 A;  2JA1 A;  1TUS A;  3UEY A;  1TUR A;  3FC3 A;  3QTL D;  4AML A;  5CCL A;  1IY5 A;  1UVF A;  1OMT A;  4FKD A;  3R5B A;  2NU0 I;  3KY9 A;  2M5X A;  1CGJ I;  1KBE A;  2WCY A;  1CT2 I;  1CT4 I;  2SGQ I;  1K7T A;  1U5K A;  2E5R A;  2ERW A;  5JHW C;  2SGP I;  1WKX A;  1HPT A;  3UOE A;  1ULN A;  2B0U C;  1X74 A;  2KCX A;  3TO6 A;  2B8T A;  1M8B A;  3E59 A;  1W4R A;  3QWP A;  4B6D A;  2ARP F;  2BUS A;  5EX0 A;  1NUB A;  2CWH A;  3TO9 A;  2ORW A;  5FUY A;  2KMQ A;  2QQE A;  2SGE I;  1ULM A;  1PJU A;  2NU2 I;  2CJS C;  2ENZ A;  5E3Q A;  1LR8 A;  2DKV A;  1BUS A;  1PCE A;  2DB6 A;  4WP4 A;  1LR9 A;  2V1C C;  4L9M A;  4UXH A;  7WGA A;  1KBF A;  5HQ8 A;  1UHA A;  2SGF I;  1MJB A;  5E3P A;  3SEK C;  2KMO A;  2LUY A;  1OMU A;  2SGD I;  1CGI I;  1DS3 I;  3TOB A;  1FYB A;  3D00 A;  2GIV A;  3OXF A;  1PTQ A;  1KMA A;  5FUV A;  1Y1B A;  3E2I A;  5E3R A;  3VDU A;  1P9G A;  2N17 A;  1BMO A;  1K7V A;  1ULK A;  2ROW A;  1H0Z A;  3R5C A;  1LR7 A; 
#chains in the Genus database with same CATH homology
 5FUX A;  4A24 A;  4E1R A;  1HJA I;  1XA6 A;  3OXL A;  1SGE I;  1V1H A;  1XBT A;  4HGU A;  1SGQ I;  2J9R A;  2A20 A;  1TBN A;  2N71 A;  3OXG A;  3RU0 A;  3SGB I;  2E73 A;  3MEK A;  1PPF I;  2K9H A;  1XX6 A;  3UFF A;  2F3C I;  1R0R I;  5HI7 A;  3SGQ I;  4SGB I;  1Z7K B;  2JXD A;  4UXJ A;  1VDD A;  3VDP A;  1PTR A;  1Y8F A;  1OVO A;  1TBO A;  1UUC A;  5CCM A;  2FNF X;  2QQD A;  1SGN I;  3PDN A;  3OL0 A;  1SGY I;  3TJQ A;  2W0T A;  1N13 A;  3OVO A;  1X4S A;  1HDL A;  2NU1 I;  2P6A C;  1RFH A;  1CHO I;  1TBQ R;  2LEO A;  1TOT A;  2V53 A;  1DS2 I;  2OD1 A;  3CXL A;  1CE3 A;  1TBR R;  2L8E A;  2QQC A;  1R79 A;  1YTP A;  2YQP A;  1AN1 I;  3UGD A;  1CSO I;  2DIP A;  2N52 A;  4E1P A;  2GKT I;  2JW6 A;  1SGR I;  4OVO A;  3BJI A;  4JCV E;  5EX3 A;  2OVO A;  1FAQ A;  1SGP I;  1V1I A;  2ODD A;  2V1C A;  2QQ0 A;  3GOX A;  2ORV A;  2YUU A;  2L7X A;  2XRC A;  4UXI A;  2JZM A;  3UGI A;  3UEJ A;  1MT1 A;  1Y1C A;  2J87 A;  1UVG A;  2GKR I;  2ELI A;  2ENN A;  1IW4 A;  3VE5 A;  2UZ3 A;  2JYY A;  5FUW A;  1W3S A;  2GKV A;  1SGD I;  2GVI A;  2N1A B;  2KMP A;  5DAE A;  4GI3 C;  3UGL A;  1OYV I;  1YU6 C;  2NU4 I;  1TIH A;  1IY6 A;  2NU3 I;  1CT0 I;  2KMR A;  2QPO A;  2VRW B;  1TGS I;  2WVJ A;  1FAR A;  1M8C A;  3B4V C;  2JA1 A;  1TUS A;  3UEY A;  1TUR A;  3FC3 A;  3QTL D;  5CCL A;  1IY5 A;  1UVF A;  1OMT A;  4FKD A;  2NU0 I;  3KY9 A;  2M5X A;  1CGJ I;  1KBE A;  2WCY A;  1CT2 I;  1CT4 I;  2SGQ I;  2E5R A;  1U5K A;  2ERW A;  5JHW C;  2SGP I;  1HPT A;  2B0U C;  1X74 A;  2KCX A;  2B8T A;  1M8B A;  3E59 A;  1W4R A;  3QWP A;  4B6D A;  2ARP F;  2BUS A;  5EX0 A;  1NUB A;  2ORW A;  5FUY A;  2KMQ A;  2QQE A;  2SGE I;  2NU2 I;  1PJU A;  2CJS C;  2ENZ A;  1LR8 A;  1BUS A;  1PCE A;  2DB6 A;  1LR9 A;  2V1C C;  4L9M A;  4UXH A;  1KBF A;  5HQ8 A;  2SGF I;  3SEK C;  2KMO A;  2LUY A;  1OMU A;  2SGD I;  1CGI I;  1DS3 I;  1FYB A;  3D00 A;  3OXF A;  1PTQ A;  1KMA A;  5FUV A;  1Y1B A;  3E2I A;  3VDU A;  2N17 A;  1BMO A;  2ROW A;  1H0Z A;  3HH2 C;  1LR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...