1HJAI

Lys 18 variant of turkey ovomucoid inhibitor third domain complexed with alpha-chymotrypsin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTKEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (hydrolase/inhibitor)
molecule keywords ALPHA-CHYMOTRYPSIN
publication title Crystal Structure of Lys18 Variant of Turkey Ovomucoid Inhibitor Third Domain Complexed with Alpha-Chymotrypsin at 2.3 A
rcsb
source organism Bos taurus
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1997-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1hjaI00
5JHWC 1TUSA 2GKVA 1YU6C 1FYBA 1TGSI 1IW4A 1MT1A 1SGRI 5DAEA 2P6AC 1TIHA 3HH2C 2B0UC 1YTPA 2SGPI 3SEKC 1HJAI 1SGPI 1HPTA 4GI3C 1OMTA 3TJQA 2QQDA 2SGDI 2NU4I 2NU0I 2N71A 2ERWA 1PCEA 1BUSA 1AN1I 1CHOI 2NU3I 1CT0I 1SGQI 2KCXA 2BUSA 1LR8A 3QTLD 3B4VC 1PJUA 1LR9A 1PPFI 1TBQR 2SGFI 1SGDI 2GKTI 1N13A 2LEOA 2KMQA 1DS3I 1M8CA 3SGBI 4SGBI 1NUBA 1CGJI 1IY5A 1TBRR 2JYYA 2V53A 2KMOA 2N17A 1CE3A 1OYVI 2KMRA 1OVOA 1Y1BA 1Z7KB 2GKRI 2WCYA 2JZMA 1R0RI 1H0ZA 2NU1I 2KMPA 2QQCA 2JXDA 2OVOA 2F3CI 1SGEI 1M8BA 1KMAA 1HDLA 2ARPF 1CGII 2SGQI 2N52A 1UVFA 3OVOA 1CSOI 2NU2I 1CT2I 4HGUA 1DS2I 1IY6A 2XRCA 1UUCA 1SGNI 2M5XA 1UVGA 1SGYI 1Y1CA 2SGEI 4OVOA 1BMOA 1OMUA 1TURA 3SGQI 1LR7A 1CT4I
chains in the Genus database with same CATH superfamily
3BJIA 5JHWC 1TUSA 2GKVA 1TBNA 2E73A 1YU6C 3R5BA 4FKDA 4B6DA 3D00A 9WGAA 1FYBA 1TGSI 3OL0A 1UHAA 1IW4A 1MT1A 1SGRI 5DAEA 2P6AC 1TIHA 3FSXA 1KBFA 3HH2C 1XA6A 2B0UC 1U5KA 1YTPA 3TO7A 1WTJA 3UEYA 1W3SA 4DNCA 1MJBA 2SGPI 3SEKC 1HJAI 5FUYA 1SGPI 2YQPA 1HPTA 4AMLA 4GI3C 2UVOA 1OMTA 3OXLA 1XX6A 5E3QA 3GOXA 3TJQA 2QQDA 2W0TA 3OXFA 2SGDI 3TO9A 2NU4I 2NU0I 2V1CA 2N71A 5FUWA 1S20A 2ERWA 1ULMA 2DB6A 3VDUA 1PCEA 1BUSA 3QAHA 5HQ8A 2UZ3A 1AN1I 1CHOI 1V1HA 5J8CA 3VDPA 3FC3A 2CWGA 2B8TA 2NU3I 1CT0I 1SGQI 3R5AA 3MEKA 2KCXA 2QQ0A 1Y8FA 5E3RA 2BUSA 1LR8A 1RFHA 3QTLD 3R5CA 3B4VC 2JW6A 1PJUA 1LR9A 1FARA 2QPOA 1MJ9A 2WGCA 1HEVA 1FY7A 1PPFI 2FNFX 1WKXA 2GVIA 4MPIA 1TBQR 4WP4A 2SGFI 5EX3A 3TO6A 2X52A 2ORWA 1PTQA 1SGDI 5FUVA 2GKTI 3UEJA 1N13A 2N1AB 3KY9A 2LEOA 2KMQA 1M8CA 1DS3I 2L7XA 3SGBI 4SGBI 3UGDA 1NUBA 1VDDA 1CGJI 1W4RA 3QWPA 3R5DA 3TOBA 1IY5A 1TBRR 2DIPA 1K7UA 4UXJA 2JYYA 2V53A 2KMOA 2N17A 1MJAA 1CE3A 1OYVI 2KMRA 5EX0A 2LB7A 1OVOA 1Y1BA 1Z7KB 2GKRI 2J9RA 2V1CC 2JZMA 2L8EA 2WCYA 2CWHA 2QQEA 2ELIA 3E2IA 1FAQA 1R0RI 1X4SA 2ODDA 1Q9BA 1Z2IA 1P9ZA 5CCMA 7WGAA 2NU1I 2KMPA 2YUUA 2QQCA 1H0ZA 3PDNA 1PTRA 1TOTA 1WGCA 1X74A 2JXDA 2OVOA 3OXGA 2F3CI 2GIVA 3UOEA 2K9HA 5HI7A 2A20A 2RC4A 2WVJA 1SGEI 1M8BA 4JCVE 4A24A 1ULNA 1KMAA 1HDLA 2ARPF 2OU2A 2ORVA 1NXUA 1ULKA 4UXIA 5E3PA 2J87A 1CGII 1R79A 2Y0MA 2OD1A 1WGTA 2SGQI 2N52A 2RIJA 2CJSC 1UVFA 2ENNA 3OVOA 5FUXA 1TBOA 4E1RA 1CSOI 2E5RA 5J8FA 3UFFA 2LUYA 1KBEA 2OZUA 2VRWB 3VE5A 2NU2I 2DKVA 3E59A 1CT2I 4HGUA 2ROWA 1DS2I 5CCLA 1IY6A 1V1IA 2JA1A 1XBTA 1K7VA 2XRCA 3FSYA 3UGIA 1UUCA 1SGNI 3UGLA 2X3TA 1P9GA 2M5XA 2CWFA 4E1PA 2ENZA 1UVGA 3RU0A 4L9MA 1SGYI 1Y1CA 3TOAA 2SGEI 4OVOA 4UXHA 1BMOA 1OMUA 2PQ8A 3CXLA 1K7TA 1TURA 3SGQI 1LR7A 1CT4I
chains in the Genus database with same CATH topology
3BJIA 5JHWC 1TUSA 2GKVA 1TBNA 2E73A 1YU6C 4B6DA 4FKDA 3D00A 1FYBA 1TGSI 3OL0A 1IW4A 1MT1A 1SGRI 5DAEA 2P6AC 1TIHA 1KBFA 3HH2C 1XA6A 2B0UC 1U5KA 1YTPA 3UEYA 1W3SA 2SGPI 3SEKC 1HJAI 5FUYA 1SGPI 2YQPA 1HPTA 4GI3C 1OMTA 3OXLA 1XX6A 3GOXA 3TJQA 2QQDA 2W0TA 3OXFA 2SGDI 2NU4I 2NU0I 2V1CA 2N71A 5FUWA 2ERWA 2DB6A 3VDUA 1PCEA 1BUSA 5HQ8A 2UZ3A 1AN1I 1CHOI 1V1HA 3VDPA 3FC3A 2B8TA 2NU3I 1CT0I 1SGQI 3MEKA 2KCXA 2QQ0A 1Y8FA 2BUSA 1LR8A 1RFHA 3QTLD 3B4VC 2JW6A 1PJUA 1LR9A 1FARA 2QPOA 1PPFI 2FNFX 2GVIA 1TBQR 2SGFI 5EX3A 2ORWA 1PTQA 1SGDI 5FUVA 2GKTI 3UEJA 1N13A 2N1AB 3KY9A 2LEOA 2KMQA 1DS3I 1M8CA 2L7XA 3SGBI 4SGBI 3UGDA 1NUBA 1VDDA 1CGJI 1W4RA 3QWPA 1IY5A 1TBRR 2DIPA 4UXJA 2JYYA 2V53A 2KMOA 2N17A 1CE3A 1OYVI 2KMRA 5EX0A 1OVOA 1Y1BA 1Z7KB 2GKRI 2J9RA 2V1CC 2JZMA 2L8EA 2WCYA 2QQEA 2ELIA 3E2IA 1FAQA 1R0RI 1X4SA 2ODDA 5CCMA 1H0ZA 2NU1I 2KMPA 2YUUA 2QQCA 3PDNA 1PTRA 1TOTA 2JXDA 1X74A 2OVOA 3OXGA 2F3CI 2K9HA 5HI7A 2A20A 2WVJA 1SGEI 1M8BA 4JCVE 4A24A 1KMAA 1HDLA 2ARPF 2ORVA 4UXIA 2J87A 1CGII 1R79A 2OD1A 2SGQI 2N52A 2CJSC 1UVFA 2ENNA 3OVOA 5FUXA 1TBOA 4E1RA 1CSOI 2E5RA 3UFFA 2LUYA 1KBEA 2VRWB 3VE5A 2NU2I 3E59A 1CT2I 4HGUA 2ROWA 1DS2I 5CCLA 1IY6A 1V1IA 2JA1A 1XBTA 2XRCA 3UGIA 1UUCA 1SGNI 3UGLA 2M5XA 4E1PA 2ENZA 1UVGA 3RU0A 4L9MA 1SGYI 1Y1CA 2SGEI 4OVOA 4UXHA 1BMOA 1OMUA 3CXLA 1TURA 3SGQI 1LR7A 1CT4I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JHW C;  1TUS A;  2GKV A;  1YU6 C;  1FYB A;  1TGS I;  1IW4 A;  1MT1 A;  1SGR I;  5DAE A;  2P6A C;  1TIH A;  3HH2 C;  2B0U C;  1YTP A;  2SGP I;  3SEK C;  1HJA I;  1SGP I;  1HPT A;  4GI3 C;  1OMT A;  3TJQ A;  2QQD A;  2SGD I;  2NU4 I;  2NU0 I;  2N71 A;  2ERW A;  1PCE A;  1BUS A;  1AN1 I;  1CHO I;  2NU3 I;  1CT0 I;  1SGQ I;  2KCX A;  2BUS A;  1LR8 A;  3QTL D;  3B4V C;  1PJU A;  1LR9 A;  1PPF I;  1TBQ R;  2SGF I;  1SGD I;  2GKT I;  1N13 A;  2LEO A;  2KMQ A;  1DS3 I;  1M8C A;  3SGB I;  4SGB I;  1NUB A;  1CGJ I;  1IY5 A;  1TBR R;  2JYY A;  2V53 A;  2KMO A;  2N17 A;  1CE3 A;  1OYV I;  2KMR A;  1OVO A;  1Y1B A;  1Z7K B;  2GKR I;  2WCY A;  2JZM A;  1R0R I;  1H0Z A;  2NU1 I;  2KMP A;  2QQC A;  2JXD A;  2OVO A;  2F3C I;  1SGE I;  1M8B A;  1KMA A;  1HDL A;  2ARP F;  1CGI I;  2SGQ I;  2N52 A;  1UVF A;  3OVO A;  1CSO I;  2NU2 I;  1CT2 I;  4HGU A;  1DS2 I;  1IY6 A;  2XRC A;  1UUC A;  1SGN I;  2M5X A;  1UVG A;  1SGY I;  1Y1C A;  2SGE I;  4OVO A;  1BMO A;  1OMU A;  1TUR A;  3SGQ I;  1LR7 A;  1CT4 I; 
#chains in the Genus database with same CATH topology
 3BJI A;  5JHW C;  1TUS A;  2GKV A;  1TBN A;  2E73 A;  1YU6 C;  3R5B A;  4FKD A;  4B6D A;  3D00 A;  9WGA A;  1FYB A;  1TGS I;  3OL0 A;  1UHA A;  1IW4 A;  1MT1 A;  1SGR I;  5DAE A;  2P6A C;  1TIH A;  3FSX A;  1KBF A;  3HH2 C;  1XA6 A;  2B0U C;  1U5K A;  1YTP A;  3TO7 A;  1WTJ A;  3UEY A;  1W3S A;  4DNC A;  1MJB A;  2SGP I;  3SEK C;  1HJA I;  5FUY A;  1SGP I;  2YQP A;  1HPT A;  4AML A;  4GI3 C;  2UVO A;  1OMT A;  3OXL A;  1XX6 A;  5E3Q A;  3GOX A;  3TJQ A;  2QQD A;  2W0T A;  3OXF A;  2SGD I;  3TO9 A;  2NU4 I;  2NU0 I;  2V1C A;  2N71 A;  5FUW A;  1S20 A;  2ERW A;  1ULM A;  2DB6 A;  3VDU A;  1PCE A;  1BUS A;  3QAH A;  5HQ8 A;  2UZ3 A;  1AN1 I;  1CHO I;  1V1H A;  5J8C A;  3VDP A;  3FC3 A;  2CWG A;  2B8T A;  2NU3 I;  1CT0 I;  1SGQ I;  3R5A A;  3MEK A;  2KCX A;  2QQ0 A;  1Y8F A;  5E3R A;  2BUS A;  1LR8 A;  1RFH A;  3QTL D;  3R5C A;  3B4V C;  2JW6 A;  1PJU A;  1LR9 A;  1FAR A;  2QPO A;  1MJ9 A;  2WGC A;  1HEV A;  1FY7 A;  1PPF I;  2FNF X;  1WKX A;  2GVI A;  4MPI A;  1TBQ R;  4WP4 A;  2SGF I;  5EX3 A;  3TO6 A;  2X52 A;  2ORW A;  1PTQ A;  1SGD I;  5FUV A;  2GKT I;  3UEJ A;  1N13 A;  2N1A B;  3KY9 A;  2LEO A;  2KMQ A;  1M8C A;  1DS3 I;  2L7X A;  3SGB I;  4SGB I;  3UGD A;  1NUB A;  1VDD A;  1CGJ I;  1W4R A;  3QWP A;  3R5D A;  3TOB A;  1IY5 A;  1TBR R;  2DIP A;  1K7U A;  4UXJ A;  2JYY A;  2V53 A;  2KMO A;  2N17 A;  1MJA A;  1CE3 A;  1OYV I;  2KMR A;  5EX0 A;  2LB7 A;  1OVO A;  1Y1B A;  1Z7K B;  2GKR I;  2J9R A;  2V1C C;  2JZM A;  2L8E A;  2WCY A;  2CWH A;  2QQE A;  2ELI A;  3E2I A;  1FAQ A;  1R0R I;  1X4S A;  2ODD A;  1Q9B A;  1Z2I A;  1P9Z A;  5CCM A;  7WGA A;  2NU1 I;  2KMP A;  2YUU A;  2QQC A;  1H0Z A;  3PDN A;  1PTR A;  1TOT A;  1WGC A;  1X74 A;  2JXD A;  2OVO A;  3OXG A;  2F3C I;  2GIV A;  3UOE A;  2K9H A;  5HI7 A;  2A20 A;  2RC4 A;  2WVJ A;  1SGE I;  1M8B A;  4JCV E;  4A24 A;  1ULN A;  1KMA A;  1HDL A;  2ARP F;  2OU2 A;  2ORV A;  1NXU A;  1ULK A;  4UXI A;  5E3P A;  2J87 A;  1CGI I;  1R79 A;  2Y0M A;  2OD1 A;  1WGT A;  2SGQ I;  2N52 A;  2RIJ A;  2CJS C;  1UVF A;  2ENN A;  3OVO A;  5FUX A;  1TBO A;  4E1R A;  1CSO I;  2E5R A;  5J8F A;  3UFF A;  2LUY A;  1KBE A;  2OZU A;  2VRW B;  3VE5 A;  2NU2 I;  2DKV A;  3E59 A;  1CT2 I;  4HGU A;  2ROW A;  1DS2 I;  5CCL A;  1IY6 A;  1V1I A;  2JA1 A;  1XBT A;  1K7V A;  2XRC A;  3FSY A;  3UGI A;  1UUC A;  1SGN I;  3UGL A;  2X3T A;  1P9G A;  2M5X A;  2CWF A;  4E1P A;  2ENZ A;  1UVG A;  3RU0 A;  4L9M A;  1SGY I;  1Y1C A;  3TOA A;  2SGE I;  4OVO A;  4UXH A;  1BMO A;  1OMU A;  2PQ8 A;  3CXL A;  1K7T A;  1TUR A;  3SGQ I;  1LR7 A;  1CT4 I; 
#chains in the Genus database with same CATH homology
 3BJI A;  5JHW C;  1TUS A;  2GKV A;  1TBN A;  2E73 A;  1YU6 C;  4B6D A;  4FKD A;  3D00 A;  1FYB A;  1TGS I;  3OL0 A;  1IW4 A;  1MT1 A;  1SGR I;  5DAE A;  2P6A C;  1TIH A;  1KBF A;  3HH2 C;  1XA6 A;  2B0U C;  1U5K A;  1YTP A;  3UEY A;  1W3S A;  2SGP I;  3SEK C;  1HJA I;  5FUY A;  1SGP I;  2YQP A;  1HPT A;  4GI3 C;  1OMT A;  3OXL A;  1XX6 A;  3GOX A;  3TJQ A;  2QQD A;  2W0T A;  3OXF A;  2SGD I;  2NU4 I;  2NU0 I;  2V1C A;  2N71 A;  5FUW A;  2ERW A;  2DB6 A;  3VDU A;  1PCE A;  1BUS A;  5HQ8 A;  2UZ3 A;  1AN1 I;  1CHO I;  1V1H A;  3VDP A;  3FC3 A;  2B8T A;  2NU3 I;  1CT0 I;  1SGQ I;  3MEK A;  2KCX A;  2QQ0 A;  1Y8F A;  2BUS A;  1LR8 A;  1RFH A;  3QTL D;  3B4V C;  2JW6 A;  1PJU A;  1LR9 A;  1FAR A;  2QPO A;  1PPF I;  2FNF X;  2GVI A;  1TBQ R;  2SGF I;  5EX3 A;  2ORW A;  1PTQ A;  1SGD I;  5FUV A;  2GKT I;  3UEJ A;  1N13 A;  2N1A B;  3KY9 A;  2LEO A;  2KMQ A;  1DS3 I;  1M8C A;  2L7X A;  3SGB I;  4SGB I;  3UGD A;  1NUB A;  1VDD A;  1CGJ I;  1W4R A;  3QWP A;  1IY5 A;  1TBR R;  2DIP A;  4UXJ A;  2JYY A;  2V53 A;  2KMO A;  2N17 A;  1CE3 A;  1OYV I;  2KMR A;  5EX0 A;  1OVO A;  1Y1B A;  1Z7K B;  2GKR I;  2J9R A;  2V1C C;  2JZM A;  2L8E A;  2WCY A;  2QQE A;  2ELI A;  3E2I A;  1FAQ A;  1R0R I;  1X4S A;  2ODD A;  5CCM A;  1H0Z A;  2NU1 I;  2KMP A;  2YUU A;  2QQC A;  3PDN A;  1PTR A;  1TOT A;  2JXD A;  1X74 A;  2OVO A;  3OXG A;  2F3C I;  2K9H A;  5HI7 A;  2A20 A;  2WVJ A;  1SGE I;  1M8B A;  4JCV E;  4A24 A;  1KMA A;  1HDL A;  2ARP F;  2ORV A;  4UXI A;  2J87 A;  1CGI I;  1R79 A;  2OD1 A;  2SGQ I;  2N52 A;  2CJS C;  1UVF A;  2ENN A;  3OVO A;  5FUX A;  1TBO A;  4E1R A;  1CSO I;  2E5R A;  3UFF A;  2LUY A;  1KBE A;  2VRW B;  3VE5 A;  2NU2 I;  3E59 A;  1CT2 I;  4HGU A;  2ROW A;  1DS2 I;  5CCL A;  1IY6 A;  1V1I A;  2JA1 A;  1XBT A;  2XRC A;  3UGI A;  1UUC A;  1SGN I;  3UGL A;  2M5X A;  4E1P A;  2ENZ A;  1UVG A;  3RU0 A;  4L9M A;  1SGY I;  1Y1C A;  2SGE I;  4OVO A;  4UXH A;  1BMO A;  1OMU A;  3CXL A;  1TUR A;  3SGQ I;  1LR7 A;  1CT4 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...