1HJAI

Lys 18 variant of turkey ovomucoid inhibitor third domain complexed with alpha-chymotrypsin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
b'VDCSEYPKPACTKEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-CHYMOTRYPSIN
publication title Crystal Structure of Lys18 Variant of Turkey Ovomucoid Inhibitor Third Domain Complexed with Alpha-Chymotrypsin at 2.3 A
rcsb
source organism Bos taurus
molecule tags Complex (hydrolase/inhibitor)
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1997-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1hjaI00
1CHOI 2ERWA 1UVGA 1PCEA 2B0UC 1Y1BA 1OVOA 1UUCA 1TUSA 2WCYA 2KMQA 3QTLD 1PJUA 2NU3I 1TGSI 1M8CA 2M5XA 2QQCA 1CT4I 2SGFI 1IW4A 2KMPA 1HPTA 1OMTA 2JYYA 1CGII 2OVOA 2GKVA 1TBQR 1TURA 2GKTI 1CT0I 1KMAA 1SGNI 1SGQI 2JZMA 1BUSA 2NU2I 1OYVI 1M8BA 2KMOA 1H0ZA 3TJQA 1CT2I 2NU0I 1NUBA 2KCXA 1DS3I 1PPFI 1N13A 1LR9A 1FYBA 1SGEI 1BMOA 1AN1I 1SGYI 2NU1I 1LR8A 1HJAI 1CE3A 1UVFA 1Z7KB 3SGQI 1CSOI 1MT1A 2SGDI 3SEKC 5JHWC 1TIHA 1CGJI 2ARPF 1YTPA 1SGRI 1DS2I 1HDLA 1SGDI 1IY5A 2QQDA 1R0RI 2P6AC 3HH2C 3B4VC 1YU6C 2GKRI 2BUSA 2SGEI 2V53A 1IY6A 4HGUA 2N17A 2SGPI 2NU4I 2XRCA 5DAEA 1TBRR 4OVOA 4SGBI 2JXDA 2SGQI 1SGPI 3SGBI 1LR7A 4GI3C 2F3CI 2N52A 1OMUA 2LEOA 2N71A 3OVOA 2KMRA 1Y1CA
chains in the Genus database with same CATH superfamily
1CHOI 2ERWA 1UVGA 1FARA 1PCEA 3CXLA 2B0UC 2YUUA 1Y1BA 4E1RA 2ELIA 2OD1A 3UEJA 1OVOA 1Y8FA 1UUCA 1TUSA 2WCYA 5FUWA 2RIJA 4FKDA 2KMQA 3QTLD 1PJUA 1RFHA 1NXUA 1P9ZA 2NU3I 1TGSI 3BJIA 1M8CA 2M5XA 2QQCA 1CT4I 1TBNA 2QQ0A 4L9MA 2SGFI 3KY9A 1Z2IA 1IW4A 2DKVA 2UVOA 2QQEA 2LB7A 2KMPA 1HPTA 4B6DA 2DB6A 1OMTA 1W4RA 3UFFA 2FNFX 1CGII 2GIVA 2GKVA 2JYYA 2CJSC 1TBQR 2OVOA 1TURA 3VDPA 5E3RA 5CCLA 4DNCA 2GKTI 9WGAA 5CCMA 5HQ8A 5EX0A 1P9GA 5FUVA 3E59A 4UXHA 2J87A 1CT0I 2VRWB 2WVJA 1KMAA 1K7VA 4JCVE 5EX3A 4AMLA 1SGNI 5FUYA 1SGQI 1KBFA 3FSXA 2JZMA 1BUSA 1XA6A 2NU2I 3VE5A 1W3SA 1OYVI 4WP4A 2E5RA 1M8BA 2KMOA 3E2IA 4MPIA 1H0ZA 1IY5A 3TJQA 1FY7A 3PDNA 1CT2I 2ODDA 2RC4A 2NU0I 1NUBA 2CWHA 4UXIA 1HEVA 1MJBA 1UHAA 1V1HA 2KCXA 3VDUA 1DS3I 1PPFI 5J8CA 1N13A 3OXFA 1LR9A 1FYBA 2V1CC 2W0TA 1MJ9A 2ROWA 4A24A 1SGEI 1BMOA 2A20A 1AN1I 3R5BA 1SGYI 1WGCA 1WKXA 2NU1I 3TOAA 3UGDA 2B8TA 2LUYA 3OXLA 1R79A 2K9HA 2ORVA 3UOEA 1FAQA 1LR8A 2Y0MA 1HJAI 2PQ8A 3TO9A 1UVFA 1Z7KB 2V1CA 1KBEA 3TOBA 2JA1A 1CE3A 3SGQI 3OL0A 1CSOI 2ENZA 2N1AB 1MT1A 3OXGA 2SGDI 5E3QA 3SEKC 1Q9BA 1TIHA 1CGJI 3UGLA 4E1PA 5JHWC 2ARPF 2DIPA 1YTPA 1SGRI 1DS2I 1HDLA 2E73A 5J8FA 1SGDI 3UEYA 7WGAA 2OZUA 3FC3A 2L7XA 1ULKA 2QQDA 1R0RI 3TO7A 2P6AC 3TO6A 2UZ3A 4UXJA 5HI7A 3HH2C 3B4VC 1S20A 1PTRA 1YU6C 2JW6A 2GKRI 2BUSA 2SGEI 2V53A 3D00A 1XBTA 3MEKA 1IY6A 2J9RA 1WGTA 4HGUA 2GVIA 3FSYA 3R5DA 2N17A 5FUXA 2SGPI 3RU0A 1XX6A 5E3PA 2NU4I 2XRCA 5DAEA 1TBRR 4OVOA 4SGBI 3UGIA 1ULMA 1K7UA 1MJAA 2JXDA 2X3TA 3QAHA 3R5AA 1X4SA 2SGQI 1SGPI 1TBOA 1LR7A 3SGBI 2CWFA 2L8EA 2ENNA 2QPOA 4GI3C 1V1IA 1U5KA 1WTJA 2F3CI 2X52A 1ULNA 1K7TA 3GOXA 2WGCA 1PTQA 3QWPA 2YQPA 2N52A 2OU2A 1OMUA 2LEOA 2CWGA 2N71A 1VDDA 1TOTA 3OVOA 3R5CA 2KMRA 1X74A 2ORWA 1Y1CA
chains in the Genus database with same CATH topology
1CHOI 2ERWA 1UVGA 1FARA 1PCEA 3CXLA 2B0UC 2YUUA 1Y1BA 4E1RA 2ELIA 2OD1A 3UEJA 1OVOA 1Y8FA 1UUCA 1TUSA 2WCYA 5FUWA 4FKDA 2KMQA 3QTLD 1PJUA 1RFHA 2NU3I 1TGSI 3BJIA 1M8CA 2M5XA 2QQCA 1CT4I 1TBNA 2QQ0A 4L9MA 2SGFI 3KY9A 1IW4A 2QQEA 2KMPA 1HPTA 4B6DA 2DB6A 1OMTA 1W4RA 3UFFA 2FNFX 1CGII 2JYYA 2GKVA 2OVOA 2CJSC 1TBQR 1TURA 3VDPA 5CCLA 2GKTI 5CCMA 5HQ8A 5EX0A 5FUVA 3E59A 4UXHA 2J87A 1CT0I 2VRWB 2WVJA 1KMAA 4JCVE 5EX3A 1SGNI 5FUYA 1SGQI 1KBFA 2JZMA 1BUSA 1XA6A 2NU2I 3VE5A 1W3SA 1OYVI 2E5RA 1M8BA 2KMOA 3E2IA 1H0ZA 3TJQA 3PDNA 1CT2I 2ODDA 2NU0I 1NUBA 4UXIA 1V1HA 2KCXA 3VDUA 1DS3I 1PPFI 1N13A 3OXFA 1LR9A 1FYBA 2V1CC 2W0TA 2ROWA 4A24A 1SGEI 1BMOA 2A20A 1AN1I 1SGYI 2NU1I 3UGDA 2B8TA 2LUYA 3OXLA 1R79A 2K9HA 2ORVA 1FAQA 1LR8A 1HJAI 1CE3A 1UVFA 1Z7KB 2V1CA 1KBEA 2JA1A 3SGQI 3OL0A 1CSOI 2ENZA 2N1AB 1MT1A 3OXGA 2SGDI 3SEKC 4E1PA 5JHWC 1TIHA 1CGJI 3UGLA 2ARPF 2DIPA 1YTPA 1SGRI 1DS2I 2E73A 3FC3A 1SGDI 3UEYA 1IY5A 1HDLA 2L7XA 2QQDA 1R0RI 2P6AC 2UZ3A 4UXJA 5HI7A 3HH2C 3B4VC 1YU6C 1PTRA 2JW6A 2GKRI 2BUSA 2SGEI 2V53A 3D00A 1XBTA 3MEKA 1IY6A 2J9RA 4HGUA 2GVIA 2N17A 5FUXA 2SGPI 3RU0A 1XX6A 2NU4I 2XRCA 5DAEA 1TBRR 4OVOA 4SGBI 3UGIA 2JXDA 1X4SA 2SGQI 1SGPI 1TBOA 1LR7A 3SGBI 2L8EA 2ENNA 2QPOA 4GI3C 1V1IA 1U5KA 2F3CI 3GOXA 1PTQA 3QWPA 2YQPA 2N52A 1OMUA 2LEOA 2N71A 1VDDA 1TOTA 3OVOA 2KMRA 1X74A 2ORWA 1Y1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CHO I;  2ERW A;  1UVG A;  1PCE A;  2B0U C;  1Y1B A;  1OVO A;  1UUC A;  1TUS A;  2WCY A;  2KMQ A;  3QTL D;  1PJU A;  2NU3 I;  1TGS I;  1M8C A;  2M5X A;  2QQC A;  1CT4 I;  2SGF I;  1IW4 A;  2KMP A;  1HPT A;  1OMT A;  2JYY A;  1CGI I;  2OVO A;  2GKV A;  1TBQ R;  1TUR A;  2GKT I;  1CT0 I;  1KMA A;  1SGN I;  1SGQ I;  2JZM A;  1BUS A;  2NU2 I;  1OYV I;  1M8B A;  2KMO A;  1H0Z A;  3TJQ A;  1CT2 I;  2NU0 I;  1NUB A;  2KCX A;  1DS3 I;  1PPF I;  1N13 A;  1LR9 A;  1FYB A;  1SGE I;  1BMO A;  1AN1 I;  1SGY I;  2NU1 I;  1LR8 A;  1HJA I;  1CE3 A;  1UVF A;  1Z7K B;  3SGQ I;  1CSO I;  1MT1 A;  2SGD I;  3SEK C;  5JHW C;  1TIH A;  1CGJ I;  2ARP F;  1YTP A;  1SGR I;  1DS2 I;  1HDL A;  1SGD I;  1IY5 A;  2QQD A;  1R0R I;  2P6A C;  3HH2 C;  3B4V C;  1YU6 C;  2GKR I;  2BUS A;  2SGE I;  2V53 A;  1IY6 A;  4HGU A;  2N17 A;  2SGP I;  2NU4 I;  2XRC A;  5DAE A;  1TBR R;  4OVO A;  4SGB I;  2JXD A;  2SGQ I;  1SGP I;  3SGB I;  1LR7 A;  4GI3 C;  2F3C I;  2N52 A;  1OMU A;  2LEO A;  2N71 A;  3OVO A;  2KMR A;  1Y1C A; 
#chains in the Genus database with same CATH topology
 1CHO I;  2ERW A;  1UVG A;  1FAR A;  1PCE A;  3CXL A;  2B0U C;  2YUU A;  1Y1B A;  4E1R A;  2ELI A;  2OD1 A;  3UEJ A;  1OVO A;  1Y8F A;  1UUC A;  1TUS A;  2WCY A;  5FUW A;  2RIJ A;  4FKD A;  2KMQ A;  3QTL D;  1PJU A;  1RFH A;  1NXU A;  1P9Z A;  2NU3 I;  1TGS I;  3BJI A;  1M8C A;  2M5X A;  2QQC A;  1CT4 I;  1TBN A;  2QQ0 A;  4L9M A;  2SGF I;  3KY9 A;  1Z2I A;  1IW4 A;  2DKV A;  2UVO A;  2QQE A;  2LB7 A;  2KMP A;  1HPT A;  4B6D A;  2DB6 A;  1OMT A;  1W4R A;  3UFF A;  2FNF X;  1CGI I;  2GIV A;  2GKV A;  2JYY A;  2CJS C;  1TBQ R;  2OVO A;  1TUR A;  3VDP A;  5E3R A;  5CCL A;  4DNC A;  2GKT I;  9WGA A;  5CCM A;  5HQ8 A;  5EX0 A;  1P9G A;  5FUV A;  3E59 A;  4UXH A;  2J87 A;  1CT0 I;  2VRW B;  2WVJ A;  1KMA A;  1K7V A;  4JCV E;  5EX3 A;  4AML A;  1SGN I;  5FUY A;  1SGQ I;  1KBF A;  3FSX A;  2JZM A;  1BUS A;  1XA6 A;  2NU2 I;  3VE5 A;  1W3S A;  1OYV I;  4WP4 A;  2E5R A;  1M8B A;  2KMO A;  3E2I A;  4MPI A;  1H0Z A;  1IY5 A;  3TJQ A;  1FY7 A;  3PDN A;  1CT2 I;  2ODD A;  2RC4 A;  2NU0 I;  1NUB A;  2CWH A;  4UXI A;  1HEV A;  1MJB A;  1UHA A;  1V1H A;  2KCX A;  3VDU A;  1DS3 I;  1PPF I;  5J8C A;  1N13 A;  3OXF A;  1LR9 A;  1FYB A;  2V1C C;  2W0T A;  1MJ9 A;  2ROW A;  4A24 A;  1SGE I;  1BMO A;  2A20 A;  1AN1 I;  3R5B A;  1SGY I;  1WGC A;  1WKX A;  2NU1 I;  3TOA A;  3UGD A;  2B8T A;  2LUY A;  3OXL A;  1R79 A;  2K9H A;  2ORV A;  3UOE A;  1FAQ A;  1LR8 A;  2Y0M A;  1HJA I;  2PQ8 A;  3TO9 A;  1UVF A;  1Z7K B;  2V1C A;  1KBE A;  3TOB A;  2JA1 A;  1CE3 A;  3SGQ I;  3OL0 A;  1CSO I;  2ENZ A;  2N1A B;  1MT1 A;  3OXG A;  2SGD I;  5E3Q A;  3SEK C;  1Q9B A;  1TIH A;  1CGJ I;  3UGL A;  4E1P A;  5JHW C;  2ARP F;  2DIP A;  1YTP A;  1SGR I;  1DS2 I;  1HDL A;  2E73 A;  5J8F A;  1SGD I;  3UEY A;  7WGA A;  2OZU A;  3FC3 A;  2L7X A;  1ULK A;  2QQD A;  1R0R I;  3TO7 A;  2P6A C;  3TO6 A;  2UZ3 A;  4UXJ A;  5HI7 A;  3HH2 C;  3B4V C;  1S20 A;  1PTR A;  1YU6 C;  2JW6 A;  2GKR I;  2BUS A;  2SGE I;  2V53 A;  3D00 A;  1XBT A;  3MEK A;  1IY6 A;  2J9R A;  1WGT A;  4HGU A;  2GVI A;  3FSY A;  3R5D A;  2N17 A;  5FUX A;  2SGP I;  3RU0 A;  1XX6 A;  5E3P A;  2NU4 I;  2XRC A;  5DAE A;  1TBR R;  4OVO A;  4SGB I;  3UGI A;  1ULM A;  1K7U A;  1MJA A;  2JXD A;  2X3T A;  3QAH A;  3R5A A;  1X4S A;  2SGQ I;  1SGP I;  1TBO A;  1LR7 A;  3SGB I;  2CWF A;  2L8E A;  2ENN A;  2QPO A;  4GI3 C;  1V1I A;  1U5K A;  1WTJ A;  2F3C I;  2X52 A;  1ULN A;  1K7T A;  3GOX A;  2WGC A;  1PTQ A;  3QWP A;  2YQP A;  2N52 A;  2OU2 A;  1OMU A;  2LEO A;  2CWG A;  2N71 A;  1VDD A;  1TOT A;  3OVO A;  3R5C A;  2KMR A;  1X74 A;  2ORW A;  1Y1C A; 
#chains in the Genus database with same CATH homology
 1CHO I;  2ERW A;  1UVG A;  1FAR A;  1PCE A;  3CXL A;  2B0U C;  2YUU A;  1Y1B A;  4E1R A;  2ELI A;  2OD1 A;  3UEJ A;  1OVO A;  1Y8F A;  1UUC A;  1TUS A;  2WCY A;  5FUW A;  4FKD A;  2KMQ A;  3QTL D;  1PJU A;  1RFH A;  2NU3 I;  1TGS I;  3BJI A;  1M8C A;  2M5X A;  2QQC A;  1CT4 I;  1TBN A;  2QQ0 A;  4L9M A;  2SGF I;  3KY9 A;  1IW4 A;  2QQE A;  2KMP A;  1HPT A;  4B6D A;  2DB6 A;  1OMT A;  1W4R A;  3UFF A;  2FNF X;  1CGI I;  2JYY A;  2GKV A;  2OVO A;  2CJS C;  1TBQ R;  1TUR A;  3VDP A;  5CCL A;  2GKT I;  5CCM A;  5HQ8 A;  5EX0 A;  5FUV A;  3E59 A;  4UXH A;  2J87 A;  1CT0 I;  2VRW B;  2WVJ A;  1KMA A;  4JCV E;  5EX3 A;  1SGN I;  5FUY A;  1SGQ I;  1KBF A;  2JZM A;  1BUS A;  1XA6 A;  2NU2 I;  3VE5 A;  1W3S A;  1OYV I;  2E5R A;  1M8B A;  2KMO A;  3E2I A;  1H0Z A;  3TJQ A;  3PDN A;  1CT2 I;  2ODD A;  2NU0 I;  1NUB A;  4UXI A;  1V1H A;  2KCX A;  3VDU A;  1DS3 I;  1PPF I;  1N13 A;  3OXF A;  1LR9 A;  1FYB A;  2V1C C;  2W0T A;  2ROW A;  4A24 A;  1SGE I;  1BMO A;  2A20 A;  1AN1 I;  1SGY I;  2NU1 I;  3UGD A;  2B8T A;  2LUY A;  3OXL A;  1R79 A;  2K9H A;  2ORV A;  1FAQ A;  1LR8 A;  1HJA I;  1CE3 A;  1UVF A;  1Z7K B;  2V1C A;  1KBE A;  2JA1 A;  3SGQ I;  3OL0 A;  1CSO I;  2ENZ A;  2N1A B;  1MT1 A;  3OXG A;  2SGD I;  3SEK C;  4E1P A;  5JHW C;  1TIH A;  1CGJ I;  3UGL A;  2ARP F;  2DIP A;  1YTP A;  1SGR I;  1DS2 I;  2E73 A;  3FC3 A;  1SGD I;  3UEY A;  1IY5 A;  1HDL A;  2L7X A;  2QQD A;  1R0R I;  2P6A C;  2UZ3 A;  4UXJ A;  5HI7 A;  3HH2 C;  3B4V C;  1YU6 C;  1PTR A;  2JW6 A;  2GKR I;  2BUS A;  2SGE I;  2V53 A;  3D00 A;  1XBT A;  3MEK A;  1IY6 A;  2J9R A;  4HGU A;  2GVI A;  2N17 A;  5FUX A;  2SGP I;  3RU0 A;  1XX6 A;  2NU4 I;  2XRC A;  5DAE A;  1TBR R;  4OVO A;  4SGB I;  3UGI A;  2JXD A;  1X4S A;  2SGQ I;  1SGP I;  1TBO A;  1LR7 A;  3SGB I;  2L8E A;  2ENN A;  2QPO A;  4GI3 C;  1V1I A;  1U5K A;  2F3C I;  3GOX A;  1PTQ A;  3QWP A;  2YQP A;  2N52 A;  1OMU A;  2LEO A;  2N71 A;  1VDD A;  1TOT A;  3OVO A;  2KMR A;  1X74 A;  2ORW A;  1Y1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...