4OVOA

Refined x-ray crystal structures of the reactive site modified ovomucoid inhibitor third domains from silver pheasant (omsvp3(asterisk)) and from japanese quail (omjpq3(asterisk))
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
56
structure length
56
Chain Sequence
LAAVSVDCSEYPKPACTMEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OVOMUCOID THIRD DOMAIN CLEAVED RDI
publication title Refined X-ray crystal structures of the reactive site modified ovomucoid inhibitor third domains from silver pheasant (OMSVP3*) and from Japanese quail (OMJPQ3*).
pubmed doi rcsb
source organism Lophura nycthemera
molecule tags Proteinase inhibitor (kazal)
total genus 11
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1991-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4ovoA00
1SGQI 1CT4I 1DS3I 1IY5A 2GKVA 2NU3I 1CGJI 2N17A 2ERWA 2P6AC 1FYBA 3B4VC 2V53A 3OVOA 2NU4I 2WCYA 4OVOA 1DS2I 1TBQR 2JYYA 3HH2C 3SGQI 5JHWC 1CE3A 1MT1A 2M5XA 1N13A 1LR8A 1AN1I 1OMTA 1PPFI 2NU0I 1HPTA 2OVOA 5DAEA 1UVFA 1UVGA 1SGNI 1IY6A 2KMRA 4GI3C 1TBRR 1SGDI 4HGUA 1SGPI 1HJAI 1TGSI 1Y1BA 1CHOI 1TIHA 2KMQA 1CT0I 1TURA 2KMPA 2KMOA 1SGYI 2NU2I 2XRCA 2SGPI 2GKRI 1Z7KB 1SGRI 2F3CI 2QQDA 4SGBI 1CT2I 1R0RI 1KMAA 2BUSA 2N52A 1UUCA 2JZMA 2ARPF 1BUSA 1PJUA 1CSOI 3QTLD 1Y1CA 3SEKC 2SGEI 2QQCA 1TUSA 1IW4A 2SGQI 1OYVI 1OMUA 2SGFI 2JXDA 2GKTI 1NUBA 1LR7A 2KCXA 3TJQA 3SGBI 1BMOA 1OVOA 1PCEA 2NU1I 2N71A 2SGDI 1M8CA 1CGII 1YU6C 2B0UC 1HDLA 1YTPA 1LR9A 1SGEI 2LEOA 1H0ZA 1M8BA
chains in the Genus database with same CATH superfamily
1ULKA 1SGQI 1CT4I 1DS3I 3E2IA 3FC3A 3VDUA 3R5CA 2DKVA 1IY5A 4E1PA 1W4RA 1TOTA 1UHAA 3UGIA 3TO9A 4A24A 2DIPA 2GKVA 1PTRA 2NU3I 1CGJI 2E73A 5FUVA 3UGLA 2WGCA 2CWGA 2J87A 2N17A 2ORWA 2CWFA 1MJ9A 2ERWA 2P6AC 2Y0MA 3VE5A 1W3SA 4B6DA 2V1CC 1Q9BA 2UVOA 1FYBA 1ULMA 1FY7A 2ROWA 3OL0A 3UGDA 1KBFA 3KY9A 3B4VC 2ODDA 2LB7A 2V53A 3UFFA 2OZUA 2VRWB 3OVOA 2NU4I 5HQ8A 4L9MA 2WCYA 4OVOA 3UOEA 3TOAA 1DS2I 1XBTA 1TBQR 2OD1A 4MPIA 2JYYA 2K9HA 3HH2C 2N1AB 4UXHA 2L8EA 2X3TA 3SGQI 1X74A 3FSYA 5J8CA 2GIVA 5JHWC 1CE3A 1FARA 3VDPA 1MT1A 3UEJA 3UEYA 2M5XA 1N13A 2ELIA 2OU2A 2ENNA 4DNCA 1LR8A 1AN1I 1OMTA 1PPFI 1V1IA 1X4SA 2NU0I 2V1CA 2X52A 2E5RA 1HPTA 2OVOA 5DAEA 5FUXA 1UVFA 3E59A 3D00A 1WGCA 5FUYA 2ORVA 1TBOA 1UVGA 5E3RA 1PTQA 1SGNI 1IY6A 2KMRA 4GI3C 1TBRR 1SGDI 1K7TA 4HGUA 1SGPI 3CXLA 2PQ8A 1HJAI 5HI7A 1WTJA 5J8FA 1TGSI 7WGAA 1Y1BA 2QPOA 3QAHA 1CHOI 1TIHA 2JW6A 2KMQA 1CT0I 3R5AA 4FKDA 4E1RA 5CCLA 4UXJA 2RIJA 1V1HA 9WGAA 1TURA 5EX0A 3R5BA 1P9ZA 2KMPA 1K7VA 1TBNA 2KMOA 1HEVA 1SGYI 2NU2I 2XRCA 2SGPI 3BJIA 2CJSC 2GKRI 2YUUA 2J9RA 1Z7KB 2W0TA 1SGRI 3OXFA 1MJBA 2F3CI 3FSXA 4AMLA 2GVIA 2QQDA 2DB6A 2QQ0A 4SGBI 1CT2I 2ENZA 1S20A 1MJAA 1H0ZA 1P9GA 1R0RI 1Z2IA 1KMAA 2BUSA 2L7XA 2N52A 1K7UA 1UUCA 2JZMA 4UXIA 2YQPA 2RC4A 4JCVE 2ARPF 1KBEA 1BUSA 1PJUA 1CSOI 3QTLD 2CWHA 1Y1CA 3SEKC 3TOBA 2SGEI 5EX3A 2QQCA 3TO6A 3MEKA 1TUSA 1FAQA 1IW4A 2SGQI 1OYVI 1OMUA 2SGFI 2JXDA 2GKTI 5E3PA 1NUBA 1LR7A 1WGTA 1XX6A 2KCXA 3R5DA 5CCMA 3TJQA 1U5KA 3SGBI 2QQEA 2A20A 1BMOA 1OVOA 3PDNA 2UZ3A 5FUWA 3QWPA 1PCEA 5E3QA 2JA1A 3GOXA 2NU1I 3TO7A 3OXGA 1VDDA 2N71A 2SGDI 1ULNA 2WVJA 1R79A 3OXLA 2B8TA 1CGII 1M8CA 2FNFX 4WP4A 1YU6C 1Y8FA 2B0UC 1HDLA 1YTPA 1NXUA 1RFHA 1LR9A 1SGEI 1WKXA 1XA6A 2LEOA 2LUYA 3RU0A 1M8BA
chains in the Genus database with same CATH topology
1SGQI 1CT4I 1DS3I 3E2IA 3FC3A 3VDUA 1IY5A 4E1PA 1W4RA 1TOTA 3UGIA 4A24A 2DIPA 2GKVA 1PTRA 2NU3I 1CGJI 2E73A 5FUVA 3UGLA 2J87A 2N17A 2ORWA 2ERWA 2P6AC 3VE5A 1W3SA 4B6DA 2V1CC 1FYBA 3UGDA 2ROWA 3OL0A 1KBFA 3KY9A 3B4VC 2ODDA 3UFFA 2V53A 2VRWB 3OVOA 2NU4I 5HQ8A 4L9MA 2WCYA 4OVOA 1DS2I 1XBTA 1TBQR 2OD1A 2JYYA 2K9HA 3HH2C 2N1AB 4UXHA 2L8EA 3SGQI 1X74A 5JHWC 1CE3A 1FARA 3VDPA 1MT1A 3UEJA 3UEYA 2M5XA 1N13A 2ELIA 2ENNA 1LR8A 1AN1I 1OMTA 1PPFI 1V1IA 1X4SA 2NU0I 2V1CA 5FUXA 2E5RA 1HPTA 2OVOA 5DAEA 1UVFA 3E59A 3D00A 5FUYA 2ORVA 1TBOA 1UVGA 1PTQA 1SGNI 1IY6A 2KMRA 4GI3C 1TBRR 1SGDI 4HGUA 1SGPI 3CXLA 5HI7A 1HJAI 1TGSI 1Y1BA 2QPOA 5CCLA 1CHOI 1TIHA 2JW6A 2KMQA 1CT0I 4FKDA 4E1RA 4UXJA 1V1HA 1TURA 5EX0A 2KMPA 1TBNA 2KMOA 1SGYI 2NU2I 2XRCA 2SGPI 3BJIA 2CJSC 2GKRI 2YUUA 2J9RA 1Z7KB 2W0TA 1SGRI 3OXFA 2F3CI 2GVIA 2QQDA 2DB6A 2QQ0A 4SGBI 1CT2I 2ENZA 1H0ZA 1R0RI 1KMAA 2BUSA 2L7XA 2N52A 1UUCA 2JZMA 4UXIA 2YQPA 4JCVE 2ARPF 1KBEA 1BUSA 1PJUA 1CSOI 3QTLD 1Y1CA 3SEKC 2SGEI 5EX3A 2QQCA 3MEKA 1TUSA 1FAQA 1IW4A 2SGQI 1OYVI 1OMUA 2SGFI 2JXDA 2GKTI 1NUBA 1LR7A 1XX6A 2KCXA 5CCMA 3TJQA 1U5KA 3SGBI 2QQEA 2A20A 1BMOA 1OVOA 3PDNA 2UZ3A 5FUWA 3QWPA 1PCEA 2JA1A 3GOXA 2NU1I 3OXGA 1VDDA 2N71A 2SGDI 2WVJA 1R79A 3OXLA 2B8TA 1M8CA 1CGII 2FNFX 1YU6C 1Y8FA 2B0UC 1HDLA 1YTPA 1RFHA 1LR9A 1SGEI 2LEOA 1XA6A 2LUYA 3RU0A 1M8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SGQ I;  1CT4 I;  1DS3 I;  1IY5 A;  2GKV A;  2NU3 I;  1CGJ I;  2N17 A;  2ERW A;  2P6A C;  1FYB A;  3B4V C;  2V53 A;  3OVO A;  2NU4 I;  2WCY A;  4OVO A;  1DS2 I;  1TBQ R;  2JYY A;  3HH2 C;  3SGQ I;  5JHW C;  1CE3 A;  1MT1 A;  2M5X A;  1N13 A;  1LR8 A;  1AN1 I;  1OMT A;  1PPF I;  2NU0 I;  1HPT A;  2OVO A;  5DAE A;  1UVF A;  1UVG A;  1SGN I;  1IY6 A;  2KMR A;  4GI3 C;  1TBR R;  1SGD I;  4HGU A;  1SGP I;  1HJA I;  1TGS I;  1Y1B A;  1CHO I;  1TIH A;  2KMQ A;  1CT0 I;  1TUR A;  2KMP A;  2KMO A;  1SGY I;  2NU2 I;  2XRC A;  2SGP I;  2GKR I;  1Z7K B;  1SGR I;  2F3C I;  2QQD A;  4SGB I;  1CT2 I;  1R0R I;  1KMA A;  2BUS A;  2N52 A;  1UUC A;  2JZM A;  2ARP F;  1BUS A;  1PJU A;  1CSO I;  3QTL D;  1Y1C A;  3SEK C;  2SGE I;  2QQC A;  1TUS A;  1IW4 A;  2SGQ I;  1OYV I;  1OMU A;  2SGF I;  2JXD A;  2GKT I;  1NUB A;  1LR7 A;  2KCX A;  3TJQ A;  3SGB I;  1BMO A;  1OVO A;  1PCE A;  2NU1 I;  2N71 A;  2SGD I;  1M8C A;  1CGI I;  1YU6 C;  2B0U C;  1HDL A;  1YTP A;  1LR9 A;  1SGE I;  2LEO A;  1H0Z A;  1M8B A; 
#chains in the Genus database with same CATH topology
 1ULK A;  1SGQ I;  1CT4 I;  1DS3 I;  3E2I A;  3FC3 A;  3VDU A;  3R5C A;  2DKV A;  1IY5 A;  4E1P A;  1W4R A;  1TOT A;  1UHA A;  3UGI A;  3TO9 A;  4A24 A;  2DIP A;  2GKV A;  1PTR A;  2NU3 I;  1CGJ I;  2E73 A;  5FUV A;  3UGL A;  2WGC A;  2CWG A;  2J87 A;  2N17 A;  2ORW A;  2CWF A;  1MJ9 A;  2ERW A;  2P6A C;  2Y0M A;  3VE5 A;  1W3S A;  4B6D A;  2V1C C;  1Q9B A;  2UVO A;  1FYB A;  1ULM A;  1FY7 A;  2ROW A;  3OL0 A;  3UGD A;  1KBF A;  3KY9 A;  3B4V C;  2ODD A;  2LB7 A;  2V53 A;  3UFF A;  2OZU A;  2VRW B;  3OVO A;  2NU4 I;  5HQ8 A;  4L9M A;  2WCY A;  4OVO A;  3UOE A;  3TOA A;  1DS2 I;  1XBT A;  1TBQ R;  2OD1 A;  4MPI A;  2JYY A;  2K9H A;  3HH2 C;  2N1A B;  4UXH A;  2L8E A;  2X3T A;  3SGQ I;  1X74 A;  3FSY A;  5J8C A;  2GIV A;  5JHW C;  1CE3 A;  1FAR A;  3VDP A;  1MT1 A;  3UEJ A;  3UEY A;  2M5X A;  1N13 A;  2ELI A;  2OU2 A;  2ENN A;  4DNC A;  1LR8 A;  1AN1 I;  1OMT A;  1PPF I;  1V1I A;  1X4S A;  2NU0 I;  2V1C A;  2X52 A;  2E5R A;  1HPT A;  2OVO A;  5DAE A;  5FUX A;  1UVF A;  3E59 A;  3D00 A;  1WGC A;  5FUY A;  2ORV A;  1TBO A;  1UVG A;  5E3R A;  1PTQ A;  1SGN I;  1IY6 A;  2KMR A;  4GI3 C;  1TBR R;  1SGD I;  1K7T A;  4HGU A;  1SGP I;  3CXL A;  2PQ8 A;  1HJA I;  5HI7 A;  1WTJ A;  5J8F A;  1TGS I;  7WGA A;  1Y1B A;  2QPO A;  3QAH A;  1CHO I;  1TIH A;  2JW6 A;  2KMQ A;  1CT0 I;  3R5A A;  4FKD A;  4E1R A;  5CCL A;  4UXJ A;  2RIJ A;  1V1H A;  9WGA A;  1TUR A;  5EX0 A;  3R5B A;  1P9Z A;  2KMP A;  1K7V A;  1TBN A;  2KMO A;  1HEV A;  1SGY I;  2NU2 I;  2XRC A;  2SGP I;  3BJI A;  2CJS C;  2GKR I;  2YUU A;  2J9R A;  1Z7K B;  2W0T A;  1SGR I;  3OXF A;  1MJB A;  2F3C I;  3FSX A;  4AML A;  2GVI A;  2QQD A;  2DB6 A;  2QQ0 A;  4SGB I;  1CT2 I;  2ENZ A;  1S20 A;  1MJA A;  1H0Z A;  1P9G A;  1R0R I;  1Z2I A;  1KMA A;  2BUS A;  2L7X A;  2N52 A;  1K7U A;  1UUC A;  2JZM A;  4UXI A;  2YQP A;  2RC4 A;  4JCV E;  2ARP F;  1KBE A;  1BUS A;  1PJU A;  1CSO I;  3QTL D;  2CWH A;  1Y1C A;  3SEK C;  3TOB A;  2SGE I;  5EX3 A;  2QQC A;  3TO6 A;  3MEK A;  1TUS A;  1FAQ A;  1IW4 A;  2SGQ I;  1OYV I;  1OMU A;  2SGF I;  2JXD A;  2GKT I;  5E3P A;  1NUB A;  1LR7 A;  1WGT A;  1XX6 A;  2KCX A;  3R5D A;  5CCM A;  3TJQ A;  1U5K A;  3SGB I;  2QQE A;  2A20 A;  1BMO A;  1OVO A;  3PDN A;  2UZ3 A;  5FUW A;  3QWP A;  1PCE A;  5E3Q A;  2JA1 A;  3GOX A;  2NU1 I;  3TO7 A;  3OXG A;  1VDD A;  2N71 A;  2SGD I;  1ULN A;  2WVJ A;  1R79 A;  3OXL A;  2B8T A;  1CGI I;  1M8C A;  2FNF X;  4WP4 A;  1YU6 C;  1Y8F A;  2B0U C;  1HDL A;  1YTP A;  1NXU A;  1RFH A;  1LR9 A;  1SGE I;  1WKX A;  1XA6 A;  2LEO A;  2LUY A;  3RU0 A;  1M8B A; 
#chains in the Genus database with same CATH homology
 1SGQ I;  1CT4 I;  1DS3 I;  3E2I A;  3FC3 A;  3VDU A;  1IY5 A;  4E1P A;  1W4R A;  1TOT A;  3UGI A;  4A24 A;  2DIP A;  2GKV A;  1PTR A;  2NU3 I;  1CGJ I;  2E73 A;  5FUV A;  3UGL A;  2J87 A;  2N17 A;  2ORW A;  2ERW A;  2P6A C;  3VE5 A;  1W3S A;  4B6D A;  2V1C C;  1FYB A;  3UGD A;  2ROW A;  3OL0 A;  1KBF A;  3KY9 A;  3B4V C;  2ODD A;  3UFF A;  2V53 A;  2VRW B;  3OVO A;  2NU4 I;  5HQ8 A;  4L9M A;  2WCY A;  4OVO A;  1DS2 I;  1XBT A;  1TBQ R;  2OD1 A;  2JYY A;  2K9H A;  3HH2 C;  2N1A B;  4UXH A;  2L8E A;  3SGQ I;  1X74 A;  5JHW C;  1CE3 A;  1FAR A;  3VDP A;  1MT1 A;  3UEJ A;  3UEY A;  2M5X A;  1N13 A;  2ELI A;  2ENN A;  1LR8 A;  1AN1 I;  1OMT A;  1PPF I;  1V1I A;  1X4S A;  2NU0 I;  2V1C A;  5FUX A;  2E5R A;  1HPT A;  2OVO A;  5DAE A;  1UVF A;  3E59 A;  3D00 A;  5FUY A;  2ORV A;  1TBO A;  1UVG A;  1PTQ A;  1SGN I;  1IY6 A;  2KMR A;  4GI3 C;  1TBR R;  1SGD I;  4HGU A;  1SGP I;  3CXL A;  5HI7 A;  1HJA I;  1TGS I;  1Y1B A;  2QPO A;  5CCL A;  1CHO I;  1TIH A;  2JW6 A;  2KMQ A;  1CT0 I;  4FKD A;  4E1R A;  4UXJ A;  1V1H A;  1TUR A;  5EX0 A;  2KMP A;  1TBN A;  2KMO A;  1SGY I;  2NU2 I;  2XRC A;  2SGP I;  3BJI A;  2CJS C;  2GKR I;  2YUU A;  2J9R A;  1Z7K B;  2W0T A;  1SGR I;  3OXF A;  2F3C I;  2GVI A;  2QQD A;  2DB6 A;  2QQ0 A;  4SGB I;  1CT2 I;  2ENZ A;  1H0Z A;  1R0R I;  1KMA A;  2BUS A;  2L7X A;  2N52 A;  1UUC A;  2JZM A;  4UXI A;  2YQP A;  4JCV E;  2ARP F;  1KBE A;  1BUS A;  1PJU A;  1CSO I;  3QTL D;  1Y1C A;  3SEK C;  2SGE I;  5EX3 A;  2QQC A;  3MEK A;  1TUS A;  1FAQ A;  1IW4 A;  2SGQ I;  1OYV I;  1OMU A;  2SGF I;  2JXD A;  2GKT I;  1NUB A;  1LR7 A;  1XX6 A;  2KCX A;  5CCM A;  3TJQ A;  1U5K A;  3SGB I;  2QQE A;  2A20 A;  1BMO A;  1OVO A;  3PDN A;  2UZ3 A;  5FUW A;  3QWP A;  1PCE A;  2JA1 A;  3GOX A;  2NU1 I;  3OXG A;  1VDD A;  2N71 A;  2SGD I;  2WVJ A;  1R79 A;  3OXL A;  2B8T A;  1M8C A;  1CGI I;  2FNF X;  1YU6 C;  1Y8F A;  2B0U C;  1HDL A;  1YTP A;  1RFH A;  1LR9 A;  1SGE I;  2LEO A;  1XA6 A;  2LUY A;  3RU0 A;  1M8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...