4OVOA

Refined x-ray crystal structures of the reactive site modified ovomucoid inhibitor third domains from silver pheasant (omsvp3(asterisk)) and from japanese quail (omjpq3(asterisk))
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
56
structure length
56
Chain Sequence
LAAVSVDCSEYPKPACTMEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OVOMUCOID THIRD DOMAIN CLEAVED RDI
publication title Refined X-ray crystal structures of the reactive site modified ovomucoid inhibitor third domains from silver pheasant (OMSVP3*) and from Japanese quail (OMJPQ3*).
pubmed doi rcsb
source organism Lophura nycthemera
molecule tags Proteinase inhibitor (kazal)
total genus 11
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1991-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4ovoA00
2BUSA 1TBRR 1M8BA 2JYYA 1Y1BA 1OMTA 2SGPI 1SGNI 1LR7A 2SGDI 1BUSA 3SGQI 1H0ZA 2V53A 2NU2I 1CGII 1TGSI 2NU3I 3SGBI 1Y1CA 1AN1I 1UVGA 1LR9A 1PCEA 1CGJI 2JZMA 1TURA 1N13A 4OVOA 2M5XA 1R0RI 1BMOA 1HPTA 2N17A 1Z7KB 2QQCA 1CE3A 2OVOA 2SGEI 2SGFI 1HDLA 1SGRI 1UUCA 1OYVI 1M8CA 3QTLD 2KMPA 1SGDI 1KMAA 1PPFI 1SGYI 2KCXA 1FYBA 3TJQA 4SGBI 2F3CI 2NU1I 1IY5A 1DS3I 1OMUA 2ARPF 4HGUA 1MT1A 5DAEA 2GKVA 2XRCA 1CT2I 2LEOA 3B4VC 2P6AC 2N71A 3SEKC 2NU0I 1YU6C 1PJUA 2NU4I 1OVOA 1TBQR 1NUBA 2KMOA 1SGEI 2QQDA 1TUSA 2WCYA 2KMQA 2SGQI 1SGQI 3HH2C 2GKTI 1CHOI 4GI3C 2B0UC 1DS2I 1HJAI 2N52A 1LR8A 1SGPI 2KMRA 1CT4I 2JXDA 1IW4A 1UVFA 2GKRI 3OVOA 1IY6A 1CT0I 1TIHA 5JHWC 1CSOI 1YTPA 2ERWA
chains in the Genus database with same CATH superfamily
2BUSA 1TBOA 1TBRR 5CCMA 1M8BA 2X3TA 3E59A 5FUWA 3QWPA 2JYYA 1Y1BA 1OMTA 2WVJA 2SGPI 2QQEA 3UGLA 3TOBA 2CWHA 1SGNI 1LR7A 2ENNA 1P9GA 2SGDI 1NXUA 2X52A 3R5DA 3RU0A 1BUSA 3TOAA 3SGQI 2RIJA 1H0ZA 3TO9A 4E1RA 2V53A 2NU2I 3MEKA 5J8CA 1P9ZA 2WGCA 2OU2A 1CGII 1K7TA 1PTRA 2ELIA 1FAQA 1TGSI 2UZ3A 1WKXA 3BJIA 1Y8FA 2NU3I 3VDUA 3SGBI 2OD1A 1Y1CA 2V1CC 1XBTA 3UGDA 1AN1I 3GOXA 1UVGA 2L8EA 1W4RA 1LR9A 1PCEA 3FSXA 3UEYA 2ORVA 1CGJI 2JZMA 1TURA 2OZUA 1N13A 4OVOA 2CJSC 5EX3A 2M5XA 1R0RI 1BMOA 1V1IA 2FNFX 1Z2IA 1WGCA 4UXHA 5E3QA 3UGIA 3CXLA 1HPTA 1TOTA 2JW6A 2N17A 3OL0A 3OXLA 3D00A 3QAHA 1V1HA 4MPIA 1Z7KB 4WP4A 2QQCA 1R79A 1CE3A 1WTJA 2OVOA 3TO7A 1ULNA 2SGEI 2A20A 5J8FA 2SGFI 1HDLA 3R5AA 3PDNA 3E2IA 3KY9A 1HEVA 3TO6A 1SGRI 2GIVA 2V1CA 1KBFA 1UHAA 1UUCA 1OYVI 1M8CA 1W3SA 3QTLD 2GVIA 2KMPA 1SGDI 2L7XA 1KMAA 1PPFI 1SGYI 2KCXA 2LUYA 1FYBA 3OXFA 3TJQA 4B6DA 2YUUA 1WGTA 5FUVA 4SGBI 2F3CI 3R5BA 2NU1I 2DIPA 1X74A 2Y0MA 7WGAA 1IY5A 1DS3I 4E1PA 1OMUA 2ARPF 2UVOA 4HGUA 5HQ8A 1MT1A 1PTQA 5DAEA 5FUYA 2GKVA 2XRCA 1MJAA 2QPOA 2ROWA 9WGAA 1CT2I 2LEOA 3B4VC 2DB6A 2P6AC 5E3RA 2QQ0A 2N71A 3SEKC 2E5RA 2NU0I 1Q9BA 4A24A 2RC4A 1K7UA 1YU6C 2ORWA 1PJUA 2NU4I 3OXGA 4DNCA 5HI7A 3FC3A 1OVOA 2ODDA 1RFHA 4AMLA 2B8TA 1FY7A 1NUBA 1TBQR 1SGEI 1VDDA 2KMOA 1ULMA 1MJ9A 4FKDA 1S20A 1XX6A 2QQDA 4UXIA 2W0TA 3VDPA 1TUSA 2WCYA 2KMQA 2CWGA 1TBNA 2SGQI 1SGQI 3HH2C 3R5CA 3FSYA 1X4SA 2GKTI 1CHOI 2DKVA 2K9HA 4GI3C 2E73A 2B0UC 1K7VA 4UXJA 3UEJA 4L9MA 3UFFA 1DS2I 1HJAI 3UOEA 2N52A 1U5KA 5CCLA 1LR8A 5E3PA 1SGPI 2LB7A 2N1AB 2J87A 2KMRA 1CT4I 1FARA 5EX0A 1ULKA 2J9RA 2PQ8A 2JXDA 5FUXA 1IW4A 1MJBA 2ENZA 1UVFA 2GKRI 3OVOA 2CWFA 1XA6A 1CT0I 1IY6A 1TIHA 5JHWC 1CSOI 1YTPA 2ERWA 2JA1A 4JCVE 2VRWB 2YQPA 3VE5A 1KBEA
chains in the Genus database with same CATH topology
2BUSA 1TBOA 1TBRR 5CCMA 1M8BA 3E59A 5FUWA 3QWPA 2JYYA 1Y1BA 1OMTA 2WVJA 2SGPI 2QQEA 3UGLA 2ENNA 1SGNI 1LR7A 3RU0A 2SGDI 1BUSA 3SGQI 1H0ZA 4E1RA 2V53A 2NU2I 3MEKA 1CGII 1PTRA 2ELIA 1FAQA 1TGSI 2UZ3A 3BJIA 1Y8FA 2NU3I 3VDUA 3SGBI 2OD1A 1Y1CA 2V1CC 1XBTA 3UGDA 1AN1I 3GOXA 1UVGA 2L8EA 1W4RA 1LR9A 1PCEA 3UEYA 2ORVA 1CGJI 2JZMA 1TURA 1N13A 4OVOA 2CJSC 5EX3A 2M5XA 1R0RI 1BMOA 1V1IA 2FNFX 4UXHA 3UGIA 3CXLA 1HPTA 1TOTA 2JW6A 2N17A 3OL0A 3OXLA 3D00A 1V1HA 1Z7KB 2QQCA 1R79A 1CE3A 2OVOA 2SGEI 2A20A 2SGFI 1HDLA 3PDNA 3E2IA 3KY9A 1SGRI 2V1CA 1KBFA 1UUCA 1OYVI 1M8CA 1W3SA 3QTLD 2GVIA 2KMPA 1SGDI 2L7XA 1KMAA 1PPFI 1SGYI 2KCXA 2LUYA 1FYBA 3OXFA 3TJQA 4B6DA 2YUUA 5FUVA 4SGBI 2F3CI 2NU1I 2DIPA 1X74A 1IY5A 1DS3I 4E1PA 1OMUA 2ARPF 5HQ8A 4HGUA 1MT1A 1PTQA 5DAEA 5FUYA 2GKVA 2XRCA 2QPOA 2ROWA 1CT2I 2LEOA 3B4VC 2DB6A 2P6AC 2QQ0A 2N71A 3SEKC 2E5RA 2NU0I 4A24A 1YU6C 2ORWA 1PJUA 2NU4I 3OXGA 3FC3A 5HI7A 1OVOA 2ODDA 1RFHA 2B8TA 1TBQR 1NUBA 1VDDA 1SGEI 2KMOA 4UXIA 4FKDA 2QQDA 1XX6A 2W0TA 3VDPA 1TUSA 2WCYA 2KMQA 1TBNA 2SGQI 1SGQI 3HH2C 1X4SA 2GKTI 1CHOI 3UFFA 2K9HA 4GI3C 2E73A 2B0UC 4UXJA 3UEJA 4L9MA 1DS2I 1HJAI 2N52A 1U5KA 5CCLA 1LR8A 1SGPI 2N1AB 2J87A 2KMRA 1CT4I 1FARA 5EX0A 2J9RA 2JXDA 5FUXA 1IW4A 2ENZA 1UVFA 2GKRI 3OVOA 1IY6A 1XA6A 1CT0I 1TIHA 5JHWC 1CSOI 1YTPA 2ERWA 2JA1A 4JCVE 2VRWB 2YQPA 3VE5A 1KBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BUS A;  1TBR R;  1M8B A;  2JYY A;  1Y1B A;  1OMT A;  2SGP I;  1SGN I;  1LR7 A;  2SGD I;  1BUS A;  3SGQ I;  1H0Z A;  2V53 A;  2NU2 I;  1CGI I;  1TGS I;  2NU3 I;  3SGB I;  1Y1C A;  1AN1 I;  1UVG A;  1LR9 A;  1PCE A;  1CGJ I;  2JZM A;  1TUR A;  1N13 A;  4OVO A;  2M5X A;  1R0R I;  1BMO A;  1HPT A;  2N17 A;  1Z7K B;  2QQC A;  1CE3 A;  2OVO A;  2SGE I;  2SGF I;  1HDL A;  1SGR I;  1UUC A;  1OYV I;  1M8C A;  3QTL D;  2KMP A;  1SGD I;  1KMA A;  1PPF I;  1SGY I;  2KCX A;  1FYB A;  3TJQ A;  4SGB I;  2F3C I;  2NU1 I;  1IY5 A;  1DS3 I;  1OMU A;  2ARP F;  4HGU A;  1MT1 A;  5DAE A;  2GKV A;  2XRC A;  1CT2 I;  2LEO A;  3B4V C;  2P6A C;  2N71 A;  3SEK C;  2NU0 I;  1YU6 C;  1PJU A;  2NU4 I;  1OVO A;  1TBQ R;  1NUB A;  2KMO A;  1SGE I;  2QQD A;  1TUS A;  2WCY A;  2KMQ A;  2SGQ I;  1SGQ I;  3HH2 C;  2GKT I;  1CHO I;  4GI3 C;  2B0U C;  1DS2 I;  1HJA I;  2N52 A;  1LR8 A;  1SGP I;  2KMR A;  1CT4 I;  2JXD A;  1IW4 A;  1UVF A;  2GKR I;  3OVO A;  1IY6 A;  1CT0 I;  1TIH A;  5JHW C;  1CSO I;  1YTP A;  2ERW A; 
#chains in the Genus database with same CATH topology
 2BUS A;  1TBO A;  1TBR R;  5CCM A;  1M8B A;  2X3T A;  3E59 A;  5FUW A;  3QWP A;  2JYY A;  1Y1B A;  1OMT A;  2WVJ A;  2SGP I;  2QQE A;  3UGL A;  3TOB A;  2CWH A;  1SGN I;  1LR7 A;  2ENN A;  1P9G A;  2SGD I;  1NXU A;  2X52 A;  3R5D A;  3RU0 A;  1BUS A;  3TOA A;  3SGQ I;  2RIJ A;  1H0Z A;  3TO9 A;  4E1R A;  2V53 A;  2NU2 I;  3MEK A;  5J8C A;  1P9Z A;  2WGC A;  2OU2 A;  1CGI I;  1K7T A;  1PTR A;  2ELI A;  1FAQ A;  1TGS I;  2UZ3 A;  1WKX A;  3BJI A;  1Y8F A;  2NU3 I;  3VDU A;  3SGB I;  2OD1 A;  1Y1C A;  2V1C C;  1XBT A;  3UGD A;  1AN1 I;  3GOX A;  1UVG A;  2L8E A;  1W4R A;  1LR9 A;  1PCE A;  3FSX A;  3UEY A;  2ORV A;  1CGJ I;  2JZM A;  1TUR A;  2OZU A;  1N13 A;  4OVO A;  2CJS C;  5EX3 A;  2M5X A;  1R0R I;  1BMO A;  1V1I A;  2FNF X;  1Z2I A;  1WGC A;  4UXH A;  5E3Q A;  3UGI A;  3CXL A;  1HPT A;  1TOT A;  2JW6 A;  2N17 A;  3OL0 A;  3OXL A;  3D00 A;  3QAH A;  1V1H A;  4MPI A;  1Z7K B;  4WP4 A;  2QQC A;  1R79 A;  1CE3 A;  1WTJ A;  2OVO A;  3TO7 A;  1ULN A;  2SGE I;  2A20 A;  5J8F A;  2SGF I;  1HDL A;  3R5A A;  3PDN A;  3E2I A;  3KY9 A;  1HEV A;  3TO6 A;  1SGR I;  2GIV A;  2V1C A;  1KBF A;  1UHA A;  1UUC A;  1OYV I;  1M8C A;  1W3S A;  3QTL D;  2GVI A;  2KMP A;  1SGD I;  2L7X A;  1KMA A;  1PPF I;  1SGY I;  2KCX A;  2LUY A;  1FYB A;  3OXF A;  3TJQ A;  4B6D A;  2YUU A;  1WGT A;  5FUV A;  4SGB I;  2F3C I;  3R5B A;  2NU1 I;  2DIP A;  1X74 A;  2Y0M A;  7WGA A;  1IY5 A;  1DS3 I;  4E1P A;  1OMU A;  2ARP F;  2UVO A;  4HGU A;  5HQ8 A;  1MT1 A;  1PTQ A;  5DAE A;  5FUY A;  2GKV A;  2XRC A;  1MJA A;  2QPO A;  2ROW A;  9WGA A;  1CT2 I;  2LEO A;  3B4V C;  2DB6 A;  2P6A C;  5E3R A;  2QQ0 A;  2N71 A;  3SEK C;  2E5R A;  2NU0 I;  1Q9B A;  4A24 A;  2RC4 A;  1K7U A;  1YU6 C;  2ORW A;  1PJU A;  2NU4 I;  3OXG A;  4DNC A;  5HI7 A;  3FC3 A;  1OVO A;  2ODD A;  1RFH A;  4AML A;  2B8T A;  1FY7 A;  1NUB A;  1TBQ R;  1SGE I;  1VDD A;  2KMO A;  1ULM A;  1MJ9 A;  4FKD A;  1S20 A;  1XX6 A;  2QQD A;  4UXI A;  2W0T A;  3VDP A;  1TUS A;  2WCY A;  2KMQ A;  2CWG A;  1TBN A;  2SGQ I;  1SGQ I;  3HH2 C;  3R5C A;  3FSY A;  1X4S A;  2GKT I;  1CHO I;  2DKV A;  2K9H A;  4GI3 C;  2E73 A;  2B0U C;  1K7V A;  4UXJ A;  3UEJ A;  4L9M A;  3UFF A;  1DS2 I;  1HJA I;  3UOE A;  2N52 A;  1U5K A;  5CCL A;  1LR8 A;  5E3P A;  1SGP I;  2LB7 A;  2N1A B;  2J87 A;  2KMR A;  1CT4 I;  1FAR A;  5EX0 A;  1ULK A;  2J9R A;  2PQ8 A;  2JXD A;  5FUX A;  1IW4 A;  1MJB A;  2ENZ A;  1UVF A;  2GKR I;  3OVO A;  2CWF A;  1XA6 A;  1CT0 I;  1IY6 A;  1TIH A;  5JHW C;  1CSO I;  1YTP A;  2ERW A;  2JA1 A;  4JCV E;  2VRW B;  2YQP A;  3VE5 A;  1KBE A; 
#chains in the Genus database with same CATH homology
 2BUS A;  1TBO A;  1TBR R;  5CCM A;  1M8B A;  3E59 A;  5FUW A;  3QWP A;  2JYY A;  1Y1B A;  1OMT A;  2WVJ A;  2SGP I;  2QQE A;  3UGL A;  2ENN A;  1SGN I;  1LR7 A;  3RU0 A;  2SGD I;  1BUS A;  3SGQ I;  1H0Z A;  4E1R A;  2V53 A;  2NU2 I;  3MEK A;  1CGI I;  1PTR A;  2ELI A;  1FAQ A;  1TGS I;  2UZ3 A;  3BJI A;  1Y8F A;  2NU3 I;  3VDU A;  3SGB I;  2OD1 A;  1Y1C A;  2V1C C;  1XBT A;  3UGD A;  1AN1 I;  3GOX A;  1UVG A;  2L8E A;  1W4R A;  1LR9 A;  1PCE A;  3UEY A;  2ORV A;  1CGJ I;  2JZM A;  1TUR A;  1N13 A;  4OVO A;  2CJS C;  5EX3 A;  2M5X A;  1R0R I;  1BMO A;  1V1I A;  2FNF X;  4UXH A;  3UGI A;  3CXL A;  1HPT A;  1TOT A;  2JW6 A;  2N17 A;  3OL0 A;  3OXL A;  3D00 A;  1V1H A;  1Z7K B;  2QQC A;  1R79 A;  1CE3 A;  2OVO A;  2SGE I;  2A20 A;  2SGF I;  1HDL A;  3PDN A;  3E2I A;  3KY9 A;  1SGR I;  2V1C A;  1KBF A;  1UUC A;  1OYV I;  1M8C A;  1W3S A;  3QTL D;  2GVI A;  2KMP A;  1SGD I;  2L7X A;  1KMA A;  1PPF I;  1SGY I;  2KCX A;  2LUY A;  1FYB A;  3OXF A;  3TJQ A;  4B6D A;  2YUU A;  5FUV A;  4SGB I;  2F3C I;  2NU1 I;  2DIP A;  1X74 A;  1IY5 A;  1DS3 I;  4E1P A;  1OMU A;  2ARP F;  5HQ8 A;  4HGU A;  1MT1 A;  1PTQ A;  5DAE A;  5FUY A;  2GKV A;  2XRC A;  2QPO A;  2ROW A;  1CT2 I;  2LEO A;  3B4V C;  2DB6 A;  2P6A C;  2QQ0 A;  2N71 A;  3SEK C;  2E5R A;  2NU0 I;  4A24 A;  1YU6 C;  2ORW A;  1PJU A;  2NU4 I;  3OXG A;  3FC3 A;  5HI7 A;  1OVO A;  2ODD A;  1RFH A;  2B8T A;  1TBQ R;  1NUB A;  1VDD A;  1SGE I;  2KMO A;  4UXI A;  4FKD A;  2QQD A;  1XX6 A;  2W0T A;  3VDP A;  1TUS A;  2WCY A;  2KMQ A;  1TBN A;  2SGQ I;  1SGQ I;  3HH2 C;  1X4S A;  2GKT I;  1CHO I;  3UFF A;  2K9H A;  4GI3 C;  2E73 A;  2B0U C;  4UXJ A;  3UEJ A;  4L9M A;  1DS2 I;  1HJA I;  2N52 A;  1U5K A;  5CCL A;  1LR8 A;  1SGP I;  2N1A B;  2J87 A;  2KMR A;  1CT4 I;  1FAR A;  5EX0 A;  2J9R A;  2JXD A;  5FUX A;  1IW4 A;  2ENZ A;  1UVF A;  2GKR I;  3OVO A;  1IY6 A;  1XA6 A;  1CT0 I;  1TIH A;  5JHW C;  1CSO I;  1YTP A;  2ERW A;  2JA1 A;  4JCV E;  2VRW B;  2YQP A;  3VE5 A;  1KBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...