4OVOA

Refined x-ray crystal structures of the reactive site modified ovomucoid inhibitor third domains from silver pheasant (omsvp3(asterisk)) and from japanese quail (omjpq3(asterisk))
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
56
structure length
56
Chain Sequence
LAAVSVDCSEYPKPACTMEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Proteinase inhibitor (kazal)
molecule keywords OVOMUCOID THIRD DOMAIN CLEAVED RDI
publication title Refined X-ray crystal structures of the reactive site modified ovomucoid inhibitor third domains from silver pheasant (OMSVP3*) and from Japanese quail (OMJPQ3*).
pubmed doi rcsb
source organism Lophura nycthemera
total genus 11
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1991-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4ovoA00
1AN1I 4HGUA 2QQCA 2P6AC 1CGJI 1LR8A 1TBQR 2SGDI 2N71A 1M8CA 2KMPA 1TUSA 1LR7A 3SGQI 2OVOA 1CT4I 2KCXA 2XRCA 1OVOA 1N13A 2ARPF 2LEOA 1SGNI 1OYVI 1YTPA 1CT0I 1M8BA 3SGBI 1SGYI 2NU4I 2V53A 2SGEI 2NU3I 1IY6A 1PCEA 2JXDA 3HH2C 3OVOA 1CHOI 2SGQI 1UUCA 1PPFI 2N52A 1UVGA 4GI3C 1HPTA 1LR9A 2GKTI 1BMOA 1KMAA 1SGDI 1H0ZA 2SGPI 3TJQA 2KMOA 2N17A 2WCYA 2F3CI 1HJAI 2BUSA 1Y1CA 1SGPI 1CE3A 1Y1BA 2ERWA 3QTLD 1BUSA 2SGFI 2B0UC 1PJUA 2M5XA 5DAEA 1HDLA 4OVOA 2KMRA 5JHWC 1FYBA 3B4VC 1TURA 2NU1I 1CGII 2GKVA 1DS2I 2JYYA 1CSOI 1Z7KB 1OMTA 2NU0I 1CT2I 1SGEI 1UVFA 1NUBA 1SGRI 2QQDA 1IY5A 1OMUA 1IW4A 2JZMA 4SGBI 1DS3I 1TGSI 1MT1A 1YU6C 2GKRI 3SEKC 1TIHA 2KMQA 1R0RI 1SGQI 1TBRR 2NU2I
chains in the Genus database with same CATH superfamily
1AN1I 1K7UA 1W3SA 3FSXA 2PQ8A 4HGUA 4DNCA 2K9HA 2QQCA 2QPOA 2VRWB 2P6AC 1CGJI 3QAHA 3RU0A 2RIJA 5J8CA 1LR8A 4MPIA 1P9GA 2DB6A 1TBQR 2SGDI 2N71A 1M8CA 3FC3A 2KMPA 1TUSA 1LR7A 3BJIA 3SGQI 2V1CA 2OVOA 3PDNA 1CT4I 2CWGA 2CWHA 4FKDA 5FUWA 3GOXA 4JCVE 2KCXA 2XRCA 1OVOA 1K7TA 1N13A 1ULMA 3MEKA 2OZUA 3TO9A 2ARPF 2GVIA 2W0TA 2LUYA 1ULKA 2WGCA 3R5AA 5CCLA 2QQEA 2LEOA 4UXIA 2UZ3A 1SGNI 1OYVI 3UGIA 1FARA 1YTPA 2ORWA 4E1PA 1CT0I 1M8BA 3SGBI 1SGYI 3FSYA 2NU4I 3UEJA 1X4SA 2V53A 4L9MA 7WGAA 2SGEI 2NU3I 1IY6A 1PCEA 2OU2A 3R5BA 2ENZA 2JXDA 2L8EA 2DIPA 1U5KA 2E73A 3CXLA 5HI7A 3HH2C 3OVOA 1CHOI 2E5RA 5EX0A 4E1RA 1HEVA 4A24A 2SGQI 1NXUA 1UUCA 1PPFI 1Z2IA 1Q9BA 1UVGA 1FY7A 2N52A 4GI3C 5E3RA 5HQ8A 1HPTA 1LR9A 1MJ9A 1BMOA 2GKTI 2DKVA 1KMAA 1K7VA 1SGDI 3E2IA 3OL0A 2ODDA 1WGTA 1H0ZA 3R5CA 2V1CC 5FUXA 2L7XA 4UXHA 2SGPI 1RFHA 1W4RA 3TJQA 2GIVA 2KMOA 1UHAA 3TOBA 2N17A 5E3QA 2WCYA 3UEYA 2B8TA 3UFFA 1KBFA 2F3CI 3UGLA 3OXLA 2X3TA 1HJAI 5J8FA 2RC4A 2BUSA 1Y1CA 3UOEA 1SGPI 1V1HA 1CE3A 4UXJA 3UGDA 1WKXA 2JA1A 4AMLA 3TO6A 1Y1BA 2ERWA 3E59A 1TOTA 3QTLD 1BUSA 1P9ZA 1ULNA 5E3PA 2A20A 5FUYA 2QQ0A 1PTQA 1Y8FA 2SGFI 4WP4A 2JW6A 1XX6A 2ORVA 2B0UC 1PJUA 1MJAA 1S20A 1WGCA 2FNFX 2M5XA 2NU2I 3OXFA 1MJBA 5DAEA 4OVOA 3VE5A 9WGAA 1HDLA 3D00A 3VDPA 1XA6A 1XBTA 2J9RA 4B6DA 1TBNA 2KMRA 1KBEA 1VDDA 5FUVA 5JHWC 1FYBA 2X52A 3TO7A 3B4VC 1TURA 2NU1I 3VDUA 1CGII 2OD1A 2GKVA 1DS2I 3QWPA 2YQPA 2JYYA 1CSOI 2WVJA 2UVOA 1Z7KB 1OMTA 1V1IA 3R5DA 2ROWA 2ENNA 1X74A 2J87A 2NU0I 1CT2I 2Y0MA 3KY9A 2CWFA 2LB7A 1SGEI 1UVFA 3TOAA 1FAQA 1NUBA 1SGRI 2QQDA 5EX3A 1IY5A 1OMUA 2CJSC 1PTRA 5CCMA 2N1AB 1IW4A 2ELIA 2JZMA 3OXGA 1DS3I 1TGSI 2YUUA 1TBOA 4SGBI 1MT1A 1YU6C 1R79A 2GKRI 1TIHA 3SEKC 2KMQA 1R0RI 1SGQI 1TBRR 1WTJA
chains in the Genus database with same CATH topology
1AN1I 1W3SA 4HGUA 2K9HA 2QQCA 2QPOA 2VRWB 2P6AC 1CGJI 3RU0A 1LR8A 2DB6A 1TBQR 2SGDI 2N71A 1M8CA 3FC3A 2KMPA 1TUSA 1LR7A 3BJIA 3SGQI 2V1CA 2OVOA 3PDNA 1CT4I 4FKDA 5FUWA 3GOXA 4JCVE 2KCXA 2XRCA 1OVOA 1N13A 3MEKA 2ARPF 2GVIA 2W0TA 2LUYA 5CCLA 2QQEA 2LEOA 4UXIA 2UZ3A 1SGNI 1OYVI 3UGIA 1FARA 1YTPA 2ORWA 4E1PA 1CT0I 1M8BA 3SGBI 1SGYI 2NU4I 3UEJA 1X4SA 2V53A 4L9MA 2SGEI 2NU3I 1IY6A 1PCEA 2ENZA 2JXDA 2L8EA 2DIPA 1U5KA 2E73A 3CXLA 5HI7A 3HH2C 3OVOA 1CHOI 2E5RA 5EX0A 4E1RA 4A24A 2SGQI 1UUCA 1PPFI 2N52A 1UVGA 4GI3C 5HQ8A 1HPTA 1LR9A 2GKTI 1BMOA 1KMAA 1SGDI 3E2IA 3OL0A 2ODDA 1H0ZA 2V1CC 5FUXA 2L7XA 4UXHA 2SGPI 1RFHA 1W4RA 3TJQA 2KMOA 2N17A 2WCYA 3UEYA 2B8TA 3UFFA 1KBFA 2F3CI 3UGLA 3OXLA 1HJAI 2BUSA 1Y1CA 1SGPI 1V1HA 1CE3A 4UXJA 3UGDA 2JA1A 1Y1BA 2ERWA 3E59A 1TOTA 3QTLD 1BUSA 2A20A 5FUYA 2QQ0A 1PTQA 1Y8FA 2SGFI 2JW6A 1XX6A 2ORVA 2B0UC 1PJUA 2FNFX 2M5XA 3OXFA 5DAEA 1HDLA 3VE5A 4OVOA 3D00A 3VDPA 1XA6A 1XBTA 2J9RA 4B6DA 1TBNA 2KMRA 1KBEA 1VDDA 5FUVA 5JHWC 1FYBA 3B4VC 1TURA 2NU1I 3VDUA 1CGII 2OD1A 2GKVA 1DS2I 3QWPA 2YQPA 2JYYA 1CSOI 2WVJA 1Z7KB 1OMTA 1V1IA 2ROWA 2ENNA 1X74A 2J87A 2NU0I 1CT2I 1FAQA 3KY9A 1SGEI 1UVFA 1NUBA 1SGRI 2QQDA 5EX3A 1IY5A 1OMUA 2CJSC 1PTRA 5CCMA 2N1AB 1IW4A 2ELIA 2JZMA 3OXGA 1DS3I 1TGSI 2YUUA 1TBOA 4SGBI 1MT1A 1YU6C 1R79A 2GKRI 1TIHA 3SEKC 2KMQA 1R0RI 1SGQI 1TBRR 2NU2I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AN1 I;  4HGU A;  2QQC A;  2P6A C;  1CGJ I;  1LR8 A;  1TBQ R;  2SGD I;  2N71 A;  1M8C A;  2KMP A;  1TUS A;  1LR7 A;  3SGQ I;  2OVO A;  1CT4 I;  2KCX A;  2XRC A;  1OVO A;  1N13 A;  2ARP F;  2LEO A;  1SGN I;  1OYV I;  1YTP A;  1CT0 I;  1M8B A;  3SGB I;  1SGY I;  2NU4 I;  2V53 A;  2SGE I;  2NU3 I;  1IY6 A;  1PCE A;  2JXD A;  3HH2 C;  3OVO A;  1CHO I;  2SGQ I;  1UUC A;  1PPF I;  2N52 A;  1UVG A;  4GI3 C;  1HPT A;  1LR9 A;  2GKT I;  1BMO A;  1KMA A;  1SGD I;  1H0Z A;  2SGP I;  3TJQ A;  2KMO A;  2N17 A;  2WCY A;  2F3C I;  1HJA I;  2BUS A;  1Y1C A;  1SGP I;  1CE3 A;  1Y1B A;  2ERW A;  3QTL D;  1BUS A;  2SGF I;  2B0U C;  1PJU A;  2M5X A;  5DAE A;  1HDL A;  4OVO A;  2KMR A;  5JHW C;  1FYB A;  3B4V C;  1TUR A;  2NU1 I;  1CGI I;  2GKV A;  1DS2 I;  2JYY A;  1CSO I;  1Z7K B;  1OMT A;  2NU0 I;  1CT2 I;  1SGE I;  1UVF A;  1NUB A;  1SGR I;  2QQD A;  1IY5 A;  1OMU A;  1IW4 A;  2JZM A;  4SGB I;  1DS3 I;  1TGS I;  1MT1 A;  1YU6 C;  2GKR I;  3SEK C;  1TIH A;  2KMQ A;  1R0R I;  1SGQ I;  1TBR R;  2NU2 I; 
#chains in the Genus database with same CATH topology
 1AN1 I;  1K7U A;  1W3S A;  3FSX A;  2PQ8 A;  4HGU A;  4DNC A;  2K9H A;  2QQC A;  2QPO A;  2VRW B;  2P6A C;  1CGJ I;  3QAH A;  3RU0 A;  2RIJ A;  5J8C A;  1LR8 A;  4MPI A;  1P9G A;  2DB6 A;  1TBQ R;  2SGD I;  2N71 A;  1M8C A;  3FC3 A;  2KMP A;  1TUS A;  1LR7 A;  3BJI A;  3SGQ I;  2V1C A;  2OVO A;  3PDN A;  1CT4 I;  2CWG A;  2CWH A;  4FKD A;  5FUW A;  3GOX A;  4JCV E;  2KCX A;  2XRC A;  1OVO A;  1K7T A;  1N13 A;  1ULM A;  3MEK A;  2OZU A;  3TO9 A;  2ARP F;  2GVI A;  2W0T A;  2LUY A;  1ULK A;  2WGC A;  3R5A A;  5CCL A;  2QQE A;  2LEO A;  4UXI A;  2UZ3 A;  1SGN I;  1OYV I;  3UGI A;  1FAR A;  1YTP A;  2ORW A;  4E1P A;  1CT0 I;  1M8B A;  3SGB I;  1SGY I;  3FSY A;  2NU4 I;  3UEJ A;  1X4S A;  2V53 A;  4L9M A;  7WGA A;  2SGE I;  2NU3 I;  1IY6 A;  1PCE A;  2OU2 A;  3R5B A;  2ENZ A;  2JXD A;  2L8E A;  2DIP A;  1U5K A;  2E73 A;  3CXL A;  5HI7 A;  3HH2 C;  3OVO A;  1CHO I;  2E5R A;  5EX0 A;  4E1R A;  1HEV A;  4A24 A;  2SGQ I;  1NXU A;  1UUC A;  1PPF I;  1Z2I A;  1Q9B A;  1UVG A;  1FY7 A;  2N52 A;  4GI3 C;  5E3R A;  5HQ8 A;  1HPT A;  1LR9 A;  1MJ9 A;  1BMO A;  2GKT I;  2DKV A;  1KMA A;  1K7V A;  1SGD I;  3E2I A;  3OL0 A;  2ODD A;  1WGT A;  1H0Z A;  3R5C A;  2V1C C;  5FUX A;  2L7X A;  4UXH A;  2SGP I;  1RFH A;  1W4R A;  3TJQ A;  2GIV A;  2KMO A;  1UHA A;  3TOB A;  2N17 A;  5E3Q A;  2WCY A;  3UEY A;  2B8T A;  3UFF A;  1KBF A;  2F3C I;  3UGL A;  3OXL A;  2X3T A;  1HJA I;  5J8F A;  2RC4 A;  2BUS A;  1Y1C A;  3UOE A;  1SGP I;  1V1H A;  1CE3 A;  4UXJ A;  3UGD A;  1WKX A;  2JA1 A;  4AML A;  3TO6 A;  1Y1B A;  2ERW A;  3E59 A;  1TOT A;  3QTL D;  1BUS A;  1P9Z A;  1ULN A;  5E3P A;  2A20 A;  5FUY A;  2QQ0 A;  1PTQ A;  1Y8F A;  2SGF I;  4WP4 A;  2JW6 A;  1XX6 A;  2ORV A;  2B0U C;  1PJU A;  1MJA A;  1S20 A;  1WGC A;  2FNF X;  2M5X A;  2NU2 I;  3OXF A;  1MJB A;  5DAE A;  4OVO A;  3VE5 A;  9WGA A;  1HDL A;  3D00 A;  3VDP A;  1XA6 A;  1XBT A;  2J9R A;  4B6D A;  1TBN A;  2KMR A;  1KBE A;  1VDD A;  5FUV A;  5JHW C;  1FYB A;  2X52 A;  3TO7 A;  3B4V C;  1TUR A;  2NU1 I;  3VDU A;  1CGI I;  2OD1 A;  2GKV A;  1DS2 I;  3QWP A;  2YQP A;  2JYY A;  1CSO I;  2WVJ A;  2UVO A;  1Z7K B;  1OMT A;  1V1I A;  3R5D A;  2ROW A;  2ENN A;  1X74 A;  2J87 A;  2NU0 I;  1CT2 I;  2Y0M A;  3KY9 A;  2CWF A;  2LB7 A;  1SGE I;  1UVF A;  3TOA A;  1FAQ A;  1NUB A;  1SGR I;  2QQD A;  5EX3 A;  1IY5 A;  1OMU A;  2CJS C;  1PTR A;  5CCM A;  2N1A B;  1IW4 A;  2ELI A;  2JZM A;  3OXG A;  1DS3 I;  1TGS I;  2YUU A;  1TBO A;  4SGB I;  1MT1 A;  1YU6 C;  1R79 A;  2GKR I;  1TIH A;  3SEK C;  2KMQ A;  1R0R I;  1SGQ I;  1TBR R;  1WTJ A; 
#chains in the Genus database with same CATH homology
 1AN1 I;  1W3S A;  4HGU A;  2K9H A;  2QQC A;  2QPO A;  2VRW B;  2P6A C;  1CGJ I;  3RU0 A;  1LR8 A;  2DB6 A;  1TBQ R;  2SGD I;  2N71 A;  1M8C A;  3FC3 A;  2KMP A;  1TUS A;  1LR7 A;  3BJI A;  3SGQ I;  2V1C A;  2OVO A;  3PDN A;  1CT4 I;  4FKD A;  5FUW A;  3GOX A;  4JCV E;  2KCX A;  2XRC A;  1OVO A;  1N13 A;  3MEK A;  2ARP F;  2GVI A;  2W0T A;  2LUY A;  5CCL A;  2QQE A;  2LEO A;  4UXI A;  2UZ3 A;  1SGN I;  1OYV I;  3UGI A;  1FAR A;  1YTP A;  2ORW A;  4E1P A;  1CT0 I;  1M8B A;  3SGB I;  1SGY I;  2NU4 I;  3UEJ A;  1X4S A;  2V53 A;  4L9M A;  2SGE I;  2NU3 I;  1IY6 A;  1PCE A;  2ENZ A;  2JXD A;  2L8E A;  2DIP A;  1U5K A;  2E73 A;  3CXL A;  5HI7 A;  3HH2 C;  3OVO A;  1CHO I;  2E5R A;  5EX0 A;  4E1R A;  4A24 A;  2SGQ I;  1UUC A;  1PPF I;  2N52 A;  1UVG A;  4GI3 C;  5HQ8 A;  1HPT A;  1LR9 A;  2GKT I;  1BMO A;  1KMA A;  1SGD I;  3E2I A;  3OL0 A;  2ODD A;  1H0Z A;  2V1C C;  5FUX A;  2L7X A;  4UXH A;  2SGP I;  1RFH A;  1W4R A;  3TJQ A;  2KMO A;  2N17 A;  2WCY A;  3UEY A;  2B8T A;  3UFF A;  1KBF A;  2F3C I;  3UGL A;  3OXL A;  1HJA I;  2BUS A;  1Y1C A;  1SGP I;  1V1H A;  1CE3 A;  4UXJ A;  3UGD A;  2JA1 A;  1Y1B A;  2ERW A;  3E59 A;  1TOT A;  3QTL D;  1BUS A;  2A20 A;  5FUY A;  2QQ0 A;  1PTQ A;  1Y8F A;  2SGF I;  2JW6 A;  1XX6 A;  2ORV A;  2B0U C;  1PJU A;  2FNF X;  2M5X A;  3OXF A;  5DAE A;  1HDL A;  3VE5 A;  4OVO A;  3D00 A;  3VDP A;  1XA6 A;  1XBT A;  2J9R A;  4B6D A;  1TBN A;  2KMR A;  1KBE A;  1VDD A;  5FUV A;  5JHW C;  1FYB A;  3B4V C;  1TUR A;  2NU1 I;  3VDU A;  1CGI I;  2OD1 A;  2GKV A;  1DS2 I;  3QWP A;  2YQP A;  2JYY A;  1CSO I;  2WVJ A;  1Z7K B;  1OMT A;  1V1I A;  2ROW A;  2ENN A;  1X74 A;  2J87 A;  2NU0 I;  1CT2 I;  1FAQ A;  3KY9 A;  1SGE I;  1UVF A;  1NUB A;  1SGR I;  2QQD A;  5EX3 A;  1IY5 A;  1OMU A;  2CJS C;  1PTR A;  5CCM A;  2N1A B;  1IW4 A;  2ELI A;  2JZM A;  3OXG A;  1DS3 I;  1TGS I;  2YUU A;  1TBO A;  4SGB I;  1MT1 A;  1YU6 C;  1R79 A;  2GKR I;  1TIH A;  3SEK C;  2KMQ A;  1R0R I;  1SGQ I;  1TBR R;  2NU2 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...