2F3CI

Crystal structure of infestin 1, a kazal-type serineprotease inhibitor, in complex with trypsin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
46
structure length
46
Chain Sequence
DCACPRVLHRVCGSDGNTYSNPCTLDCAKHEGKPDLVQVHEGPCDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title The Kazal-type inhibitors infestins 1 and 4 differ in specificity but are similar in three-dimensional structure.
pubmed doi rcsb
source organism Triatoma infestans
total genus 14
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2005-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2f3cI00
1TURA 1M8BA 1YU6C 2QQCA 1Z7KB 1N13A 2V53A 1PJUA 1TBQR 2GKRI 1CT2I 1LR7A 1IY5A 2KMRA 1LR8A 4SGBI 1OMUA 2GKTI 2XRCA 5JHWC 1HJAI 3B4VC 2N17A 2JZMA 2KMPA 1UVGA 1YTPA 4GI3C 4OVOA 1CT4I 1BMOA 1UUCA 2F3CI 3SEKC 1SGRI 2NU4I 1DS3I 1AN1I 1HPTA 1OYVI 2B0UC 1TBRR 2KMOA 2N52A 1Y1BA 1CT0I 2SGQI 2LEOA 1CSOI 1HDLA 1DS2I 2KMQA 2GKVA 2NU2I 2JXDA 1BUSA 1SGEI 1CHOI 1CGJI 2M5XA 2ERWA 1IY6A 1SGYI 2BUSA 1UVFA 1KMAA 2KCXA 4HGUA 1IW4A 2SGPI 1PCEA 1SGNI 2NU3I 1SGPI 1PPFI 5DAEA 1TGSI 1Y1CA 3HH2C 1FYBA 1LR9A 2JYYA 1CGII 1OMTA 2QQDA 3SGBI 2NU0I 2P6AC 1SGQI 2ARPF 1OVOA 2WCYA 2N71A 1M8CA 1NUBA 3TJQA 3SGQI 2OVOA 3OVOA 1TUSA 2SGDI 1H0ZA 1SGDI 1CE3A 3QTLD 1MT1A 2NU1I 1R0RI 1TIHA 2SGEI 2SGFI
chains in the Genus database with same CATH superfamily
1TURA 1M8BA 2LB7A 1YU6C 4AMLA 2OZUA 2QQCA 1Z7KB 1N13A 4MPIA 2V53A 3OXGA 2WVJA 2VRWB 1Y8FA 2CWFA 4DNCA 5HQ8A 3UFFA 1ULNA 1FARA 1PJUA 1V1IA 2ENNA 2OU2A 1TBQR 4UXHA 2QPOA 2K9HA 9WGAA 5J8CA 2GKRI 1KBEA 4E1RA 1CT2I 1K7UA 2OD1A 2ROWA 2V1CC 3FSYA 1S20A 1LR7A 2X52A 1IY5A 2QQ0A 1HEVA 3BJIA 1MJAA 2ODDA 3OL0A 1MJ9A 2KMRA 2N1AB 3UOEA 3R5CA 1LR8A 1WGCA 4SGBI 1OMUA 1TOTA 2GKTI 2XRCA 1FY7A 1HJAI 3D00A 3R5BA 5JHWC 3R5DA 1Q9BA 1ULMA 3B4VC 1VDDA 2N17A 1FAQA 2JZMA 1W4RA 1UVGA 2KMPA 3FC3A 1YTPA 1XBTA 1WTJA 4GI3C 1X4SA 5E3RA 3OXFA 4OVOA 2J9RA 2JA1A 3VE5A 1CT4I 1BMOA 1UUCA 2RC4A 5E3PA 2F3CI 3CXLA 3SEKC 3UEYA 1TBOA 1SGRI 1XX6A 1X74A 2NU4I 1DS3I 1PTRA 2A20A 3E2IA 1V1HA 3QWPA 1AN1I 2GIVA 5FUXA 1HPTA 3TO6A 2YUUA 1NXUA 1OYVI 2X3TA 3E59A 2B0UC 5EX3A 1TBRR 2LUYA 2ORWA 2KMOA 4B6DA 1WKXA 2N52A 2Y0MA 1UHAA 2L7XA 1Y1BA 1CT0I 3KY9A 3VDPA 2SGQI 2J87A 3TOBA 2LEOA 4E1PA 1CSOI 3VDUA 3MEKA 5CCLA 5E3QA 1HDLA 1DS2I 4UXJA 2KMQA 2GKVA 2NU2I 2JXDA 4JCVE 1BUSA 2FNFX 1SGEI 4WP4A 1CHOI 1CGJI 2M5XA 2ERWA 1P9GA 1W3SA 1IY6A 2JW6A 1TBNA 2E5RA 4FKDA 2ENZA 1SGYI 3UGLA 3UGIA 2BUSA 1UVFA 3R5AA 1KMAA 7WGAA 2KCXA 1XA6A 4HGUA 5CCMA 2DIPA 2ELIA 2SGPI 1IW4A 2V1CA 1PCEA 1K7VA 2PQ8A 1SGNI 3GOXA 2NU3I 1SGPI 1PPFI 5HI7A 2CWHA 2L8EA 3UGDA 2UZ3A 2WGCA 2CJSC 5DAEA 3TO9A 3TOAA 1TGSI 1Y1CA 1Z2IA 2CWGA 3HH2C 3OXLA 5EX0A 1LR9A 2JYYA 1CGII 1FYBA 1OMTA 2QQDA 3SGBI 2NU0I 3FSXA 5J8FA 1K7TA 2P6AC 1SGQI 2W0TA 3UEJA 3PDNA 2QQEA 2E73A 5FUVA 1R79A 2ARPF 1OVOA 1WGTA 2WCYA 3QAHA 2N71A 1M8CA 1NUBA 3TJQA 3SGQI 2OVOA 2ORVA 1MJBA 1TUSA 2SGDI 3OVOA 2DB6A 5FUWA 1PTQA 1H0ZA 1SGDI 5FUYA 1CE3A 2YQPA 3QTLD 4A24A 1MT1A 2NU1I 1R0RI 1P9ZA 4L9MA 4UXIA 3RU0A 1ULKA 1TIHA 2RIJA 2GVIA 2SGEI 2SGFI 2UVOA 3TO7A 2B8TA 1U5KA 1RFHA 2DKVA 1KBFA
chains in the Genus database with same CATH topology
1TURA 1M8BA 1YU6C 2QQCA 1Z7KB 1N13A 2V53A 3OXGA 2WVJA 2VRWB 1Y8FA 5HQ8A 3UFFA 1FARA 1PJUA 1V1IA 2ENNA 1TBQR 4UXHA 2QPOA 2K9HA 2GKRI 1KBEA 4E1RA 1CT2I 2OD1A 2ROWA 2V1CC 1LR7A 1IY5A 2QQ0A 3BJIA 2ODDA 3OL0A 2KMRA 2N1AB 1LR8A 4SGBI 1OMUA 1TOTA 2GKTI 2XRCA 3D00A 1HJAI 5JHWC 3B4VC 1VDDA 2N17A 1FAQA 2JZMA 1W4RA 1UVGA 2KMPA 3FC3A 1YTPA 1XBTA 4GI3C 1X4SA 3OXFA 4OVOA 2J9RA 2JA1A 3VE5A 1CT4I 1BMOA 1UUCA 2F3CI 3CXLA 3SEKC 3UEYA 1TBOA 1SGRI 1XX6A 1X74A 2NU4I 1DS3I 1PTRA 2A20A 3E2IA 1V1HA 3QWPA 1AN1I 5FUXA 1HPTA 2YUUA 1OYVI 3E59A 2B0UC 5EX3A 1TBRR 2LUYA 2ORWA 2KMOA 4B6DA 2N52A 2L7XA 1Y1BA 1CT0I 3KY9A 3VDPA 2SGQI 2J87A 4E1PA 2LEOA 1CSOI 3VDUA 3MEKA 5CCLA 1HDLA 1DS2I 4UXJA 2KMQA 2GKVA 2NU2I 2JXDA 4JCVE 1BUSA 2FNFX 1SGEI 1CHOI 1CGJI 2M5XA 2ERWA 1W3SA 1IY6A 2JW6A 1TBNA 2E5RA 4FKDA 2ENZA 1SGYI 3UGLA 3UGIA 2BUSA 1UVFA 1KMAA 2KCXA 1XA6A 4HGUA 5CCMA 2DIPA 2ELIA 2SGPI 1IW4A 2V1CA 1PCEA 1SGNI 3GOXA 2NU3I 1SGPI 1PPFI 5HI7A 2L8EA 3UGDA 2UZ3A 2CJSC 5DAEA 1TGSI 1Y1CA 3HH2C 3OXLA 5EX0A 1FYBA 1LR9A 2JYYA 1CGII 1OMTA 2QQDA 3SGBI 2NU0I 2P6AC 1SGQI 2W0TA 3UEJA 3PDNA 2QQEA 2E73A 5FUVA 1R79A 2ARPF 1OVOA 2WCYA 2N71A 1M8CA 1NUBA 3TJQA 3SGQI 2OVOA 2ORVA 3OVOA 1TUSA 2SGDI 2DB6A 5FUWA 1PTQA 1H0ZA 1SGDI 5FUYA 1CE3A 2YQPA 3QTLD 4A24A 1MT1A 2NU1I 1R0RI 4L9MA 4UXIA 3RU0A 1TIHA 2GVIA 2SGEI 2SGFI 2B8TA 1U5KA 1RFHA 1KBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TUR A;  1M8B A;  1YU6 C;  2QQC A;  1Z7K B;  1N13 A;  2V53 A;  1PJU A;  1TBQ R;  2GKR I;  1CT2 I;  1LR7 A;  1IY5 A;  2KMR A;  1LR8 A;  4SGB I;  1OMU A;  2GKT I;  2XRC A;  5JHW C;  1HJA I;  3B4V C;  2N17 A;  2JZM A;  2KMP A;  1UVG A;  1YTP A;  4GI3 C;  4OVO A;  1CT4 I;  1BMO A;  1UUC A;  2F3C I;  3SEK C;  1SGR I;  2NU4 I;  1DS3 I;  1AN1 I;  1HPT A;  1OYV I;  2B0U C;  1TBR R;  2KMO A;  2N52 A;  1Y1B A;  1CT0 I;  2SGQ I;  2LEO A;  1CSO I;  1HDL A;  1DS2 I;  2KMQ A;  2GKV A;  2NU2 I;  2JXD A;  1BUS A;  1SGE I;  1CHO I;  1CGJ I;  2M5X A;  2ERW A;  1IY6 A;  1SGY I;  2BUS A;  1UVF A;  1KMA A;  2KCX A;  4HGU A;  1IW4 A;  2SGP I;  1PCE A;  1SGN I;  2NU3 I;  1SGP I;  1PPF I;  5DAE A;  1TGS I;  1Y1C A;  3HH2 C;  1FYB A;  1LR9 A;  2JYY A;  1CGI I;  1OMT A;  2QQD A;  3SGB I;  2NU0 I;  2P6A C;  1SGQ I;  2ARP F;  1OVO A;  2WCY A;  2N71 A;  1M8C A;  1NUB A;  3TJQ A;  3SGQ I;  2OVO A;  3OVO A;  1TUS A;  2SGD I;  1H0Z A;  1SGD I;  1CE3 A;  3QTL D;  1MT1 A;  2NU1 I;  1R0R I;  1TIH A;  2SGE I;  2SGF I; 
#chains in the Genus database with same CATH topology
 1TUR A;  1M8B A;  2LB7 A;  1YU6 C;  4AML A;  2OZU A;  2QQC A;  1Z7K B;  1N13 A;  4MPI A;  2V53 A;  3OXG A;  2WVJ A;  2VRW B;  1Y8F A;  2CWF A;  4DNC A;  5HQ8 A;  3UFF A;  1ULN A;  1FAR A;  1PJU A;  1V1I A;  2ENN A;  2OU2 A;  1TBQ R;  4UXH A;  2QPO A;  2K9H A;  9WGA A;  5J8C A;  2GKR I;  1KBE A;  4E1R A;  1CT2 I;  1K7U A;  2OD1 A;  2ROW A;  2V1C C;  3FSY A;  1S20 A;  1LR7 A;  2X52 A;  1IY5 A;  2QQ0 A;  1HEV A;  3BJI A;  1MJA A;  2ODD A;  3OL0 A;  1MJ9 A;  2KMR A;  2N1A B;  3UOE A;  3R5C A;  1LR8 A;  1WGC A;  4SGB I;  1OMU A;  1TOT A;  2GKT I;  2XRC A;  1FY7 A;  1HJA I;  3D00 A;  3R5B A;  5JHW C;  3R5D A;  1Q9B A;  1ULM A;  3B4V C;  1VDD A;  2N17 A;  1FAQ A;  2JZM A;  1W4R A;  1UVG A;  2KMP A;  3FC3 A;  1YTP A;  1XBT A;  1WTJ A;  4GI3 C;  1X4S A;  5E3R A;  3OXF A;  4OVO A;  2J9R A;  2JA1 A;  3VE5 A;  1CT4 I;  1BMO A;  1UUC A;  2RC4 A;  5E3P A;  2F3C I;  3CXL A;  3SEK C;  3UEY A;  1TBO A;  1SGR I;  1XX6 A;  1X74 A;  2NU4 I;  1DS3 I;  1PTR A;  2A20 A;  3E2I A;  1V1H A;  3QWP A;  1AN1 I;  2GIV A;  5FUX A;  1HPT A;  3TO6 A;  2YUU A;  1NXU A;  1OYV I;  2X3T A;  3E59 A;  2B0U C;  5EX3 A;  1TBR R;  2LUY A;  2ORW A;  2KMO A;  4B6D A;  1WKX A;  2N52 A;  2Y0M A;  1UHA A;  2L7X A;  1Y1B A;  1CT0 I;  3KY9 A;  3VDP A;  2SGQ I;  2J87 A;  3TOB A;  2LEO A;  4E1P A;  1CSO I;  3VDU A;  3MEK A;  5CCL A;  5E3Q A;  1HDL A;  1DS2 I;  4UXJ A;  2KMQ A;  2GKV A;  2NU2 I;  2JXD A;  4JCV E;  1BUS A;  2FNF X;  1SGE I;  4WP4 A;  1CHO I;  1CGJ I;  2M5X A;  2ERW A;  1P9G A;  1W3S A;  1IY6 A;  2JW6 A;  1TBN A;  2E5R A;  4FKD A;  2ENZ A;  1SGY I;  3UGL A;  3UGI A;  2BUS A;  1UVF A;  3R5A A;  1KMA A;  7WGA A;  2KCX A;  1XA6 A;  4HGU A;  5CCM A;  2DIP A;  2ELI A;  2SGP I;  1IW4 A;  2V1C A;  1PCE A;  1K7V A;  2PQ8 A;  1SGN I;  3GOX A;  2NU3 I;  1SGP I;  1PPF I;  5HI7 A;  2CWH A;  2L8E A;  3UGD A;  2UZ3 A;  2WGC A;  2CJS C;  5DAE A;  3TO9 A;  3TOA A;  1TGS I;  1Y1C A;  1Z2I A;  2CWG A;  3HH2 C;  3OXL A;  5EX0 A;  1LR9 A;  2JYY A;  1CGI I;  1FYB A;  1OMT A;  2QQD A;  3SGB I;  2NU0 I;  3FSX A;  5J8F A;  1K7T A;  2P6A C;  1SGQ I;  2W0T A;  3UEJ A;  3PDN A;  2QQE A;  2E73 A;  5FUV A;  1R79 A;  2ARP F;  1OVO A;  1WGT A;  2WCY A;  3QAH A;  2N71 A;  1M8C A;  1NUB A;  3TJQ A;  3SGQ I;  2OVO A;  2ORV A;  1MJB A;  1TUS A;  2SGD I;  3OVO A;  2DB6 A;  5FUW A;  1PTQ A;  1H0Z A;  1SGD I;  5FUY A;  1CE3 A;  2YQP A;  3QTL D;  4A24 A;  1MT1 A;  2NU1 I;  1R0R I;  1P9Z A;  4L9M A;  4UXI A;  3RU0 A;  1ULK A;  1TIH A;  2RIJ A;  2GVI A;  2SGE I;  2SGF I;  2UVO A;  3TO7 A;  2B8T A;  1U5K A;  1RFH A;  2DKV A;  1KBF A; 
#chains in the Genus database with same CATH homology
 1TUR A;  1M8B A;  1YU6 C;  2QQC A;  1Z7K B;  1N13 A;  2V53 A;  3OXG A;  2WVJ A;  2VRW B;  1Y8F A;  5HQ8 A;  3UFF A;  1FAR A;  1PJU A;  1V1I A;  2ENN A;  1TBQ R;  4UXH A;  2QPO A;  2K9H A;  2GKR I;  1KBE A;  4E1R A;  1CT2 I;  2OD1 A;  2ROW A;  2V1C C;  1LR7 A;  1IY5 A;  2QQ0 A;  3BJI A;  2ODD A;  3OL0 A;  2KMR A;  2N1A B;  1LR8 A;  4SGB I;  1OMU A;  1TOT A;  2GKT I;  2XRC A;  3D00 A;  1HJA I;  5JHW C;  3B4V C;  1VDD A;  2N17 A;  1FAQ A;  2JZM A;  1W4R A;  1UVG A;  2KMP A;  3FC3 A;  1YTP A;  1XBT A;  4GI3 C;  1X4S A;  3OXF A;  4OVO A;  2J9R A;  2JA1 A;  3VE5 A;  1CT4 I;  1BMO A;  1UUC A;  2F3C I;  3CXL A;  3SEK C;  3UEY A;  1TBO A;  1SGR I;  1XX6 A;  1X74 A;  2NU4 I;  1DS3 I;  1PTR A;  2A20 A;  3E2I A;  1V1H A;  3QWP A;  1AN1 I;  5FUX A;  1HPT A;  2YUU A;  1OYV I;  3E59 A;  2B0U C;  5EX3 A;  1TBR R;  2LUY A;  2ORW A;  2KMO A;  4B6D A;  2N52 A;  2L7X A;  1Y1B A;  1CT0 I;  3KY9 A;  3VDP A;  2SGQ I;  2J87 A;  4E1P A;  2LEO A;  1CSO I;  3VDU A;  3MEK A;  5CCL A;  1HDL A;  1DS2 I;  4UXJ A;  2KMQ A;  2GKV A;  2NU2 I;  2JXD A;  4JCV E;  1BUS A;  2FNF X;  1SGE I;  1CHO I;  1CGJ I;  2M5X A;  2ERW A;  1W3S A;  1IY6 A;  2JW6 A;  1TBN A;  2E5R A;  4FKD A;  2ENZ A;  1SGY I;  3UGL A;  3UGI A;  2BUS A;  1UVF A;  1KMA A;  2KCX A;  1XA6 A;  4HGU A;  5CCM A;  2DIP A;  2ELI A;  2SGP I;  1IW4 A;  2V1C A;  1PCE A;  1SGN I;  3GOX A;  2NU3 I;  1SGP I;  1PPF I;  5HI7 A;  2L8E A;  3UGD A;  2UZ3 A;  2CJS C;  5DAE A;  1TGS I;  1Y1C A;  3HH2 C;  3OXL A;  5EX0 A;  1FYB A;  1LR9 A;  2JYY A;  1CGI I;  1OMT A;  2QQD A;  3SGB I;  2NU0 I;  2P6A C;  1SGQ I;  2W0T A;  3UEJ A;  3PDN A;  2QQE A;  2E73 A;  5FUV A;  1R79 A;  2ARP F;  1OVO A;  2WCY A;  2N71 A;  1M8C A;  1NUB A;  3TJQ A;  3SGQ I;  2OVO A;  2ORV A;  3OVO A;  1TUS A;  2SGD I;  2DB6 A;  5FUW A;  1PTQ A;  1H0Z A;  1SGD I;  5FUY A;  1CE3 A;  2YQP A;  3QTL D;  4A24 A;  1MT1 A;  2NU1 I;  1R0R I;  4L9M A;  4UXI A;  3RU0 A;  1TIH A;  2GVI A;  2SGE I;  2SGF I;  2B8T A;  1U5K A;  1RFH A;  1KBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...