2F3CI

Crystal structure of infestin 1, a kazal-type serineprotease inhibitor, in complex with trypsin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
46
structure length
46
Chain Sequence
DCACPRVLHRVCGSDGNTYSNPCTLDCAKHEGKPDLVQVHEGPCDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title The Kazal-type inhibitors infestins 1 and 4 differ in specificity but are similar in three-dimensional structure.
pubmed doi rcsb
source organism Triatoma infestans
molecule tags Hydrolase/hydrolase inhibitor
total genus 14
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2005-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2f3cI00
2BUSA 1CHOI 1N13A 1CT2I 1Z7KB 1YTPA 2GKTI 2V53A 2SGPI 1M8BA 1KMAA 1Y1BA 1HDLA 3TJQA 2JYYA 1IW4A 2KCXA 2F3CI 1PJUA 2NU0I 2GKVA 2KMOA 1SGEI 3HH2C 5DAEA 2OVOA 1UUCA 1IY6A 2SGDI 1SGDI 2M5XA 1CT4I 1TGSI 1BUSA 2NU4I 2WCYA 1TURA 3SGQI 5JHWC 1MT1A 1OYVI 1R0RI 2SGFI 1BMOA 2XRCA 1AN1I 2QQCA 2ERWA 2KMRA 1TBRR 2ARPF 1M8CA 1H0ZA 1TUSA 1PCEA 1SGRI 3B4VC 1CGJI 1LR7A 1HJAI 2KMQA 2JXDA 1DS2I 1SGYI 2SGQI 2QQDA 1TIHA 1PPFI 4HGUA 4GI3C 1SGNI 2N71A 1CGII 2N52A 1SGPI 2KMPA 2NU1I 3QTLD 1UVGA 1YU6C 1OMUA 2SGEI 3OVOA 2N17A 1OMTA 1FYBA 2JZMA 4OVOA 2GKRI 1CE3A 2P6AC 1NUBA 1SGQI 1LR8A 1LR9A 3SEKC 3SGBI 1IY5A 1CSOI 1OVOA 2NU2I 4SGBI 2B0UC 1CT0I 2NU3I 1TBQR 1DS3I 1UVFA 2LEOA 1HPTA 1Y1CA
chains in the Genus database with same CATH superfamily
1W3SA 2BUSA 9WGAA 1CHOI 1KBFA 1N13A 1R79A 2A20A 1CT2I 1Z7KB 3MEKA 1YTPA 2ENZA 2GKTI 2V53A 3E59A 2ORWA 2SGPI 2V1CC 1M8BA 1S20A 2Y0MA 3FC3A 1Y1BA 2J87A 1HDLA 4E1PA 1KMAA 2QQ0A 2W0TA 3TJQA 1FY7A 2JYYA 3R5BA 1WGCA 2KCXA 1IW4A 2F3CI 1PJUA 1KBEA 2PQ8A 1XX6A 1FARA 2NU0I 2X52A 2GIVA 1ULNA 2GKVA 3BJIA 2CJSC 1SGEI 2KMOA 3HH2C 1TBOA 1X74A 5DAEA 1P9GA 1UUCA 2OVOA 2QQEA 2SGDI 1SGDI 7WGAA 1IY6A 2M5XA 1CT4I 3FSYA 1K7UA 1TGSI 5E3QA 4FKDA 3CXLA 3OXLA 1XA6A 3UGIA 2NU4I 1BUSA 2WCYA 5E3PA 1TURA 3OXFA 1PTRA 1TOTA 2ROWA 3SGQI 5JHWC 2DKVA 1U5KA 2OD1A 2LB7A 1MT1A 1OYVI 1R0RI 1WGTA 2SGFI 2ELIA 4A24A 1Y8FA 2UVOA 3UGDA 1BMOA 2WGCA 2XRCA 4B6DA 1AN1I 3UGLA 3R5CA 2QQCA 4JCVE 2ERWA 2DB6A 2K9HA 1XBTA 2KMRA 5E3RA 3VE5A 1TBRR 2ARPF 1K7VA 1M8CA 1UHAA 2OZUA 2QPOA 5FUXA 3TOBA 1H0ZA 1TUSA 1PCEA 5FUVA 3RU0A 3R5AA 2RIJA 1SGRI 3TO6A 3R5DA 1MJ9A 2ODDA 3B4VC 1CGJI 2GVIA 1LR7A 5CCLA 1HJAI 2KMQA 2ORVA 2JXDA 1DS2I 1WKXA 3VDUA 1SGYI 1V1HA 2RC4A 2SGQI 3E2IA 1WTJA 2X3TA 2QQDA 1TIHA 1PPFI 4HGUA 4GI3C 1SGNI 1Q9BA 3UFFA 1ULKA 3UOEA 2N71A 3TO9A 1CGII 2N52A 1SGPI 1MJBA 2KMPA 2NU1I 2JA1A 2CWGA 2N1AB 3OXGA 2CWFA 3QTLD 1UVGA 3D00A 3FSXA 1YU6C 4UXIA 5J8CA 5CCMA 2JW6A 1OMUA 2SGEI 3OVOA 5HI7A 2E73A 5EX3A 1FAQA 2DIPA 2FNFX 2L8EA 2N17A 1OMTA 4UXJA 2JZMA 4OVOA 5FUWA 2OU2A 1FYBA 1Z2IA 2GKRI 1TBNA 1MJAA 2LUYA 3TOAA 2VRWB 2YUUA 2E5RA 1P9ZA 1CE3A 2P6AC 3UEJA 1W4RA 4L9MA 2B8TA 1NUBA 1SGQI 1LR8A 1LR9A 1V1IA 4UXHA 3SEKC 2ENNA 1K7TA 3SGBI 5J8FA 1IY5A 3KY9A 1CSOI 2CWHA 1OVOA 2UZ3A 1RFHA 2J9RA 1X4SA 3VDPA 2NU2I 1NXUA 4SGBI 4DNCA 3QWPA 2B0UC 3PDNA 1CT0I 2NU3I 5EX0A 1TBQR 3OL0A 3UEYA 5HQ8A 3TO7A 4WP4A 2WVJA 1HEVA 3QAHA 1DS3I 1ULMA 1UVFA 3GOXA 2LEOA 1HPTA 4E1RA 2YQPA 5FUYA 4MPIA 1Y1CA 4AMLA 2L7XA 1VDDA 2V1CA 1PTQA
chains in the Genus database with same CATH topology
1W3SA 2BUSA 1CHOI 1KBFA 1N13A 1R79A 2A20A 1CT2I 1Z7KB 3MEKA 1YTPA 2ENZA 2GKTI 2V53A 3E59A 2ORWA 2SGPI 2V1CC 1M8BA 3FC3A 1KMAA 1Y1BA 2J87A 1HDLA 4E1PA 2QQ0A 2W0TA 3TJQA 2JYYA 1IW4A 2KCXA 2F3CI 1PJUA 1KBEA 1XX6A 1FARA 2NU0I 2GKVA 3BJIA 2CJSC 1SGEI 2KMOA 3HH2C 1TBOA 1X74A 5DAEA 2OVOA 1UUCA 1IY6A 2QQEA 2SGDI 1SGDI 2M5XA 1CT4I 1TGSI 4FKDA 3CXLA 3OXLA 1XA6A 3UGIA 2NU4I 1BUSA 2WCYA 1TURA 3OXFA 1PTRA 1TOTA 2ROWA 3SGQI 5JHWC 2OD1A 1U5KA 1MT1A 1OYVI 1R0RI 2SGFI 2ELIA 4A24A 1Y8FA 4B6DA 3UGDA 1BMOA 2XRCA 1AN1I 3UGLA 2QQCA 4JCVE 2ERWA 2DB6A 2K9HA 1XBTA 2KMRA 3VE5A 1TBRR 2ARPF 2QPOA 1M8CA 5FUXA 1H0ZA 1TUSA 1PCEA 5FUVA 3RU0A 1SGRI 2ODDA 3B4VC 1CGJI 2GVIA 1LR7A 5CCLA 1HJAI 2KMQA 2ORVA 2JXDA 1DS2I 3VDUA 1SGYI 1V1HA 3E2IA 2SGQI 2QQDA 1TIHA 1PPFI 4HGUA 4GI3C 1SGNI 3UFFA 2N71A 1CGII 2N52A 1SGPI 2KMPA 2NU1I 2JA1A 2N1AB 3OXGA 3QTLD 1UVGA 3D00A 4UXIA 1YU6C 5CCMA 2JW6A 1OMUA 2SGEI 3OVOA 5HI7A 2E73A 5EX3A 1FAQA 2DIPA 2FNFX 2L8EA 2N17A 1OMTA 4UXJA 2JZMA 4OVOA 5FUWA 1FYBA 2GKRI 1TBNA 2LUYA 2VRWB 2YUUA 2E5RA 1CE3A 2P6AC 3UEJA 1W4RA 4L9MA 2B8TA 1NUBA 1SGQI 1LR8A 1LR9A 1V1IA 4UXHA 3SEKC 2ENNA 3SGBI 1IY5A 3KY9A 1CSOI 1OVOA 2UZ3A 1RFHA 2J9RA 1X4SA 3VDPA 2NU2I 4SGBI 3QWPA 2B0UC 3PDNA 1CT0I 2NU3I 5EX0A 1TBQR 3OL0A 3UEYA 5HQ8A 2WVJA 1DS3I 3GOXA 1UVFA 2LEOA 1HPTA 4E1RA 2YQPA 5FUYA 1Y1CA 2L7XA 1VDDA 2V1CA 1PTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BUS A;  1CHO I;  1N13 A;  1CT2 I;  1Z7K B;  1YTP A;  2GKT I;  2V53 A;  2SGP I;  1M8B A;  1KMA A;  1Y1B A;  1HDL A;  3TJQ A;  2JYY A;  1IW4 A;  2KCX A;  2F3C I;  1PJU A;  2NU0 I;  2GKV A;  2KMO A;  1SGE I;  3HH2 C;  5DAE A;  2OVO A;  1UUC A;  1IY6 A;  2SGD I;  1SGD I;  2M5X A;  1CT4 I;  1TGS I;  1BUS A;  2NU4 I;  2WCY A;  1TUR A;  3SGQ I;  5JHW C;  1MT1 A;  1OYV I;  1R0R I;  2SGF I;  1BMO A;  2XRC A;  1AN1 I;  2QQC A;  2ERW A;  2KMR A;  1TBR R;  2ARP F;  1M8C A;  1H0Z A;  1TUS A;  1PCE A;  1SGR I;  3B4V C;  1CGJ I;  1LR7 A;  1HJA I;  2KMQ A;  2JXD A;  1DS2 I;  1SGY I;  2SGQ I;  2QQD A;  1TIH A;  1PPF I;  4HGU A;  4GI3 C;  1SGN I;  2N71 A;  1CGI I;  2N52 A;  1SGP I;  2KMP A;  2NU1 I;  3QTL D;  1UVG A;  1YU6 C;  1OMU A;  2SGE I;  3OVO A;  2N17 A;  1OMT A;  1FYB A;  2JZM A;  4OVO A;  2GKR I;  1CE3 A;  2P6A C;  1NUB A;  1SGQ I;  1LR8 A;  1LR9 A;  3SEK C;  3SGB I;  1IY5 A;  1CSO I;  1OVO A;  2NU2 I;  4SGB I;  2B0U C;  1CT0 I;  2NU3 I;  1TBQ R;  1DS3 I;  1UVF A;  2LEO A;  1HPT A;  1Y1C A; 
#chains in the Genus database with same CATH topology
 1W3S A;  2BUS A;  9WGA A;  1CHO I;  1KBF A;  1N13 A;  1R79 A;  2A20 A;  1CT2 I;  1Z7K B;  3MEK A;  1YTP A;  2ENZ A;  2GKT I;  2V53 A;  3E59 A;  2ORW A;  2SGP I;  2V1C C;  1M8B A;  1S20 A;  2Y0M A;  3FC3 A;  1Y1B A;  2J87 A;  1HDL A;  4E1P A;  1KMA A;  2QQ0 A;  2W0T A;  3TJQ A;  1FY7 A;  2JYY A;  3R5B A;  1WGC A;  2KCX A;  1IW4 A;  2F3C I;  1PJU A;  1KBE A;  2PQ8 A;  1XX6 A;  1FAR A;  2NU0 I;  2X52 A;  2GIV A;  1ULN A;  2GKV A;  3BJI A;  2CJS C;  1SGE I;  2KMO A;  3HH2 C;  1TBO A;  1X74 A;  5DAE A;  1P9G A;  1UUC A;  2OVO A;  2QQE A;  2SGD I;  1SGD I;  7WGA A;  1IY6 A;  2M5X A;  1CT4 I;  3FSY A;  1K7U A;  1TGS I;  5E3Q A;  4FKD A;  3CXL A;  3OXL A;  1XA6 A;  3UGI A;  2NU4 I;  1BUS A;  2WCY A;  5E3P A;  1TUR A;  3OXF A;  1PTR A;  1TOT A;  2ROW A;  3SGQ I;  5JHW C;  2DKV A;  1U5K A;  2OD1 A;  2LB7 A;  1MT1 A;  1OYV I;  1R0R I;  1WGT A;  2SGF I;  2ELI A;  4A24 A;  1Y8F A;  2UVO A;  3UGD A;  1BMO A;  2WGC A;  2XRC A;  4B6D A;  1AN1 I;  3UGL A;  3R5C A;  2QQC A;  4JCV E;  2ERW A;  2DB6 A;  2K9H A;  1XBT A;  2KMR A;  5E3R A;  3VE5 A;  1TBR R;  2ARP F;  1K7V A;  1M8C A;  1UHA A;  2OZU A;  2QPO A;  5FUX A;  3TOB A;  1H0Z A;  1TUS A;  1PCE A;  5FUV A;  3RU0 A;  3R5A A;  2RIJ A;  1SGR I;  3TO6 A;  3R5D A;  1MJ9 A;  2ODD A;  3B4V C;  1CGJ I;  2GVI A;  1LR7 A;  5CCL A;  1HJA I;  2KMQ A;  2ORV A;  2JXD A;  1DS2 I;  1WKX A;  3VDU A;  1SGY I;  1V1H A;  2RC4 A;  2SGQ I;  3E2I A;  1WTJ A;  2X3T A;  2QQD A;  1TIH A;  1PPF I;  4HGU A;  4GI3 C;  1SGN I;  1Q9B A;  3UFF A;  1ULK A;  3UOE A;  2N71 A;  3TO9 A;  1CGI I;  2N52 A;  1SGP I;  1MJB A;  2KMP A;  2NU1 I;  2JA1 A;  2CWG A;  2N1A B;  3OXG A;  2CWF A;  3QTL D;  1UVG A;  3D00 A;  3FSX A;  1YU6 C;  4UXI A;  5J8C A;  5CCM A;  2JW6 A;  1OMU A;  2SGE I;  3OVO A;  5HI7 A;  2E73 A;  5EX3 A;  1FAQ A;  2DIP A;  2FNF X;  2L8E A;  2N17 A;  1OMT A;  4UXJ A;  2JZM A;  4OVO A;  5FUW A;  2OU2 A;  1FYB A;  1Z2I A;  2GKR I;  1TBN A;  1MJA A;  2LUY A;  3TOA A;  2VRW B;  2YUU A;  2E5R A;  1P9Z A;  1CE3 A;  2P6A C;  3UEJ A;  1W4R A;  4L9M A;  2B8T A;  1NUB A;  1SGQ I;  1LR8 A;  1LR9 A;  1V1I A;  4UXH A;  3SEK C;  2ENN A;  1K7T A;  3SGB I;  5J8F A;  1IY5 A;  3KY9 A;  1CSO I;  2CWH A;  1OVO A;  2UZ3 A;  1RFH A;  2J9R A;  1X4S A;  3VDP A;  2NU2 I;  1NXU A;  4SGB I;  4DNC A;  3QWP A;  2B0U C;  3PDN A;  1CT0 I;  2NU3 I;  5EX0 A;  1TBQ R;  3OL0 A;  3UEY A;  5HQ8 A;  3TO7 A;  4WP4 A;  2WVJ A;  1HEV A;  3QAH A;  1DS3 I;  1ULM A;  1UVF A;  3GOX A;  2LEO A;  1HPT A;  4E1R A;  2YQP A;  5FUY A;  4MPI A;  1Y1C A;  4AML A;  2L7X A;  1VDD A;  2V1C A;  1PTQ A; 
#chains in the Genus database with same CATH homology
 1W3S A;  2BUS A;  1CHO I;  1KBF A;  1N13 A;  1R79 A;  2A20 A;  1CT2 I;  1Z7K B;  3MEK A;  1YTP A;  2ENZ A;  2GKT I;  2V53 A;  3E59 A;  2ORW A;  2SGP I;  2V1C C;  1M8B A;  3FC3 A;  1KMA A;  1Y1B A;  2J87 A;  1HDL A;  4E1P A;  2QQ0 A;  2W0T A;  3TJQ A;  2JYY A;  1IW4 A;  2KCX A;  2F3C I;  1PJU A;  1KBE A;  1XX6 A;  1FAR A;  2NU0 I;  2GKV A;  3BJI A;  2CJS C;  1SGE I;  2KMO A;  3HH2 C;  1TBO A;  1X74 A;  5DAE A;  2OVO A;  1UUC A;  1IY6 A;  2QQE A;  2SGD I;  1SGD I;  2M5X A;  1CT4 I;  1TGS I;  4FKD A;  3CXL A;  3OXL A;  1XA6 A;  3UGI A;  2NU4 I;  1BUS A;  2WCY A;  1TUR A;  3OXF A;  1PTR A;  1TOT A;  2ROW A;  3SGQ I;  5JHW C;  2OD1 A;  1U5K A;  1MT1 A;  1OYV I;  1R0R I;  2SGF I;  2ELI A;  4A24 A;  1Y8F A;  4B6D A;  3UGD A;  1BMO A;  2XRC A;  1AN1 I;  3UGL A;  2QQC A;  4JCV E;  2ERW A;  2DB6 A;  2K9H A;  1XBT A;  2KMR A;  3VE5 A;  1TBR R;  2ARP F;  2QPO A;  1M8C A;  5FUX A;  1H0Z A;  1TUS A;  1PCE A;  5FUV A;  3RU0 A;  1SGR I;  2ODD A;  3B4V C;  1CGJ I;  2GVI A;  1LR7 A;  5CCL A;  1HJA I;  2KMQ A;  2ORV A;  2JXD A;  1DS2 I;  3VDU A;  1SGY I;  1V1H A;  3E2I A;  2SGQ I;  2QQD A;  1TIH A;  1PPF I;  4HGU A;  4GI3 C;  1SGN I;  3UFF A;  2N71 A;  1CGI I;  2N52 A;  1SGP I;  2KMP A;  2NU1 I;  2JA1 A;  2N1A B;  3OXG A;  3QTL D;  1UVG A;  3D00 A;  4UXI A;  1YU6 C;  5CCM A;  2JW6 A;  1OMU A;  2SGE I;  3OVO A;  5HI7 A;  2E73 A;  5EX3 A;  1FAQ A;  2DIP A;  2FNF X;  2L8E A;  2N17 A;  1OMT A;  4UXJ A;  2JZM A;  4OVO A;  5FUW A;  1FYB A;  2GKR I;  1TBN A;  2LUY A;  2VRW B;  2YUU A;  2E5R A;  1CE3 A;  2P6A C;  3UEJ A;  1W4R A;  4L9M A;  2B8T A;  1NUB A;  1SGQ I;  1LR8 A;  1LR9 A;  1V1I A;  4UXH A;  3SEK C;  2ENN A;  3SGB I;  1IY5 A;  3KY9 A;  1CSO I;  1OVO A;  2UZ3 A;  1RFH A;  2J9R A;  1X4S A;  3VDP A;  2NU2 I;  4SGB I;  3QWP A;  2B0U C;  3PDN A;  1CT0 I;  2NU3 I;  5EX0 A;  1TBQ R;  3OL0 A;  3UEY A;  5HQ8 A;  2WVJ A;  1DS3 I;  3GOX A;  1UVF A;  2LEO A;  1HPT A;  4E1R A;  2YQP A;  5FUY A;  1Y1C A;  2L7X A;  1VDD A;  2V1C A;  1PTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...