1BMOA

Bm-40, fs/ec domain pair
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
233
structure length
233
Chain Sequence
PCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BM-40
publication title Crystal structure of a pair of follistatin-like and EF-hand calcium-binding domains in BM-40.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Extracellular module
total genus 71
structure length 233
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
A PF09289 FOLN Follistatin/Osteonectin-like EGF domain
A PF10591 SPARC_Ca_bdg Secreted protein acidic and rich in cysteine Ca binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1bmoA02
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1bmoA01
5I8NA 1SR6B 4WQ3A 2ZN9A 2BBNA 3LK0A 1TBRR 1WDCB 3ZWHA 5I2QA 1KCYA 2NU0I 1MT1A 2EGDA 1QS7A 3EK7A 3WHTB 3SGBI 1NIWA 4PE4A 4PHNA 1CMGA 1RTP1 2BBMA 1LR7A 1YVLA 2OS8B 4Q04A 2PVBA 2BCXA 2AMIA 4DUQA 1ALWA 1C7VA 1K9PA 1TNQA 1S36A 1CFCA 1B1GA 2MBXA 3DD4A 1UHNA 3VRQA 4AQJA 1YU6C 1PSBA 1M8CA 1KQMB 1WLMA 3I5IC 1TNXA 1KFUS 3M0WA 3WNXB 4CFQA 1AJ5A 2AAOA 1F55A 5JHWC 4CFRA 1KFUL 3SG3A 3KF9A 2F2OA 1OOJA 4F0ZB 1KWOB 4YGAA 2H61C 1NCXA 2M1KB 2TN4A 3I5FC 1GGWA 2L2EA 2L5XB 2G9BA 4C0LA 4CIDA 1TNPA 1QLSA 1UURA 1IRJA 2WCEA 2M0RA 2JT8A 3FWBA 1PSRA 2BKIB 4HREE 3OVOA 1H0ZA 4PALA 3OP0A 3I5HC 1JC2A 1K94A 1KK8B 3SIBA 1S6JA 2QACA 3NXAA 1CGII 1HJAI 1SBJA 4YGBB 1IG5A 1TRFA 3GK1A 4WRIA 4GI3C 4L9MA 4ZCUA 4MLWA 4YGEB 4I5KA 3PALA 4NDCA 4XJKB 5HLVA 1DJXA 1XK4C 3DVEA 4N1FA 1L7ZA 1CSOI 1A2XA 3OX5A 3LK1A 1JUOA 2KYFA 1AN1I 2BECA 4FTGA 1F4OA 5F6TA 3PSRA 1PVBA 4GFTA 2KDHA 4U8DA 2A4JA 1M39A 4PCWA 2K0JA 4XYNA 2LE9B 4MZLA 1N65A 2PSRA 3O4YA 1CDLA 3PM8A 2I94A 2ZNEA 5I2LA 1SPYA 5HKZA 2ARPF 1DF0B 2LV7A 3AAKA 1SYMA 3BYAA 1TIHA 3LLEA 3EVUA 2Y5IA 5J3XA 1LA3A 1W7IB 1C07A 3CR2A 4BY5A 1J1EA 1WLZA 1PCEA 2WORA 3FIAA 2F3CI 3CS1A 1CNPA 1SGYI 3CR4X 2LP2A 3DF0B 4MRYA 5DAEA 1NCZA 1K90D 2K7BA 1TCOB 2ZKMX 2MRDA 1YUTA 1CFDA 2JNXA 1UP5A 1SNLA 4WQ2A 1BUSA 3A4UB 4JQ0D 1CB1A 1WY9A 1CKKA 1BOCA 1YTPA 3SG2A 1M46A 3OX6A 2K2FA 2WCBA 3SGQI 4XJKA 1OE9B 2K61A 4PDZA 1AP4A 1CLBA 1KQVA 1L2OB 2WOSA 1BF5A 3HX4A 1B4CA 3BQ3A 2GKTI 2ISDA 1AK8A 2PRUA 1J55A 4M2OA 3KO0A 1DTLA 2EC6B 1RECA 2JU0A 1K2HA 2EHBA 1UHHA 2V53A 3PFVA 1NX1A 2FCEA 1K96A 1FBVA 1PJUA 2LEOA 1BLQA 2JOJA 3FWCA 1BMOA 1OMRA 3BOWB 3C1VA 1F54A 1DF0A 2D8NA 1YVHA 2NU4I 1TTXA 1UWOA 2JULA 4A4CA 2N17A 1QLKA 4GNKB 2JZMA 1EJ3A 1IJ6A 2BCAA 2P6BB 5KTYA 3GK4X 3DF0A 2F8PA 1YR5A 1V1FA 3OB1B 2ERWA 1JFJA 1R6PA 1DGVA 5AANA 3TS5C 4OV2A 1TNWA 4C0JA 2AUCA 1ALVA 2LHLA 1CDPA 2JNFA 1J7QA 4YI9A 5IBWA 1TBQR 2JT3A 1CFFA 1Y1BA 1S3PA 4SGBI 2LMTA 1PRWA 2LVJA 5ER4X 4ETOA 1F70A 2CBLA 2KAVA 2KI6D 3CR5X 4QJ5B 1TN4A 2ZFDA 1ZUZA 2DOQA 3D10A 3KHEA 2BE6A 2OTGC 1IY6A 2SGFI 1SCMB 4HGUA 5G08A 2OS8C 1SL7A 2F2PA 1HT9A 1QASA 5DKQA 1QVIY 1RJVA 1LA0A 1YTZC 2BKHB 3O6BA 2KI4B 2LC5A 3HCMA 2PALA 3BOWA 4HRGA 2KI6C 2KNEA 2GKVA 1LVCD 2NLNA 1SL9A 3SJSA 1KQMC 1NX3A 3PN7B 1S26D 3CZTX 4OVNF 1G8IA 2JZIA 2LUCA 1YURA 1QX2A 1WRZA 1S1EA 3RLZA 4AOMA 1YX7A 1NX0A 3H4SE 2SGEI 1CFPA 2KBMA 5BPJA 2KYCA 1KWOC 2L51A 4MZKA 1KSOA 1M31A 1SGNI 3SG7A 2BL0C 3KPXA 3DVJA 2OPOA 1SGEI 1M63B 1NSHA 4OR9B 3SIAA 3NSIA 1UHIA 2LMUA 5PALA 2QQDA 2HQ8A 3OHMB 2NZ0A 1SK6D 3FS7A 2K7OA 4NDDA 3BUMB 3EVRA 4E68A 2M1UA 3KEVA 1OYVI 1PULA 4MN0A 2WNDA 1S6IA 1QIVA 2F33A 2IS9A 3TUYB 3EK8A 2SGPI 1E8AA 2B1UA 2KOTA 2M7NA 2H2KA 1A4PA 4TNCA 3JVTB 1XVJA 2MAZA 5K89A 2O5GA 4QJ4B 1R2UA 2LAPA 4M2QA 4GGFC 5JJGA 2SCPA 3SG5A 3B4VC 2HETA 1SGRI 2KGRA 2PASA 1Z7KB 1MR8A 3GOFA 2LCPA 2KBIA 2O60A 3WXAA 1CT2I 1UVGA 3D0YB 1HPTA 3WHUB 3O2PA 1H8BA 1OMUA 1RFJA 1BJFA 1PK0D 1XA5A 2BUSA 1DS3I 1U5IB 1K93D 3AKBA 4PE7A 2COLB 1BR1B 4NDBA 2BE4A 3EKHA 1UVFA 2LHIA 2M29A 4MRXA 3E3RA 1LR9A 2JRFA 1MXLC 5CSNA 1TUSA 3LCPC 1Y1AA 1J7RA 2LVKA 2WC8A 3IQQA 1ZOTB 4I5JA 1JBAA 2L0PA 4P2YB 1CT4I 1SW8A 1DJWA 1EH2A 1SGQI 1DJZA 2LLTA 1GQMA 3JTDB 5D69A 2KGBC 1OSAA 2K2AA 2LANA 2M8UA 1H4BA 2N52A 1VRKA 5HKWA 1FW4A 2E30A 4MBEA 1Y6WA 5FYXA 4DRWA 1NWDA 3EKJA 1IJ5A 3RM1A 1DS2I 3CWGA 1X02A 1DGUA 4DCKA 1N0YA 1L2OC 2K8MB 1EL4A 4FQOA 1K9KA 1ZACA 2KAYA 2KQYA 2Y1MA 4PHJA 2OVOA 4ICBA 2EC6C 4MZJA 1RROA 1WRLA 1EG3A 1NCYA 1CMFA 1PPFI 1IGVA 3MSEB 1U5IA 1SGDI 1TGSI 2WCYA 5CPVA 1OZOA 1DT7B 1G4YR 1LXFC 5HLOA 1EXRA 1K95A 1NYAA 3VGOA 4YRUA 1XO5A 2I7AA 2MLEC 1FI6A 2M3WA 4HSZA 2FCDA 1IQ5A 3GK2A 4PHKA 4MVFA 2LNKA 1CHOI 2BCBA 1M45A 1XFXO 1IWQA 2CXJA 2LP3A 4OCIA 4QJ3B 1CDMA 3CGAA 4CPVA 1BU3A 1XFWO 5JOLA 2CTNA 4C0KA 4OKHA 1KSMA 1V1GA 1WRKA 1Q80A 2VRGA 2E6WA 2JXCA 1B7TY 1JF2A 1LKJA 2F3YA 2KMRA 1SR6C 3ZNIA 2KMQA 1CE3A 1FPWA 1OVOA 1OMVA 1QX7A 3EVVA 1WDCC 3BXKA 2N71A 2SGQI 1DJHA 2NCOA 5DKNA 3TDUA 1B7TZ 1Y1UA 2JTZA 1J1DA 1F8HA 1K9UA 3I5GB 5GQQC 1OMTA 1DJGA 2KMPA 5KSZA 1SKTA 1CM1A 2R2IA 4JWQA 1GJYA 1W7JB 1HQVA 1BR4B 1SCMC 4PE1A 1DVIA 4GPLB 4JPZB 2K7CA 3TDIA 2WCFA 1TURA 2M7LA 2JC2A 2M9GA 1CLLA 4I5NB 5KU1A 1K8UA 1YUUA 1OQPA 1B8CA 2KI4C 1MUXA 3SG4A 1QVIZ 1IQ3A 2NU3I 1NPQA 1F71A 1A75B 1QTXA 3AKAA 3DVMA 4HRHA 1BT6A 2MA2A 4AQIA 1QV1A 2JXDA 3VRNA 1Y0VH 2OTGB 3PN7C 4YGDB 5AXIA 5CSJA 2KAXA 1AVSA 1SMGA 1SCVA 1KFXS 3TZ1A 5HYDA 2KSPA 1CDNA 5CSFA 1IKUA 1DJYA 2ZRTA 2MHHA 1B8LA 1KFXL 1BG1A 1ZFSA 3DVKA 1B9AA 1B8RA 3QTLD 4MSPA 2KCXA 3I5IB 2M5XA 1UUSA 1IW4A 1UHJA 1HDLA 2B0UC 3SEKC 1MHOA 1YRTB 1QATA 3NSLA 3TDZA 1FI5A 4GUKA 5CSIA 5ER5A 1XFZO 2MLFC 1DJIA 1NUBA 2GGZA 4MEWA 1SRAA 3BUOB 1KK8C 3I5FB 3EK4A 3IF7A 2XRCA 2KFFA 3NSOA 5AERA 1J7PA 1YUSA 2FOTA 4IL1A 2PMYA 4NQGA 4YGCB 1IY5A 3TUYC 2BL0B 4N5XA 1JF0A 2LUXA 1SGPI 5I2OA 3JVTC 1KK7Y 3PATA 2HF5A 1NP8A 3TJQA 1RK9A 1TOPA 4M2PA 2NU2I 1A75A 1PVAA 1QJTA 1NX2A 3I5HB 3K21A 4OVOA 1CLMA 4PHMA 5B8IB 1KK7Z 2CNPA 1YX8A 2Y1NA 1B47A 2JXLA 1MWNA 1S6CA 4DS7A 1M8BA 1KMAA 2SGDI 2KHNA 1CGJI 4YI8A 4P5OE 2L4IA 4R1EA 1G33A 4BY4A 2RGIA 2LM5A 2GKRI 2GV5A 1JFKA 1XFYO 1EG4A 1CM4A 2LVIA 3LL8B 1OZSA 2NU1I 2L98A 1XFUO 4PE0A 5D7FA 3VRRA 2ZRSA 2JQ6A 2KFGA 2LLSA 1S5GY 2H61A 2SASA 3VROA 1A03A 4GGNA 2HPSA 1QV0A 2I2RE 2MJWB 1CT0I 2F3ZA 3IQOA 3JTDC 1TCFA 1D1OA 4N1GA 2LLUA 2KQ6A 4CLNA 1S5GZ 1SY9A 3A8RA 1MQ1A 1AJ4A 2NCPA 1QXPA 1MXEA 1UHKA 1DMOA 1FYBA 5AFPA 1QX5B 3D0YA 2HQWA 2M97A 1PALA 3BUXB 2FJUB 4D1EA 1TIZA 3BUNB 3SG6A 2G2BA 2M49B 2JWWA 4USLA 3ICBA 1YRUB 2LMVA 1BODA 1XK4A 2CCMA 4ZCVA 2L50A 4ORCB 2QQCA 2Q91A 2LVVA 1RWYA 1A29A 4GGFA 1AUIB 1QIWA 3O78A 3VRPA 1J7OA 1JWDA 5DKRA 4DIRA 1MF8B 1XYDA 2JPTA 3CTNA 3OB2B 2KFHA 3CLNA 2K7DA 1F4QA 1UUCA 1CTRA 1N2DA 2I18A 2ZN8A 1R0RI 4I5LB 5HKYA 1Y1XA 2Q4UA 1GGZA 4A4BA 1LINA 3PLFB 2P6AC 5TNCA 4GBAA 1LR8A 1FF1A 3AAJA 1N13A 1IH0A 4YBHB 1ZMZA 2JT0A 1SL8A 4ORAB 1ODBA 2KMOA 4ORBB 3BUWB 1OMDA 2JYYA 2ZNDA 1AHRA 5AEQA 3HH2C 1Y1CA 1JSAA 1C7WA 2Y4QA 3NSKA 2CT9A 1XFVO 3I5GC 3F45A 2JTTA 3QRXA 3TS5B 2QPTA 2GGMA 4UPGA 4GAOA 2NXQA 2L4HA
chains in the Genus database with same CATH superfamily
1SR6B 1TWOA 3DZTA 4WQ3A 2BBNA 3QWPA 3EK7A 4A24A 1RTP1 4Q04A 1FARA 3VRQA 2ENNA 1YU6C 1KQMB 1WLMA 1X74A 2VRWB 4YGAA 2M1KB 2L2EA 1PSRA 2BKIB 3NXAA 1CGII 1TRFA 1XA6A 4MLWA 3B88A 1XK4C 3DVEA 3R1PA 1A2XA 3TO7A 1JUOA 2KYFA 3B6XA 4FKDA 2LB7A 1RFHA 2KDHA 2A4JA 1WGTA 2OD1A 1N65A 3PM8A 4IJ7A 2I94A 2QEOA 3BYAA 3EVUA 5J3XA 1LA3A 3IVTA 5J8CA 1SGYI 2LP2A 2ORWA 3UGDA 1SNLA 1CB1A 3OX6A 4UXIA 2WCBA 1AP4A 1W9ZA 1KQVA 2GKTI 4M2OA 2EC6B 1UHHA 2V53A 1NX1A 1K96A 2LEOA 3BFBA 1BMOA 1DF0A 1YVHA 1TTXA 1UWOA 4A4CA 2QPOA 5HI7A 3OB1B 1R6PA 3EG5B 2ERBA 1ALVA 2LHLA 1J7QA 2W0TA 4YI9A 5IBWA 1CFFA 2LVJA 3Q8IA 4ETOA 3CZ0A 2KAVA 2KI6D 4QJ5B 1DQEA 1TN4A 2ZFDA 3D10A 2SGFI 1SCMB 2KLDA 2OS8C 1SL7A 1QASA 5DKQA 2BKHB 3BOWA 1LVCD 2NLNA 1NX3A 1S26D 3H4SE 5BPJA 1KSOA 1QWVA 2K60A 3DVJA 2OPOA 1SGEI 3SIAA 3NSIA 3OHMB 2NZ0A 3EVRA 1K7TA 2M1UA 5FI6A 2SGPI 2B1UA 2MAZA 2O5GA 1R2UA 4M2QA 5JJGA 1SGRI 3FSYA 2LCPA 3WXAA 2PQ8A 3O2PA 1H8BA 1RFJA 1BJFA 3BFHA 2COLB 4NDBA 2M29A 4MRXA 4FQTA 2JRFA 5CSNA 3CYZA 3R5DA 1J7RA 4I5JA 1ZOTB 5FUWA 2L5YA 1DJWA 1VRKA 5HKWA 1FW4A 4MBEA 4DRWA 3EKJA 1TBOA 1DGUA 2WCHA 3PM2A 1L2OC 2K8MB 1EL4A 1IIOA 1RROA 1NCYA 1SGDI 3MSEB 3RU0A 1EXRA 1FY7A 2I7AA 2X3TA 1IQ5A 2BCBA 3B87A 3QAHA 2CTNA 1V1GA 1ULNA 1B7TY 1SR6C 3ZNIA 2KMQA 1OVOA 3EVVA 2N71A 3I5GB 2KMPA 5KSZA 1GJYA 1HQVA 4GPLB 2M9GA 1B8CA 3SG4A 2QEHA 1NPQA 1QTXA 4HRHA 1BT6A 4AQIA 5HL1A 3PN7C 2KAXA 2WC6A 1SCVA 2WCMA 5HYDA 5CSFA 1IKUA 3SS5A 2ZRTA 3K1EA 3L4LA 5DICA 2B0UC 1YRTB 4E1PA 5ER5A 1XFZO 4MEWA 1OW4A 1YUSA 4YGCB 2PMYA 2BL0B 2LUXA 2CWFA 3R1OA 3JVTC 2HF5A 1NP8A 5D3OA 1A75A 1NX2A 4OVOA 5B8IB 1MJ9A 4UXHA 2FJYA 1B47A 1MWNA 4DS7A 1KMAA 1CGJI 1PTQA 3SS3A 2LVIA 1WKXA 2L98A 1W3SA 5D7FA 2LLSA 2H61A 2SASA 3VDPA 4N1GA 2WC5A 1SY9A 2NCPA 3D76A 2H8VA 3D77A 2FJUB 3BUNB 2BAPA 2J9RA 3SG6A 2JWWA 2LMVA 1SSEB 2L50A 1RWYA 3O78A 3CTNA 2DIPA 2BNXA 1UUCA 1N2DA 2ZN8A 1Y1XA 4A4BA 1LINA 3PLFB 3AAJA 1IH0A 1ZMZA 3L47A 1HEVA 4ORAB 1XFVO 3S0FA 2JTTA 2CWHA 4UPGA 2NXQA 2L4HA 2CWGA 5I8NA 3LK0A 4PT1A 1NIWA 1CMGA 2BBMA 2K9HA 2OS8B 2PVBA 2AMIA 1ULMA 1K9PA 3S0GA 1TNXA 1KFUS 3M0WA 4CFQA 1F55A 3SG3A 3KF9A 4F0ZB 2H61C 2TN4A 1GGWA 2OU2A 2L5XB 2G9BA 3OXLA 2WCEA 3OVOA 1KK8B 3CZ2A 3D74A 1S6JA 3SIBA 2GTEA 1IG5A 3GK1A 5FUYA 1ORGA 4L9MA 4YGEB 4NDCA 1DJXA 4N1FA 1L7ZA 2BECA 1F4OA 3DY9A 5E3QA 4U8DA 1C3ZA 4PCWA 2L8EA 2PSRA 3R5CA 5I2LA 1SPYA 5HKZA 1DF0B 1T14A 3AAKA 1TIHA 1C07A 2Y5IA 1WLZA 2WORA 2F3CI 3CS1A 3TOAA 1NCZA 1K90D 2ZKMX 1YUTA 3TO9A 1BUSA 3A4UB 1CKKA 2K61A 1L2OB 2WOSA 1B4CA 5FUXA 1OOGA 2PRUA 3KO0A 4JD9A 2ODDA 2EHBA 3E2IA 2JOJA 1OMRA 3BOWB 3C1VA 1F54A 3FC3A 2D8NA 2JULA 2E5RA 2N17A 1QLKA 4GNKB 1IJ6A 3DF0A 2AUCA 3VDUA 1TBNA 1ZUZA 2DOQA 1RJVA 3HCMA 3R1VA 1SL9A 1MJAA 3PN7B 3CZTX 1G8IA 1YURA 1S1EA 2SGEI 3DXLA 3MEKA 2L51A 2BL0C 3KPXA 1NSHA 2DKVA 1UHIA 5PALA 2QQDA 2X52A 1SK6D 3BUMB 4E68A 3UNWA 1PULA 1QIVA 3VE5A 2F33A 2IS9A 2M7NA 3JVTB 2HETA 2PASA 1MR8A 1CT2I 4PE7A 3BJIA 3EKHA 1UVFA 3FE9A 1LR9A 1TUSA 3LCPC 1JBAA 1CT4I 1SW8A 5D69A 2LANA 2N52A 1Y6WA 1IJ5A 2YQPA 1X02A 3FSXA 1K9KA 1ZACA 2Y1MA 4PHJA 1PPFI 1U5IA 2WCYA 1G4YR 1NYAA 3GK2A 4PHKA 1CHOI 1M45A 1IWQA 4OCIA 3CGAA 1BU3A 1XFWO 1WRKA 1Q80A 1DELA 1JF2A 2F3YA 1CE3A 1OMVA 5FI7A 1DJHA 5DKNA 1Y1UA 1DJGA 1SKTA 2R2IA 1TOTA 4PE1A 4JPZB 3TDIA 1TURA 2WGCA 5KU1A 1OQPA 2RC4A 1MUXA 2NU3I 5E3RA 2QDIA 1A75B 3AKAA 2JXDA 1QV1A 1Y0VH 2QQEA 1KFXS 3TZ1A 1CDNA 1B8LA 1ZFSA 1B9AA 4MSPA 2KCXA 2RIJA 3O4XA 1IW4A 1UHJA 1MHOA 2N1AB 3OL0A 4GUKA 5CSIA 2MLFC 3D78A 3BUOB 1KK8C 2J87A 3IF7A 2XRCA 2KFFA 4IL1A 2NU2I 1QJTA 3K21A 1CLMA 4PHMA 1KK7Z 5I94A 1S6CA 2SGDI 2JW6A 2L4IA 4R1EA 4BY4A 2LM5A 2GV5A 1PTRA 3NHTA 3LL8B 1NXUA 4PE0A 3VRRA 2ZRSA 2I2RE 1TCFA 4DNCA 2LLUA 1XBTA 1S5GZ 5EX0A 1QXPA 1MXEA 1FYBA 5AFPA 1QX5B 4D1EA 2FNFX 1TIZA 5EL2A 3QMEA 2G2BA 3ICBA 2CCMA 5CCLA 2Q91A 4GGFA 3VRPA 7WGAA 5DKRA 3R5BA 3CABA 1XYDA 3CLNA 2K7DA 1F4QA 1R0RI 5HKYA 5TNCA 5FUVA 1LR8A 1FF1A 4UXJA 2JYYA 3BUWB 1OMDA 1AHRA 5AEQA 2WCKA 3QRXA 1Z2CB 3B86A 2ZN9A 1TBRR 1WDCB 3ZWHA 1KCYA 2NU0I 1MT1A 2EGDA 3S0BA 4B6DA 1S36A 1CFCA 3DD4A 1M8CA 2DB6A 1AJ5A 2QQ0A 2F2OA 1OOJA 3I5FC 4E1RA 4CIDA 1TNPA 2L7XA 1QLSA 1IRJA 2M0RA 3FWBA 4HREE 1H0ZA 4PALA 3OP0A 4YGBB 3SS4A 4WRIA 4GI3C 1CSOI 3OX5A 3LK1A 4GFTA 1M39A 2LE9B 4MZLA 3O4YA 2ZNEA 2ARPF 1SYMA 3LLEA 1W7IB 4BY5A 1J1EA 2YGUA 1PCEA 3CR4X 3DF0B 1Z4HA 3TOBA 1CFDA 2JNXA 4WQ2A 9WGAA 4JQ0D 1YTPA 3SG2A 1M46A 1FAQA 3SGQI 4XJKA 4PDZA 1BF5A 3BQ3A 2PYQA 2ISDA 1J55A 1Y8FA 1DTLA 1RECA 2JU0A 5CCMA 3PFVA 2FCEA 1FBVA 3PJIA 2UZ3A 2BCAA 2F8PA 1V1FA 1JFJA 5AANA 4C0JA 1TNWA 1CDPA 1Y1BA 2JT3A 1S3PA 4SGBI 3OGNA 2LMTA 1PRWA 2CBLA 3KHEA 2BE6A 1LA0A 2KPHA 3O6BA 2LC5A 4HRGA 2GKVA 3SJSA 4OVNF 2JZIA 3RLZA 4AOMA 1YX7A 1NX0A 2B8TA 2KBMA 3S0AA 2KYCA 1KWOC 3R72A 4MZKA 3SG7A 1M63B 1V1HA 3FS7A 3KEVA 1OYVI 3EK8A 2KOTA 1K7VA 2H2KA 1A4PA 4TNCA 3FE8A 4QJ4B 3UEJA 3D00A 1UVGA 3WHUB 1PK0D 2BUSA 1DS3I 1U5IB 1K93D 1V1IA 2WCLA 2BE4A 3E3RA 2QEBA 2WC8A 3IQQA 3CZ1A 3UFFA 1EH2A 1DJZA 2LLTA 2KGBC 1OSAA 2M8UA 3NHIA 2E30A 5FYXA 1UHAA 3RM1A 1DS2I 3CWGA 1N0YA 2KQYA 2OVOA 4ICBA 4MZJA 1EG3A 3S0EA 5CPVA 1LXFC 4YRUA 3VGOA 1XO5A 2ROWA 1XFXO 2CXJA 2LP3A 4QJ3B 1CDMA 5JOLA 2VRGA 2JXCA 1VDDA 1FPWA 1Z2IA 1QX7A 1WDCC 1B7TZ 2JTZA 1W7JB 1DVIA 2M7LA 1K8UA 2KI4C 1QVIZ 1F71A 3UO9A 3DVMA 2OTGB 5CSJA 1DJYA 1BG1A 3QTLD 1UUSA 3SEKC 3NSLA 3TDZA 1FI5A 4WP4A 4INWA 1NUBA 3I5FB 3EK4A 3NSOA 5AERA 1XX6A 4NQGA 3TUYC 5I2OA 3PATA 1W4RA 5FI2A 1RK9A 1TOPA 4M2PA 1KBEA 2QEVA 1PVAA 2CNPA 2JXLA 1M8BA 1P28A 2KHNA 1Q9BA 4P5OE 2RGIA 2GKRI 1XFYO 1EG4A 2NU1I 5HQ8A 5J8FA 1XFUO 3BFAA 3VROA 1A03A 4GGNA 2HPSA 2F3ZA 2L2CA 3JTDC 3N7HA 2E73A 4CLNA 3A8RA 1DMOA 3UEYA 2M97A 1PALA 2YUUA 1YRUB 2GIVA 1A29A 1QIWA 4DIRA 3E59A 3PDNA 3D73A 1CTRA 2I18A 1GGZA 2V1CA 3UOEA 4GBAA 1LS8A 4YBHB 1WTJA 2JT0A 1SL8A 2ZNDA 1Y1CA 3NSKA 2CT9A 3F45A 2Y0MA 2GGMA 4GAOA 3VB1A 5I2QA 1QS7A 3WHTB 3SGBI 4PE4A 4PHNA 1LR7A 1YVLA 2BCXA 4DUQA 1ALWA 1C7VA 1TNQA 1B1GA 2A20A 2MBXA 1UHNA 3S0DA 4AQJA 1PSBA 1K7UA 3I5IC 3WNXB 2AAOA 5JHWC 4CFRA 1KFUL 1KWOB 1NCXA 3B7AA 4C0LA 1UURA 2JT8A 3I5HC 1TUZA 1K94A 1JC2A 2QACA 1HJAI 1SBJA 4ZCUA 2P70A 3DYEA 3PALA 4I5KA 4XJKB 5HLVA 1AN1I 4FTGA 3FE6A 5F6TA 3PSRA 1MJBA 1PVBA 4XYNA 2K0JA 3L4AA 1WGCA 1CDLA 2V1CC 2LV7A 2PQLA 1P9GA 1P9ZA 3CR2A 1DC1A 3FIAA 1CNPA 4MRYA 5DAEA 2K7BA 1TCOB 2MRDA 1UP5A 1WY9A 1BOCA 2K2FA 1OE9B 1CLBA 3HX4A 1AK8A 2UVOA 1K2HA 1PJUA 3TO6A 1BLQA 3FWCA 4F7FA 2NU4I 2JZMA 1EJ3A 2P6BB 5KTYA 3GK4X 1YR5A 2ERWA 1DGVA 3TS5C 4OV2A 2JNFA 1TBQR 5ER4X 1ULKA 1F70A 3CR5X 2ORVA 2OTGC 1IY6A 1X4SA 4HGUA 2P71A 5G08A 2F2PA 1HT9A 1QVIY 1YTZC 1DEKA 2KI4B 2PALA 1OOFA 2KI6C 2KNEA 1KQMC 3UGLA 2LUCA 1QX2A 1WRZA 2JA1A 1CFPA 1M31A 1SGNI 4OR9B 1OOIX 2LUYA 2LMUA 2HQ8A 2K7OA 4NDDA 4MN0A 2WNDA 1S6IA 3TUYB 1E8AA 3OXFA 1XVJA 5K89A 2KLEA 2LAPA 4GGFC 2SCPA 3SG5A 2OZUA 3B4VC 4OZDA 2KGRA 1Z7KB 3GOFA 2KBIA 2O60A 3D0YB 1HPTA 1OMUA 1XA5A 1R79A 3AKBA 1BR1B 2LHIA 1MXLC 1Y1AA 2LVKA 3KY9A 2L0PA 4P2YB 1SGQI 4AMLA 1GQMA 3JTDB 2K2AA 1KBFA 1H4BA 1NWDA 4DCKA 4FQOA 2KAYA 2EC6C 1WRLA 1CMFA 1IGVA 1TGSI 1XFRA 1OZOA 1DT7B 5HLOA 1K95A 2MLEC 1FI6A 2M3WA 4HSZA 2FCDA 4MVFA 2LNKA 3NGVA 4CPVA 4C0KA 4OKHA 1S20A 1KSMA 2E6WA 1LKJA 4JCVE 1OOHA 3R5AA 2KMRA 3BJHA 2SGQI 3BXKA 2NCOA 3TDUA 1F8HA 1J1DA 1K9UA 5GQQC 1OMTA 1CM1A 4JWQA 3GOXA 1BR4B 1SCMC 2K7CA 4INXA 2WCFA 2JC2A 2WCJA 1CLLA 4I5NB 1IQ3A 1YUUA 3V2LA 2MA2A 3VRNA 4YGDB 5AXIA 1AVSA 1SMGA 2KSPA 2MHHA 5E3PA 1KFXL 3DVKA 1B8RA 3I5IB 2M5XA 1HDLA 2JPOA 1C3YA 3D75A 3OBVA 1QATA 3UGIA 3RZSA 1DJIA 2GGZA 1SRAA 1J7PA 2FOTA 1IY5A 4N5XA 3CXLA 1JF0A 1SGPI 1KK7Y 3TJQA 1GM0A 3I5HB 4JKTA 1YX8A 2Y1NA 4YI8A 1G33A 2GVIA 1JFKA 1CM4A 3OXGA 1OZSA 2JQ6A 2KFGA 1S5GY 5EX3A 1CT0I 1QV0A 2MJWB 3IQOA 1D1OA 2KQ6A 1MQ1A 1AJ4A 1UHKA 1U5KA 3D0YA 2HQWA 3BUXB 2M49B 4USLA 1BODA 1XK4A 4ZCVA 4ORCB 2QQCA 2LVVA 1AUIB 1J7OA 1JWDA 2ELIA 1MF8B 2JPTA 3OB2B 2KFHA 4MPIA 2WVJA 4I5LB 2P6AC 2Q4UA 3CDNA 1N13A 4KYNA 1ODBA 2KMOA 2CJSC 4ORBB 3HH2C 1JSAA 1C7WA 2Y4QA 2ENZA 3I5GC 3TS5B 2QPTA 1TUJA
chains in the Genus database with same CATH topology
5I8NA 1SR6B 4WQ3A 2ZN9A 2BBNA 3LK0A 1TBRR 1WDCB 3ZWHA 5I2QA 1KCYA 2NU0I 1MT1A 2EGDA 3QWPA 1QS7A 3EK7A 3WHTB 3SGBI 1NIWA 4PE4A 4PHNA 1CMGA 1RTP1 4A24A 2BBMA 1LR7A 2K9HA 1YVLA 2OS8B 4Q04A 2PVBA 2BCXA 2AMIA 4DUQA 1ALWA 1C7VA 1K9PA 1TNQA 4B6DA 1S36A 1CFCA 1B1GA 1FARA 2A20A 2MBXA 3DD4A 1UHNA 3VRQA 2ENNA 4AQJA 1YU6C 1PSBA 1M8CA 1KQMB 1WLMA 3I5IC 1TNXA 1KFUS 1X74A 2DB6A 3M0WA 3WNXB 4CFQA 1AJ5A 2AAOA 1F55A 5JHWC 4CFRA 2QQ0A 1KFUL 3SG3A 3KF9A 2F2OA 1OOJA 4F0ZB 2VRWB 1KWOB 4YGAA 2H61C 1NCXA 2M1KB 2TN4A 3I5FC 1GGWA 2L2EA 2L5XB 2G9BA 4C0LA 4CIDA 4E1RA 1TNPA 2L7XA 3OXLA 1QLSA 1UURA 1IRJA 2WCEA 2M0RA 2JT8A 3FWBA 1PSRA 2BKIB 4HREE 3OVOA 1H0ZA 4PALA 3OP0A 3I5HC 1JC2A 1K94A 1KK8B 3SIBA 1S6JA 2QACA 3NXAA 1CGII 1HJAI 1SBJA 4YGBB 1IG5A 1TRFA 3GK1A 1XA6A 5FUYA 4WRIA 4GI3C 4L9MA 4ZCUA 4MLWA 4YGEB 4I5KA 3PALA 4NDCA 4XJKB 5HLVA 1DJXA 1XK4C 3DVEA 4N1FA 1L7ZA 1CSOI 1A2XA 3OX5A 3LK1A 1JUOA 2KYFA 1AN1I 2BECA 4FTGA 4FKDA 1F4OA 5F6TA 3PSRA 1PVBA 1RFHA 4GFTA 2KDHA 4U8DA 2A4JA 1M39A 4PCWA 2K0JA 4XYNA 2L8EA 2OD1A 2LE9B 4MZLA 1N65A 2PSRA 3O4YA 1CDLA 3PM8A 2I94A 2ZNEA 2V1CC 5I2LA 1SPYA 5HKZA 2ARPF 1DF0B 2LV7A 3AAKA 1SYMA 3BYAA 1TIHA 3LLEA 3EVUA 2Y5IA 5J3XA 1LA3A 1W7IB 1C07A 3CR2A 4BY5A 1J1EA 1WLZA 1PCEA 2WORA 3FIAA 2F3CI 3CS1A 1CNPA 1SGYI 3CR4X 2LP2A 3DF0B 4MRYA 5DAEA 1NCZA 1K90D 2K7BA 1TCOB 2ZKMX 2ORWA 2MRDA 3UGDA 1YUTA 1CFDA 2JNXA 1UP5A 1SNLA 4WQ2A 1BUSA 3A4UB 4JQ0D 1CB1A 1WY9A 1CKKA 1BOCA 1YTPA 3SG2A 1M46A 1FAQA 3OX6A 2K2FA 4UXIA 2WCBA 3SGQI 4XJKA 1OE9B 2K61A 4PDZA 1AP4A 1CLBA 1KQVA 1L2OB 2WOSA 1BF5A 3HX4A 1B4CA 3BQ3A 2GKTI 5FUXA 2ISDA 1AK8A 2PRUA 1J55A 4M2OA 3KO0A 1DTLA 1Y8FA 2EC6B 2ODDA 1RECA 2JU0A 1K2HA 5CCMA 2EHBA 1UHHA 2V53A 3PFVA 3E2IA 1NX1A 2FCEA 1K96A 1FBVA 1PJUA 2LEOA 1BLQA 2JOJA 3FWCA 1BMOA 1OMRA 3BOWB 3C1VA 1F54A 1DF0A 3FC3A 2D8NA 1YVHA 2NU4I 1TTXA 1UWOA 2JULA 4A4CA 2E5RA 1QLKA 4GNKB 2N17A 2JZMA 1EJ3A 2QPOA 1IJ6A 2UZ3A 2BCAA 2P6BB 5KTYA 5HI7A 3GK4X 3DF0A 2F8PA 1YR5A 1V1FA 3OB1B 2ERWA 1JFJA 1R6PA 1DGVA 5AANA 3TS5C 4OV2A 1TNWA 4C0JA 2AUCA 1ALVA 2LHLA 1CDPA 2JNFA 1J7QA 4YI9A 2W0TA 3VDUA 5IBWA 1TBQR 2JT3A 1CFFA 1Y1BA 1S3PA 4SGBI 2LMTA 1PRWA 2LVJA 5ER4X 4ETOA 1F70A 2CBLA 2KAVA 2KI6D 3CR5X 4QJ5B 1TBNA 1TN4A 2ORVA 3GOXA 2ZFDA 1ZUZA 2DOQA 3D10A 3KHEA 2BE6A 2OTGC 1IY6A 2SGFI 1X4SA 1SCMB 4HGUA 5G08A 2OS8C 1SL7A 2F2PA 1HT9A 1QASA 5DKQA 1QVIY 1RJVA 1LA0A 1YTZC 2BKHB 3O6BA 2KI4B 2LC5A 3HCMA 2PALA 3BOWA 4HRGA 2KI6C 2KNEA 2GKVA 1LVCD 2NLNA 1SL9A 3SJSA 1KQMC 1NX3A 3PN7B 1S26D 3UGLA 3CZTX 4OVNF 1G8IA 2JZIA 2LUCA 1YURA 1QX2A 1WRZA 1S1EA 3RLZA 4AOMA 2JA1A 1YX7A 1NX0A 3H4SE 2B8TA 2SGEI 3MEKA 1CFPA 2KBMA 5BPJA 2KYCA 1KWOC 2L51A 4MZKA 1KSOA 1M31A 1SGNI 3SG7A 2BL0C 3KPXA 3DVJA 2OPOA 1SGEI 1M63B 1NSHA 4OR9B 3SIAA 1V1HA 3NSIA 2LUYA 1UHIA 2LMUA 5PALA 2QQDA 2HQ8A 3OHMB 2NZ0A 1SK6D 3FS7A 2K7OA 4NDDA 3BUMB 3EVRA 4E68A 2M1UA 3KEVA 1OYVI 1PULA 4MN0A 2WNDA 1S6IA 1QIVA 3VE5A 2F33A 2IS9A 3TUYB 3EK8A 2SGPI 1E8AA 2B1UA 2KOTA 2M7NA 2H2KA 3OXFA 1A4PA 4TNCA 3JVTB 1XVJA 2MAZA 5K89A 2O5GA 4QJ4B 1R2UA 2LAPA 4M2QA 4GGFC 5JJGA 2SCPA 3SG5A 3B4VC 2HETA 1SGRI 2KGRA 2PASA 1Z7KB 3UEJA 1MR8A 3D00A 3GOFA 2LCPA 2KBIA 2O60A 3WXAA 1CT2I 1UVGA 3D0YB 1HPTA 3WHUB 3O2PA 1H8BA 1OMUA 1RFJA 1BJFA 1PK0D 1XA5A 2BUSA 1DS3I 1R79A 1U5IB 1K93D 3AKBA 4PE7A 2COLB 1V1IA 1BR1B 4NDBA 3BJIA 2BE4A 3EKHA 1UVFA 2LHIA 2M29A 4MRXA 3E3RA 1LR9A 2JRFA 1MXLC 5CSNA 1TUSA 3LCPC 1Y1AA 1J7RA 2LVKA 2WC8A 3IQQA 1ZOTB 4I5JA 3UFFA 5FUWA 3KY9A 1JBAA 2L0PA 4P2YB 1CT4I 1SW8A 1DJWA 1EH2A 1SGQI 1DJZA 2LLTA 1GQMA 3JTDB 5D69A 2KGBC 1OSAA 2K2AA 2LANA 2M8UA 1KBFA 1H4BA 2N52A 1VRKA 5HKWA 1FW4A 2E30A 4MBEA 1Y6WA 5FYXA 4DRWA 1NWDA 3EKJA 1IJ5A 1TBOA 3RM1A 1DS2I 3CWGA 2YQPA 1X02A 1DGUA 4DCKA 1N0YA 1L2OC 2K8MB 1EL4A 4FQOA 1K9KA 1ZACA 2KAYA 2KQYA 2Y1MA 4PHJA 2OVOA 4ICBA 2EC6C 4MZJA 1RROA 1WRLA 1EG3A 1NCYA 1CMFA 1PPFI 1IGVA 3MSEB 1U5IA 1SGDI 1TGSI 2WCYA 3RU0A 5CPVA 1OZOA 1DT7B 1G4YR 1LXFC 5HLOA 1EXRA 1K95A 1NYAA 3VGOA 4YRUA 1XO5A 2I7AA 2MLEC 1FI6A 2M3WA 4HSZA 2FCDA 1IQ5A 3GK2A 4PHKA 4MVFA 2LNKA 1CHOI 2ROWA 2BCBA 1M45A 1XFXO 1IWQA 2CXJA 2LP3A 4OCIA 4QJ3B 1CDMA 3CGAA 4CPVA 1BU3A 1XFWO 5JOLA 2CTNA 4C0KA 4OKHA 1KSMA 1V1GA 1WRKA 1Q80A 2VRGA 2E6WA 2JXCA 1B7TY 1JF2A 1LKJA 1VDDA 4JCVE 2F3YA 2KMRA 1SR6C 3ZNIA 2KMQA 1CE3A 1FPWA 1OVOA 1OMVA 1QX7A 3EVVA 1WDCC 3BXKA 2N71A 2SGQI 1DJHA 2NCOA 5DKNA 3TDUA 1B7TZ 1Y1UA 2JTZA 1J1DA 1F8HA 1K9UA 3I5GB 5GQQC 1OMTA 1DJGA 2KMPA 5KSZA 1SKTA 1CM1A 2R2IA 4JWQA 1GJYA 1W7JB 1HQVA 1BR4B 1SCMC 4PE1A 1DVIA 1TOTA 4GPLB 4JPZB 2K7CA 3TDIA 2WCFA 1TURA 2M7LA 2JC2A 2M9GA 1CLLA 4I5NB 5KU1A 1K8UA 1YUUA 1OQPA 1B8CA 2KI4C 1MUXA 3SG4A 1QVIZ 1IQ3A 2NU3I 1NPQA 1F71A 1A75B 1QTXA 3AKAA 3DVMA 4HRHA 1BT6A 2MA2A 4AQIA 1QV1A 2JXDA 3VRNA 1Y0VH 2OTGB 3PN7C 4YGDB 5AXIA 5CSJA 2KAXA 1AVSA 2QQEA 1SMGA 1SCVA 1KFXS 3TZ1A 5HYDA 2KSPA 1CDNA 5CSFA 1IKUA 1DJYA 2ZRTA 2MHHA 1B8LA 1KFXL 1BG1A 1ZFSA 3DVKA 1B9AA 1B8RA 3QTLD 4MSPA 2KCXA 3I5IB 2M5XA 1UUSA 1IW4A 1UHJA 1HDLA 2B0UC 3SEKC 1MHOA 1YRTB 1QATA 3NSLA 2N1AB 3OL0A 3TDZA 3UGIA 1FI5A 4GUKA 5CSIA 4E1PA 5ER5A 1XFZO 2MLFC 1DJIA 1NUBA 2GGZA 4MEWA 1SRAA 3BUOB 1KK8C 3I5FB 2J87A 3EK4A 3IF7A 2XRCA 2KFFA 3NSOA 5AERA 1J7PA 1YUSA 2FOTA 4IL1A 2PMYA 4NQGA 4YGCB 1XX6A 3TUYC 1IY5A 2BL0B 4N5XA 3CXLA 1JF0A 2LUXA 1SGPI 5I2OA 3JVTC 1KK7Y 3PATA 2HF5A 1NP8A 1W4RA 3TJQA 1RK9A 1TOPA 4M2PA 1KBEA 1A75A 2NU2I 1PVAA 1QJTA 1NX2A 3I5HB 3K21A 4OVOA 1CLMA 4PHMA 5B8IB 1KK7Z 2CNPA 4UXHA 1YX8A 2Y1NA 1B47A 2JXLA 1MWNA 1S6CA 4DS7A 1M8BA 1KMAA 2SGDI 2KHNA 1CGJI 4YI8A 2JW6A 4P5OE 2L4IA 4R1EA 1PTQA 1G33A 4BY4A 2RGIA 2LM5A 2GKRI 2GV5A 2GVIA 1JFKA 1XFYO 1EG4A 1CM4A 2LVIA 1PTRA 3OXGA 3LL8B 1OZSA 2NU1I 5HQ8A 2L98A 1W3SA 1XFUO 4PE0A 5D7FA 3VRRA 2ZRSA 2JQ6A 2KFGA 2LLSA 1S5GY 2H61A 2SASA 3VROA 1A03A 4GGNA 5EX3A 2HPSA 1QV0A 2I2RE 2MJWB 1CT0I 2F3ZA 3IQOA 3JTDC 1TCFA 1D1OA 3VDPA 4N1GA 2LLUA 1XBTA 2KQ6A 2E73A 4CLNA 1S5GZ 1SY9A 3A8RA 1MQ1A 1AJ4A 2NCPA 5EX0A 1QXPA 1MXEA 1UHKA 1DMOA 1FYBA 1U5KA 3UEYA 5AFPA 1QX5B 3D0YA 2HQWA 2M97A 1PALA 3BUXB 2FJUB 4D1EA 2FNFX 1TIZA 3BUNB 2J9RA 2YUUA 3SG6A 2G2BA 2M49B 2JWWA 4USLA 3ICBA 1YRUB 2LMVA 1BODA 1XK4A 2CCMA 4ZCVA 5CCLA 2L50A 4ORCB 2QQCA 2Q91A 2LVVA 1RWYA 1A29A 4GGFA 1AUIB 1QIWA 3O78A 3VRPA 1J7OA 1JWDA 5DKRA 4DIRA 1MF8B 2ELIA 3E59A 1XYDA 2JPTA 3CTNA 3OB2B 2KFHA 3PDNA 2DIPA 3CLNA 2WVJA 2K7DA 1F4QA 1UUCA 1CTRA 1N2DA 2I18A 2ZN8A 1R0RI 4I5LB 5HKYA 1Y1XA 2Q4UA 1GGZA 4A4BA 1LINA 3PLFB 2P6AC 2V1CA 5TNCA 4GBAA 5FUVA 1LR8A 1FF1A 3AAJA 1N13A 1IH0A 4YBHB 1ZMZA 2JT0A 1SL8A 4UXJA 4ORAB 1ODBA 2KMOA 2CJSC 4ORBB 3BUWB 1OMDA 2JYYA 2ZNDA 1AHRA 5AEQA 3HH2C 1Y1CA 1JSAA 1C7WA 2Y4QA 3NSKA 2CT9A 2ENZA 1XFVO 3I5GC 3F45A 2JTTA 3QRXA 3TS5B 2QPTA 2GGMA 4UPGA 4GAOA 2NXQA 2L4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I8N A;  1SR6 B;  4WQ3 A;  2ZN9 A;  2BBN A;  3LK0 A;  1TBR R;  1WDC B;  3ZWH A;  5I2Q A;  1KCY A;  2NU0 I;  1MT1 A;  2EGD A;  1QS7 A;  3EK7 A;  3WHT B;  3SGB I;  1NIW A;  4PE4 A;  4PHN A;  1CMG A;  1RTP 1;  2BBM A;  1LR7 A;  1YVL A;  2OS8 B;  4Q04 A;  2PVB A;  2BCX A;  2AMI A;  4DUQ A;  1ALW A;  1C7V A;  1K9P A;  1TNQ A;  1S36 A;  1CFC A;  1B1G A;  2MBX A;  3DD4 A;  1UHN A;  3VRQ A;  4AQJ A;  1YU6 C;  1PSB A;  1M8C A;  1KQM B;  1WLM A;  3I5I C;  1TNX A;  1KFU S;  3M0W A;  3WNX B;  4CFQ A;  1AJ5 A;  2AAO A;  1F55 A;  5JHW C;  4CFR A;  1KFU L;  3SG3 A;  3KF9 A;  2F2O A;  1OOJ A;  4F0Z B;  1KWO B;  4YGA A;  2H61 C;  1NCX A;  2M1K B;  2TN4 A;  3I5F C;  1GGW A;  2L2E A;  2L5X B;  2G9B A;  4C0L A;  4CID A;  1TNP A;  1QLS A;  1UUR A;  1IRJ A;  2WCE A;  2M0R A;  2JT8 A;  3FWB A;  1PSR A;  2BKI B;  4HRE E;  3OVO A;  1H0Z A;  4PAL A;  3OP0 A;  3I5H C;  1JC2 A;  1K94 A;  1KK8 B;  3SIB A;  1S6J A;  2QAC A;  3NXA A;  1CGI I;  1HJA I;  1SBJ A;  4YGB B;  1IG5 A;  1TRF A;  3GK1 A;  4WRI A;  4GI3 C;  4L9M A;  4ZCU A;  4MLW A;  4YGE B;  4I5K A;  3PAL A;  4NDC A;  4XJK B;  5HLV A;  1DJX A;  1XK4 C;  3DVE A;  4N1F A;  1L7Z A;  1CSO I;  1A2X A;  3OX5 A;  3LK1 A;  1JUO A;  2KYF A;  1AN1 I;  2BEC A;  4FTG A;  1F4O A;  5F6T A;  3PSR A;  1PVB A;  4GFT A;  2KDH A;  4U8D A;  2A4J A;  1M39 A;  4PCW A;  2K0J A;  4XYN A;  2LE9 B;  4MZL A;  1N65 A;  2PSR A;  3O4Y A;  1CDL A;  3PM8 A;  2I94 A;  2ZNE A;  5I2L A;  1SPY A;  5HKZ A;  2ARP F;  1DF0 B;  2LV7 A;  3AAK A;  1SYM A;  3BYA A;  1TIH A;  3LLE A;  3EVU A;  2Y5I A;  5J3X A;  1LA3 A;  1W7I B;  1C07 A;  3CR2 A;  4BY5 A;  1J1E A;  1WLZ A;  1PCE A;  2WOR A;  3FIA A;  2F3C I;  3CS1 A;  1CNP A;  1SGY I;  3CR4 X;  2LP2 A;  3DF0 B;  4MRY A;  5DAE A;  1NCZ A;  1K90 D;  2K7B A;  1TCO B;  2ZKM X;  2MRD A;  1YUT A;  1CFD A;  2JNX A;  1UP5 A;  1SNL A;  4WQ2 A;  1BUS A;  3A4U B;  4JQ0 D;  1CB1 A;  1WY9 A;  1CKK A;  1BOC A;  1YTP A;  3SG2 A;  1M46 A;  3OX6 A;  2K2F A;  2WCB A;  3SGQ I;  4XJK A;  1OE9 B;  2K61 A;  4PDZ A;  1AP4 A;  1CLB A;  1KQV A;  1L2O B;  2WOS A;  1BF5 A;  3HX4 A;  1B4C A;  3BQ3 A;  2GKT I;  2ISD A;  1AK8 A;  2PRU A;  1J55 A;  4M2O A;  3KO0 A;  1DTL A;  2EC6 B;  1REC A;  2JU0 A;  1K2H A;  2EHB A;  1UHH A;  2V53 A;  3PFV A;  1NX1 A;  2FCE A;  1K96 A;  1FBV A;  1PJU A;  2LEO A;  1BLQ A;  2JOJ A;  3FWC A;  1BMO A;  1OMR A;  3BOW B;  3C1V A;  1F54 A;  1DF0 A;  2D8N A;  1YVH A;  2NU4 I;  1TTX A;  1UWO A;  2JUL A;  4A4C A;  2N17 A;  1QLK A;  4GNK B;  2JZM A;  1EJ3 A;  1IJ6 A;  2BCA A;  2P6B B;  5KTY A;  3GK4 X;  3DF0 A;  2F8P A;  1YR5 A;  1V1F A;  3OB1 B;  2ERW A;  1JFJ A;  1R6P A;  1DGV A;  5AAN A;  3TS5 C;  4OV2 A;  1TNW A;  4C0J A;  2AUC A;  1ALV A;  2LHL A;  1CDP A;  2JNF A;  1J7Q A;  4YI9 A;  5IBW A;  1TBQ R;  2JT3 A;  1CFF A;  1Y1B A;  1S3P A;  4SGB I;  2LMT A;  1PRW A;  2LVJ A;  5ER4 X;  4ETO A;  1F70 A;  2CBL A;  2KAV A;  2KI6 D;  3CR5 X;  4QJ5 B;  1TN4 A;  2ZFD A;  1ZUZ A;  2DOQ A;  3D10 A;  3KHE A;  2BE6 A;  2OTG C;  1IY6 A;  2SGF I;  1SCM B;  4HGU A;  5G08 A;  2OS8 C;  1SL7 A;  2F2P A;  1HT9 A;  1QAS A;  5DKQ A;  1QVI Y;  1RJV A;  1LA0 A;  1YTZ C;  2BKH B;  3O6B A;  2KI4 B;  2LC5 A;  3HCM A;  2PAL A;  3BOW A;  4HRG A;  2KI6 C;  2KNE A;  2GKV A;  1LVC D;  2NLN A;  1SL9 A;  3SJS A;  1KQM C;  1NX3 A;  3PN7 B;  1S26 D;  3CZT X;  4OVN F;  1G8I A;  2JZI A;  2LUC A;  1YUR A;  1QX2 A;  1WRZ A;  1S1E A;  3RLZ A;  4AOM A;  1YX7 A;  1NX0 A;  3H4S E;  2SGE I;  1CFP A;  2KBM A;  5BPJ A;  2KYC A;  1KWO C;  2L51 A;  4MZK A;  1KSO A;  1M31 A;  1SGN I;  3SG7 A;  2BL0 C;  3KPX A;  3DVJ A;  2OPO A;  1SGE I;  1M63 B;  1NSH A;  4OR9 B;  3SIA A;  3NSI A;  1UHI A;  2LMU A;  5PAL A;  2QQD A;  2HQ8 A;  3OHM B;  2NZ0 A;  1SK6 D;  3FS7 A;  2K7O A;  4NDD A;  3BUM B;  3EVR A;  4E68 A;  2M1U A;  3KEV A;  1OYV I;  1PUL A;  4MN0 A;  2WND A;  1S6I A;  1QIV A;  2F33 A;  2IS9 A;  3TUY B;  3EK8 A;  2SGP I;  1E8A A;  2B1U A;  2KOT A;  2M7N A;  2H2K A;  1A4P A;  4TNC A;  3JVT B;  1XVJ A;  2MAZ A;  5K89 A;  2O5G A;  4QJ4 B;  1R2U A;  2LAP A;  4M2Q A;  4GGF C;  5JJG A;  2SCP A;  3SG5 A;  3B4V C;  2HET A;  1SGR I;  2KGR A;  2PAS A;  1Z7K B;  1MR8 A;  3GOF A;  2LCP A;  2KBI A;  2O60 A;  3WXA A;  1CT2 I;  1UVG A;  3D0Y B;  1HPT A;  3WHU B;  3O2P A;  1H8B A;  1OMU A;  1RFJ A;  1BJF A;  1PK0 D;  1XA5 A;  2BUS A;  1DS3 I;  1U5I B;  1K93 D;  3AKB A;  4PE7 A;  2COL B;  1BR1 B;  4NDB A;  2BE4 A;  3EKH A;  1UVF A;  2LHI A;  2M29 A;  4MRX A;  3E3R A;  1LR9 A;  2JRF A;  1MXL C;  5CSN A;  1TUS A;  3LCP C;  1Y1A A;  1J7R A;  2LVK A;  2WC8 A;  3IQQ A;  1ZOT B;  4I5J A;  1JBA A;  2L0P A;  4P2Y B;  1CT4 I;  1SW8 A;  1DJW A;  1EH2 A;  1SGQ I;  1DJZ A;  2LLT A;  1GQM A;  3JTD B;  5D69 A;  2KGB C;  1OSA A;  2K2A A;  2LAN A;  2M8U A;  1H4B A;  2N52 A;  1VRK A;  5HKW A;  1FW4 A;  2E30 A;  4MBE A;  1Y6W A;  5FYX A;  4DRW A;  1NWD A;  3EKJ A;  1IJ5 A;  3RM1 A;  1DS2 I;  3CWG A;  1X02 A;  1DGU A;  4DCK A;  1N0Y A;  1L2O C;  2K8M B;  1EL4 A;  4FQO A;  1K9K A;  1ZAC A;  2KAY A;  2KQY A;  2Y1M A;  4PHJ A;  2OVO A;  4ICB A;  2EC6 C;  4MZJ A;  1RRO A;  1WRL A;  1EG3 A;  1NCY A;  1CMF A;  1PPF I;  1IGV A;  3MSE B;  1U5I A;  1SGD I;  1TGS I;  2WCY A;  5CPV A;  1OZO A;  1DT7 B;  1G4Y R;  1LXF C;  5HLO A;  1EXR A;  1K95 A;  1NYA A;  3VGO A;  4YRU A;  1XO5 A;  2I7A A;  2MLE C;  1FI6 A;  2M3W A;  4HSZ A;  2FCD A;  1IQ5 A;  3GK2 A;  4PHK A;  4MVF A;  2LNK A;  1CHO I;  2BCB A;  1M45 A;  1XFX O;  1IWQ A;  2CXJ A;  2LP3 A;  4OCI A;  4QJ3 B;  1CDM A;  3CGA A;  4CPV A;  1BU3 A;  1XFW O;  5JOL A;  2CTN A;  4C0K A;  4OKH A;  1KSM A;  1V1G A;  1WRK A;  1Q80 A;  2VRG A;  2E6W A;  2JXC A;  1B7T Y;  1JF2 A;  1LKJ A;  2F3Y A;  2KMR A;  1SR6 C;  3ZNI A;  2KMQ A;  1CE3 A;  1FPW A;  1OVO A;  1OMV A;  1QX7 A;  3EVV A;  1WDC C;  3BXK A;  2N71 A;  2SGQ I;  1DJH A;  2NCO A;  5DKN A;  3TDU A;  1B7T Z;  1Y1U A;  2JTZ A;  1J1D A;  1F8H A;  1K9U A;  3I5G B;  5GQQ C;  1OMT A;  1DJG A;  2KMP A;  5KSZ A;  1SKT A;  1CM1 A;  2R2I A;  4JWQ A;  1GJY A;  1W7J B;  1HQV A;  1BR4 B;  1SCM C;  4PE1 A;  1DVI A;  4GPL B;  4JPZ B;  2K7C A;  3TDI A;  2WCF A;  1TUR A;  2M7L A;  2JC2 A;  2M9G A;  1CLL A;  4I5N B;  5KU1 A;  1K8U A;  1YUU A;  1OQP A;  1B8C A;  2KI4 C;  1MUX A;  3SG4 A;  1QVI Z;  1IQ3 A;  2NU3 I;  1NPQ A;  1F71 A;  1A75 B;  1QTX A;  3AKA A;  3DVM A;  4HRH A;  1BT6 A;  2MA2 A;  4AQI A;  1QV1 A;  2JXD A;  3VRN A;  1Y0V H;  2OTG B;  3PN7 C;  4YGD B;  5AXI A;  5CSJ A;  2KAX A;  1AVS A;  1SMG A;  1SCV A;  1KFX S;  3TZ1 A;  5HYD A;  2KSP A;  1CDN A;  5CSF A;  1IKU A;  1DJY A;  2ZRT A;  2MHH A;  1B8L A;  1KFX L;  1BG1 A;  1ZFS A;  3DVK A;  1B9A A;  1B8R A;  3QTL D;  4MSP A;  2KCX A;  3I5I B;  2M5X A;  1UUS A;  1IW4 A;  1UHJ A;  1HDL A;  2B0U C;  3SEK C;  1MHO A;  1YRT B;  1QAT A;  3NSL A;  3TDZ A;  1FI5 A;  4GUK A;  5CSI A;  5ER5 A;  1XFZ O;  2MLF C;  1DJI A;  1NUB A;  2GGZ A;  4MEW A;  1SRA A;  3BUO B;  1KK8 C;  3I5F B;  3EK4 A;  3IF7 A;  2XRC A;  2KFF A;  3NSO A;  5AER A;  1J7P A;  1YUS A;  2FOT A;  4IL1 A;  2PMY A;  4NQG A;  4YGC B;  1IY5 A;  3TUY C;  2BL0 B;  4N5X A;  1JF0 A;  2LUX A;  1SGP I;  5I2O A;  3JVT C;  1KK7 Y;  3PAT A;  2HF5 A;  1NP8 A;  3TJQ A;  1RK9 A;  1TOP A;  4M2P A;  2NU2 I;  1A75 A;  1PVA A;  1QJT A;  1NX2 A;  3I5H B;  3K21 A;  4OVO A;  1CLM A;  4PHM A;  5B8I B;  1KK7 Z;  2CNP A;  1YX8 A;  2Y1N A;  1B47 A;  2JXL A;  1MWN A;  1S6C A;  4DS7 A;  1M8B A;  1KMA A;  2SGD I;  2KHN A;  1CGJ I;  4YI8 A;  4P5O E;  2L4I A;  4R1E A;  1G33 A;  4BY4 A;  2RGI A;  2LM5 A;  2GKR I;  2GV5 A;  1JFK A;  1XFY O;  1EG4 A;  1CM4 A;  2LVI A;  3LL8 B;  1OZS A;  2NU1 I;  2L98 A;  1XFU O;  4PE0 A;  5D7F A;  3VRR A;  2ZRS A;  2JQ6 A;  2KFG A;  2LLS A;  1S5G Y;  2H61 A;  2SAS A;  3VRO A;  1A03 A;  4GGN A;  2HPS A;  1QV0 A;  2I2R E;  2MJW B;  1CT0 I;  2F3Z A;  3IQO A;  3JTD C;  1TCF A;  1D1O A;  4N1G A;  2LLU A;  2KQ6 A;  4CLN A;  1S5G Z;  1SY9 A;  3A8R A;  1MQ1 A;  1AJ4 A;  2NCP A;  1QXP A;  1MXE A;  1UHK A;  1DMO A;  1FYB A;  5AFP A;  1QX5 B;  3D0Y A;  2HQW A;  2M97 A;  1PAL A;  3BUX B;  2FJU B;  4D1E A;  1TIZ A;  3BUN B;  3SG6 A;  2G2B A;  2M49 B;  2JWW A;  4USL A;  3ICB A;  1YRU B;  2LMV A;  1BOD A;  1XK4 A;  2CCM A;  4ZCV A;  2L50 A;  4ORC B;  2QQC A;  2Q91 A;  2LVV A;  1RWY A;  1A29 A;  4GGF A;  1AUI B;  1QIW A;  3O78 A;  3VRP A;  1J7O A;  1JWD A;  5DKR A;  4DIR A;  1MF8 B;  1XYD A;  2JPT A;  3CTN A;  3OB2 B;  2KFH A;  3CLN A;  2K7D A;  1F4Q A;  1UUC A;  1CTR A;  1N2D A;  2I18 A;  2ZN8 A;  1R0R I;  4I5L B;  5HKY A;  1Y1X A;  2Q4U A;  1GGZ A;  4A4B A;  1LIN A;  3PLF B;  2P6A C;  5TNC A;  4GBA A;  1LR8 A;  1FF1 A;  3AAJ A;  1N13 A;  1IH0 A;  4YBH B;  1ZMZ A;  2JT0 A;  1SL8 A;  4ORA B;  1ODB A;  2KMO A;  4ORB B;  3BUW B;  1OMD A;  2JYY A;  2ZND A;  1AHR A;  5AEQ A;  3HH2 C;  1Y1C A;  1JSA A;  1C7W A;  2Y4Q A;  3NSK A;  2CT9 A;  1XFV O;  3I5G C;  3F45 A;  2JTT A;  3QRX A;  3TS5 B;  2QPT A;  2GGM A;  4UPG A;  4GAO A;  2NXQ A;  2L4H A; 
#chains in the Genus database with same CATH topology
 1SR6 B;  1TWO A;  3DZT A;  4WQ3 A;  2BBN A;  3QWP A;  3EK7 A;  4A24 A;  1RTP 1;  4Q04 A;  1FAR A;  3VRQ A;  2ENN A;  1YU6 C;  1KQM B;  1WLM A;  1X74 A;  2VRW B;  4YGA A;  2M1K B;  2L2E A;  1PSR A;  2BKI B;  3NXA A;  1CGI I;  1TRF A;  1XA6 A;  4MLW A;  3B88 A;  1XK4 C;  3DVE A;  3R1P A;  1A2X A;  3TO7 A;  1JUO A;  2KYF A;  3B6X A;  4FKD A;  2LB7 A;  1RFH A;  2KDH A;  2A4J A;  1WGT A;  2OD1 A;  1N65 A;  3PM8 A;  4IJ7 A;  2I94 A;  2QEO A;  3BYA A;  3EVU A;  5J3X A;  1LA3 A;  3IVT A;  5J8C A;  1SGY I;  2LP2 A;  2ORW A;  3UGD A;  1SNL A;  1CB1 A;  3OX6 A;  4UXI A;  2WCB A;  1AP4 A;  1W9Z A;  1KQV A;  2GKT I;  4M2O A;  2EC6 B;  1UHH A;  2V53 A;  1NX1 A;  1K96 A;  2LEO A;  3BFB A;  1BMO A;  1DF0 A;  1YVH A;  1TTX A;  1UWO A;  4A4C A;  2QPO A;  5HI7 A;  3OB1 B;  1R6P A;  3EG5 B;  2ERB A;  1ALV A;  2LHL A;  1J7Q A;  2W0T A;  4YI9 A;  5IBW A;  1CFF A;  2LVJ A;  3Q8I A;  4ETO A;  3CZ0 A;  2KAV A;  2KI6 D;  4QJ5 B;  1DQE A;  1TN4 A;  2ZFD A;  3D10 A;  2SGF I;  1SCM B;  2KLD A;  2OS8 C;  1SL7 A;  1QAS A;  5DKQ A;  2BKH B;  3BOW A;  1LVC D;  2NLN A;  1NX3 A;  1S26 D;  3H4S E;  5BPJ A;  1KSO A;  1QWV A;  2K60 A;  3DVJ A;  2OPO A;  1SGE I;  3SIA A;  3NSI A;  3OHM B;  2NZ0 A;  3EVR A;  1K7T A;  2M1U A;  5FI6 A;  2SGP I;  2B1U A;  2MAZ A;  2O5G A;  1R2U A;  4M2Q A;  5JJG A;  1SGR I;  3FSY A;  2LCP A;  3WXA A;  2PQ8 A;  3O2P A;  1H8B A;  1RFJ A;  1BJF A;  3BFH A;  2COL B;  4NDB A;  2M29 A;  4MRX A;  4FQT A;  2JRF A;  5CSN A;  3CYZ A;  3R5D A;  1J7R A;  4I5J A;  1ZOT B;  5FUW A;  2L5Y A;  1DJW A;  1VRK A;  5HKW A;  1FW4 A;  4MBE A;  4DRW A;  3EKJ A;  1TBO A;  1DGU A;  2WCH A;  3PM2 A;  1L2O C;  2K8M B;  1EL4 A;  1IIO A;  1RRO A;  1NCY A;  1SGD I;  3MSE B;  3RU0 A;  1EXR A;  1FY7 A;  2I7A A;  2X3T A;  1IQ5 A;  2BCB A;  3B87 A;  3QAH A;  2CTN A;  1V1G A;  1ULN A;  1B7T Y;  1SR6 C;  3ZNI A;  2KMQ A;  1OVO A;  3EVV A;  2N71 A;  3I5G B;  2KMP A;  5KSZ A;  1GJY A;  1HQV A;  4GPL B;  2M9G A;  1B8C A;  3SG4 A;  2QEH A;  1NPQ A;  1QTX A;  4HRH A;  1BT6 A;  4AQI A;  5HL1 A;  3PN7 C;  2KAX A;  2WC6 A;  1SCV A;  2WCM A;  5HYD A;  5CSF A;  1IKU A;  3SS5 A;  2ZRT A;  3K1E A;  3L4L A;  5DIC A;  2B0U C;  1YRT B;  4E1P A;  5ER5 A;  1XFZ O;  4MEW A;  1OW4 A;  1YUS A;  4YGC B;  2PMY A;  2BL0 B;  2LUX A;  2CWF A;  3R1O A;  3JVT C;  2HF5 A;  1NP8 A;  5D3O A;  1A75 A;  1NX2 A;  4OVO A;  5B8I B;  1MJ9 A;  4UXH A;  2FJY A;  1B47 A;  1MWN A;  4DS7 A;  1KMA A;  1CGJ I;  1PTQ A;  3SS3 A;  2LVI A;  1WKX A;  2L98 A;  1W3S A;  5D7F A;  2LLS A;  2H61 A;  2SAS A;  3VDP A;  4N1G A;  2WC5 A;  1SY9 A;  2NCP A;  3D76 A;  2H8V A;  3D77 A;  2FJU B;  3BUN B;  2BAP A;  2J9R A;  3SG6 A;  2JWW A;  2LMV A;  1SSE B;  2L50 A;  1RWY A;  3O78 A;  3CTN A;  2DIP A;  2BNX A;  1UUC A;  1N2D A;  2ZN8 A;  1Y1X A;  4A4B A;  1LIN A;  3PLF B;  3AAJ A;  1IH0 A;  1ZMZ A;  3L47 A;  1HEV A;  4ORA B;  1XFV O;  3S0F A;  2JTT A;  2CWH A;  4UPG A;  2NXQ A;  2L4H A;  2CWG A;  5I8N A;  3LK0 A;  4PT1 A;  1NIW A;  1CMG A;  2BBM A;  2K9H A;  2OS8 B;  2PVB A;  2AMI A;  1ULM A;  1K9P A;  3S0G A;  1TNX A;  1KFU S;  3M0W A;  4CFQ A;  1F55 A;  3SG3 A;  3KF9 A;  4F0Z B;  2H61 C;  2TN4 A;  1GGW A;  2OU2 A;  2L5X B;  2G9B A;  3OXL A;  2WCE A;  3OVO A;  1KK8 B;  3CZ2 A;  3D74 A;  1S6J A;  3SIB A;  2GTE A;  1IG5 A;  3GK1 A;  5FUY A;  1ORG A;  4L9M A;  4YGE B;  4NDC A;  1DJX A;  4N1F A;  1L7Z A;  2BEC A;  1F4O A;  3DY9 A;  5E3Q A;  4U8D A;  1C3Z A;  4PCW A;  2L8E A;  2PSR A;  3R5C A;  5I2L A;  1SPY A;  5HKZ A;  1DF0 B;  1T14 A;  3AAK A;  1TIH A;  1C07 A;  2Y5I A;  1WLZ A;  2WOR A;  2F3C I;  3CS1 A;  3TOA A;  1NCZ A;  1K90 D;  2ZKM X;  1YUT A;  3TO9 A;  1BUS A;  3A4U B;  1CKK A;  2K61 A;  1L2O B;  2WOS A;  1B4C A;  5FUX A;  1OOG A;  2PRU A;  3KO0 A;  4JD9 A;  2ODD A;  2EHB A;  3E2I A;  2JOJ A;  1OMR A;  3BOW B;  3C1V A;  1F54 A;  3FC3 A;  2D8N A;  2JUL A;  2E5R A;  2N17 A;  1QLK A;  4GNK B;  1IJ6 A;  3DF0 A;  2AUC A;  3VDU A;  1TBN A;  1ZUZ A;  2DOQ A;  1RJV A;  3HCM A;  3R1V A;  1SL9 A;  1MJA A;  3PN7 B;  3CZT X;  1G8I A;  1YUR A;  1S1E A;  2SGE I;  3DXL A;  3MEK A;  2L51 A;  2BL0 C;  3KPX A;  1NSH A;  2DKV A;  1UHI A;  5PAL A;  2QQD A;  2X52 A;  1SK6 D;  3BUM B;  4E68 A;  3UNW A;  1PUL A;  1QIV A;  3VE5 A;  2F33 A;  2IS9 A;  2M7N A;  3JVT B;  2HET A;  2PAS A;  1MR8 A;  1CT2 I;  4PE7 A;  3BJI A;  3EKH A;  1UVF A;  3FE9 A;  1LR9 A;  1TUS A;  3LCP C;  1JBA A;  1CT4 I;  1SW8 A;  5D69 A;  2LAN A;  2N52 A;  1Y6W A;  1IJ5 A;  2YQP A;  1X02 A;  3FSX A;  1K9K A;  1ZAC A;  2Y1M A;  4PHJ A;  1PPF I;  1U5I A;  2WCY A;  1G4Y R;  1NYA A;  3GK2 A;  4PHK A;  1CHO I;  1M45 A;  1IWQ A;  4OCI A;  3CGA A;  1BU3 A;  1XFW O;  1WRK A;  1Q80 A;  1DEL A;  1JF2 A;  2F3Y A;  1CE3 A;  1OMV A;  5FI7 A;  1DJH A;  5DKN A;  1Y1U A;  1DJG A;  1SKT A;  2R2I A;  1TOT A;  4PE1 A;  4JPZ B;  3TDI A;  1TUR A;  2WGC A;  5KU1 A;  1OQP A;  2RC4 A;  1MUX A;  2NU3 I;  5E3R A;  2QDI A;  1A75 B;  3AKA A;  2JXD A;  1QV1 A;  1Y0V H;  2QQE A;  1KFX S;  3TZ1 A;  1CDN A;  1B8L A;  1ZFS A;  1B9A A;  4MSP A;  2KCX A;  2RIJ A;  3O4X A;  1IW4 A;  1UHJ A;  1MHO A;  2N1A B;  3OL0 A;  4GUK A;  5CSI A;  2MLF C;  3D78 A;  3BUO B;  1KK8 C;  2J87 A;  3IF7 A;  2XRC A;  2KFF A;  4IL1 A;  2NU2 I;  1QJT A;  3K21 A;  1CLM A;  4PHM A;  1KK7 Z;  5I94 A;  1S6C A;  2SGD I;  2JW6 A;  2L4I A;  4R1E A;  4BY4 A;  2LM5 A;  2GV5 A;  1PTR A;  3NHT A;  3LL8 B;  1NXU A;  4PE0 A;  3VRR A;  2ZRS A;  2I2R E;  1TCF A;  4DNC A;  2LLU A;  1XBT A;  1S5G Z;  5EX0 A;  1QXP A;  1MXE A;  1FYB A;  5AFP A;  1QX5 B;  4D1E A;  2FNF X;  1TIZ A;  5EL2 A;  3QME A;  2G2B A;  3ICB A;  2CCM A;  5CCL A;  2Q91 A;  4GGF A;  3VRP A;  7WGA A;  5DKR A;  3R5B A;  3CAB A;  1XYD A;  3CLN A;  2K7D A;  1F4Q A;  1R0R I;  5HKY A;  5TNC A;  5FUV A;  1LR8 A;  1FF1 A;  4UXJ A;  2JYY A;  3BUW B;  1OMD A;  1AHR A;  5AEQ A;  2WCK A;  3QRX A;  1Z2C B;  3B86 A;  2ZN9 A;  1TBR R;  1WDC B;  3ZWH A;  1KCY A;  2NU0 I;  1MT1 A;  2EGD A;  3S0B A;  4B6D A;  1S36 A;  1CFC A;  3DD4 A;  1M8C A;  2DB6 A;  1AJ5 A;  2QQ0 A;  2F2O A;  1OOJ A;  3I5F C;  4E1R A;  4CID A;  1TNP A;  2L7X A;  1QLS A;  1IRJ A;  2M0R A;  3FWB A;  4HRE E;  1H0Z A;  4PAL A;  3OP0 A;  4YGB B;  3SS4 A;  4WRI A;  4GI3 C;  1CSO I;  3OX5 A;  3LK1 A;  4GFT A;  1M39 A;  2LE9 B;  4MZL A;  3O4Y A;  2ZNE A;  2ARP F;  1SYM A;  3LLE A;  1W7I B;  4BY5 A;  1J1E A;  2YGU A;  1PCE A;  3CR4 X;  3DF0 B;  1Z4H A;  3TOB A;  1CFD A;  2JNX A;  4WQ2 A;  9WGA A;  4JQ0 D;  1YTP A;  3SG2 A;  1M46 A;  1FAQ A;  3SGQ I;  4XJK A;  4PDZ A;  1BF5 A;  3BQ3 A;  2PYQ A;  2ISD A;  1J55 A;  1Y8F A;  1DTL A;  1REC A;  2JU0 A;  5CCM A;  3PFV A;  2FCE A;  1FBV A;  3PJI A;  2UZ3 A;  2BCA A;  2F8P A;  1V1F A;  1JFJ A;  5AAN A;  4C0J A;  1TNW A;  1CDP A;  1Y1B A;  2JT3 A;  1S3P A;  4SGB I;  3OGN A;  2LMT A;  1PRW A;  2CBL A;  3KHE A;  2BE6 A;  1LA0 A;  2KPH A;  3O6B A;  2LC5 A;  4HRG A;  2GKV A;  3SJS A;  4OVN F;  2JZI A;  3RLZ A;  4AOM A;  1YX7 A;  1NX0 A;  2B8T A;  2KBM A;  3S0A A;  2KYC A;  1KWO C;  3R72 A;  4MZK A;  3SG7 A;  1M63 B;  1V1H A;  3FS7 A;  3KEV A;  1OYV I;  3EK8 A;  2KOT A;  1K7V A;  2H2K A;  1A4P A;  4TNC A;  3FE8 A;  4QJ4 B;  3UEJ A;  3D00 A;  1UVG A;  3WHU B;  1PK0 D;  2BUS A;  1DS3 I;  1U5I B;  1K93 D;  1V1I A;  2WCL A;  2BE4 A;  3E3R A;  2QEB A;  2WC8 A;  3IQQ A;  3CZ1 A;  3UFF A;  1EH2 A;  1DJZ A;  2LLT A;  2KGB C;  1OSA A;  2M8U A;  3NHI A;  2E30 A;  5FYX A;  1UHA A;  3RM1 A;  1DS2 I;  3CWG A;  1N0Y A;  2KQY A;  2OVO A;  4ICB A;  4MZJ A;  1EG3 A;  3S0E A;  5CPV A;  1LXF C;  4YRU A;  3VGO A;  1XO5 A;  2ROW A;  1XFX O;  2CXJ A;  2LP3 A;  4QJ3 B;  1CDM A;  5JOL A;  2VRG A;  2JXC A;  1VDD A;  1FPW A;  1Z2I A;  1QX7 A;  1WDC C;  1B7T Z;  2JTZ A;  1W7J B;  1DVI A;  2M7L A;  1K8U A;  2KI4 C;  1QVI Z;  1F71 A;  3UO9 A;  3DVM A;  2OTG B;  5CSJ A;  1DJY A;  1BG1 A;  3QTL D;  1UUS A;  3SEK C;  3NSL A;  3TDZ A;  1FI5 A;  4WP4 A;  4INW A;  1NUB A;  3I5F B;  3EK4 A;  3NSO A;  5AER A;  1XX6 A;  4NQG A;  3TUY C;  5I2O A;  3PAT A;  1W4R A;  5FI2 A;  1RK9 A;  1TOP A;  4M2P A;  1KBE A;  2QEV A;  1PVA A;  2CNP A;  2JXL A;  1M8B A;  1P28 A;  2KHN A;  1Q9B A;  4P5O E;  2RGI A;  2GKR I;  1XFY O;  1EG4 A;  2NU1 I;  5HQ8 A;  5J8F A;  1XFU O;  3BFA A;  3VRO A;  1A03 A;  4GGN A;  2HPS A;  2F3Z A;  2L2C A;  3JTD C;  3N7H A;  2E73 A;  4CLN A;  3A8R A;  1DMO A;  3UEY A;  2M97 A;  1PAL A;  2YUU A;  1YRU B;  2GIV A;  1A29 A;  1QIW A;  4DIR A;  3E59 A;  3PDN A;  3D73 A;  1CTR A;  2I18 A;  1GGZ A;  2V1C A;  3UOE A;  4GBA A;  1LS8 A;  4YBH B;  1WTJ A;  2JT0 A;  1SL8 A;  2ZND A;  1Y1C A;  3NSK A;  2CT9 A;  3F45 A;  2Y0M A;  2GGM A;  4GAO A;  3VB1 A;  5I2Q A;  1QS7 A;  3WHT B;  3SGB I;  4PE4 A;  4PHN A;  1LR7 A;  1YVL A;  2BCX A;  4DUQ A;  1ALW A;  1C7V A;  1TNQ A;  1B1G A;  2A20 A;  2MBX A;  1UHN A;  3S0D A;  4AQJ A;  1PSB A;  1K7U A;  3I5I C;  3WNX B;  2AAO A;  5JHW C;  4CFR A;  1KFU L;  1KWO B;  1NCX A;  3B7A A;  4C0L A;  1UUR A;  2JT8 A;  3I5H C;  1TUZ A;  1K94 A;  1JC2 A;  2QAC A;  1HJA I;  1SBJ A;  4ZCU A;  2P70 A;  3DYE A;  3PAL A;  4I5K A;  4XJK B;  5HLV A;  1AN1 I;  4FTG A;  3FE6 A;  5F6T A;  3PSR A;  1MJB A;  1PVB A;  4XYN A;  2K0J A;  3L4A A;  1WGC A;  1CDL A;  2V1C C;  2LV7 A;  2PQL A;  1P9G A;  1P9Z A;  3CR2 A;  1DC1 A;  3FIA A;  1CNP A;  4MRY A;  5DAE A;  2K7B A;  1TCO B;  2MRD A;  1UP5 A;  1WY9 A;  1BOC A;  2K2F A;  1OE9 B;  1CLB A;  3HX4 A;  1AK8 A;  2UVO A;  1K2H A;  1PJU A;  3TO6 A;  1BLQ A;  3FWC A;  4F7F A;  2NU4 I;  2JZM A;  1EJ3 A;  2P6B B;  5KTY A;  3GK4 X;  1YR5 A;  2ERW A;  1DGV A;  3TS5 C;  4OV2 A;  2JNF A;  1TBQ R;  5ER4 X;  1ULK A;  1F70 A;  3CR5 X;  2ORV A;  2OTG C;  1IY6 A;  1X4S A;  4HGU A;  2P71 A;  5G08 A;  2F2P A;  1HT9 A;  1QVI Y;  1YTZ C;  1DEK A;  2KI4 B;  2PAL A;  1OOF A;  2KI6 C;  2KNE A;  1KQM C;  3UGL A;  2LUC A;  1QX2 A;  1WRZ A;  2JA1 A;  1CFP A;  1M31 A;  1SGN I;  4OR9 B;  1OOI X;  2LUY A;  2LMU A;  2HQ8 A;  2K7O A;  4NDD A;  4MN0 A;  2WND A;  1S6I A;  3TUY B;  1E8A A;  3OXF A;  1XVJ A;  5K89 A;  2KLE A;  2LAP A;  4GGF C;  2SCP A;  3SG5 A;  2OZU A;  3B4V C;  4OZD A;  2KGR A;  1Z7K B;  3GOF A;  2KBI A;  2O60 A;  3D0Y B;  1HPT A;  1OMU A;  1XA5 A;  1R79 A;  3AKB A;  1BR1 B;  2LHI A;  1MXL C;  1Y1A A;  2LVK A;  3KY9 A;  2L0P A;  4P2Y B;  1SGQ I;  4AML A;  1GQM A;  3JTD B;  2K2A A;  1KBF A;  1H4B A;  1NWD A;  4DCK A;  4FQO A;  2KAY A;  2EC6 C;  1WRL A;  1CMF A;  1IGV A;  1TGS I;  1XFR A;  1OZO A;  1DT7 B;  5HLO A;  1K95 A;  2MLE C;  1FI6 A;  2M3W A;  4HSZ A;  2FCD A;  4MVF A;  2LNK A;  3NGV A;  4CPV A;  4C0K A;  4OKH A;  1S20 A;  1KSM A;  2E6W A;  1LKJ A;  4JCV E;  1OOH A;  3R5A A;  2KMR A;  3BJH A;  2SGQ I;  3BXK A;  2NCO A;  3TDU A;  1F8H A;  1J1D A;  1K9U A;  5GQQ C;  1OMT A;  1CM1 A;  4JWQ A;  3GOX A;  1BR4 B;  1SCM C;  2K7C A;  4INX A;  2WCF A;  2JC2 A;  2WCJ A;  1CLL A;  4I5N B;  1IQ3 A;  1YUU A;  3V2L A;  2MA2 A;  3VRN A;  4YGD B;  5AXI A;  1AVS A;  1SMG A;  2KSP A;  2MHH A;  5E3P A;  1KFX L;  3DVK A;  1B8R A;  3I5I B;  2M5X A;  1HDL A;  2JPO A;  1C3Y A;  3D75 A;  3OBV A;  1QAT A;  3UGI A;  3RZS A;  1DJI A;  2GGZ A;  1SRA A;  1J7P A;  2FOT A;  1IY5 A;  4N5X A;  3CXL A;  1JF0 A;  1SGP I;  1KK7 Y;  3TJQ A;  1GM0 A;  3I5H B;  4JKT A;  1YX8 A;  2Y1N A;  4YI8 A;  1G33 A;  2GVI A;  1JFK A;  1CM4 A;  3OXG A;  1OZS A;  2JQ6 A;  2KFG A;  1S5G Y;  5EX3 A;  1CT0 I;  1QV0 A;  2MJW B;  3IQO A;  1D1O A;  2KQ6 A;  1MQ1 A;  1AJ4 A;  1UHK A;  1U5K A;  3D0Y A;  2HQW A;  3BUX B;  2M49 B;  4USL A;  1BOD A;  1XK4 A;  4ZCV A;  4ORC B;  2QQC A;  2LVV A;  1AUI B;  1J7O A;  1JWD A;  2ELI A;  1MF8 B;  2JPT A;  3OB2 B;  2KFH A;  4MPI A;  2WVJ A;  4I5L B;  2P6A C;  2Q4U A;  3CDN A;  1N13 A;  4KYN A;  1ODB A;  2KMO A;  2CJS C;  4ORB B;  3HH2 C;  1JSA A;  1C7W A;  2Y4Q A;  2ENZ A;  3I5G C;  3TS5 B;  2QPT A;  1TUJ A; 
#chains in the Genus database with same CATH homology
 5I8N A;  1SR6 B;  4WQ3 A;  2ZN9 A;  2BBN A;  3LK0 A;  1TBR R;  1WDC B;  3ZWH A;  5I2Q A;  1KCY A;  2NU0 I;  1MT1 A;  2EGD A;  3QWP A;  1QS7 A;  3EK7 A;  3WHT B;  3SGB I;  1NIW A;  4PE4 A;  4PHN A;  1CMG A;  1RTP 1;  4A24 A;  2BBM A;  1LR7 A;  2K9H A;  1YVL A;  2OS8 B;  4Q04 A;  2PVB A;  2BCX A;  2AMI A;  4DUQ A;  1ALW A;  1C7V A;  1K9P A;  1TNQ A;  4B6D A;  1S36 A;  1CFC A;  1B1G A;  1FAR A;  2A20 A;  2MBX A;  3DD4 A;  1UHN A;  3VRQ A;  2ENN A;  4AQJ A;  1YU6 C;  1PSB A;  1M8C A;  1KQM B;  1WLM A;  3I5I C;  1TNX A;  1KFU S;  1X74 A;  2DB6 A;  3M0W A;  3WNX B;  4CFQ A;  1AJ5 A;  2AAO A;  1F55 A;  5JHW C;  4CFR A;  2QQ0 A;  1KFU L;  3SG3 A;  3KF9 A;  2F2O A;  1OOJ A;  4F0Z B;  2VRW B;  1KWO B;  4YGA A;  2H61 C;  1NCX A;  2M1K B;  2TN4 A;  3I5F C;  1GGW A;  2L2E A;  2L5X B;  2G9B A;  4C0L A;  4CID A;  4E1R A;  1TNP A;  2L7X A;  3OXL A;  1QLS A;  1UUR A;  1IRJ A;  2WCE A;  2M0R A;  2JT8 A;  3FWB A;  1PSR A;  2BKI B;  4HRE E;  3OVO A;  1H0Z A;  4PAL A;  3OP0 A;  3I5H C;  1JC2 A;  1K94 A;  1KK8 B;  3SIB A;  1S6J A;  2QAC A;  3NXA A;  1CGI I;  1HJA I;  1SBJ A;  4YGB B;  1IG5 A;  1TRF A;  3GK1 A;  1XA6 A;  5FUY A;  4WRI A;  4GI3 C;  4L9M A;  4ZCU A;  4MLW A;  4YGE B;  4I5K A;  3PAL A;  4NDC A;  4XJK B;  5HLV A;  1DJX A;  1XK4 C;  3DVE A;  4N1F A;  1L7Z A;  1CSO I;  1A2X A;  3OX5 A;  3LK1 A;  1JUO A;  2KYF A;  1AN1 I;  2BEC A;  4FTG A;  4FKD A;  1F4O A;  5F6T A;  3PSR A;  1PVB A;  1RFH A;  4GFT A;  2KDH A;  4U8D A;  2A4J A;  1M39 A;  4PCW A;  2K0J A;  4XYN A;  2L8E A;  2OD1 A;  2LE9 B;  4MZL A;  1N65 A;  2PSR A;  3O4Y A;  1CDL A;  3PM8 A;  2I94 A;  2ZNE A;  2V1C C;  5I2L A;  1SPY A;  5HKZ A;  2ARP F;  1DF0 B;  2LV7 A;  3AAK A;  1SYM A;  3BYA A;  1TIH A;  3LLE A;  3EVU A;  2Y5I A;  5J3X A;  1LA3 A;  1W7I B;  1C07 A;  3CR2 A;  4BY5 A;  1J1E A;  1WLZ A;  1PCE A;  2WOR A;  3FIA A;  2F3C I;  3CS1 A;  1CNP A;  1SGY I;  3CR4 X;  2LP2 A;  3DF0 B;  4MRY A;  5DAE A;  1NCZ A;  1K90 D;  2K7B A;  1TCO B;  2ZKM X;  2ORW A;  2MRD A;  3UGD A;  1YUT A;  1CFD A;  2JNX A;  1UP5 A;  1SNL A;  4WQ2 A;  1BUS A;  3A4U B;  4JQ0 D;  1CB1 A;  1WY9 A;  1CKK A;  1BOC A;  1YTP A;  3SG2 A;  1M46 A;  1FAQ A;  3OX6 A;  2K2F A;  4UXI A;  2WCB A;  3SGQ I;  4XJK A;  1OE9 B;  2K61 A;  4PDZ A;  1AP4 A;  1CLB A;  1KQV A;  1L2O B;  2WOS A;  1BF5 A;  3HX4 A;  1B4C A;  3BQ3 A;  2GKT I;  5FUX A;  2ISD A;  1AK8 A;  2PRU A;  1J55 A;  4M2O A;  3KO0 A;  1DTL A;  1Y8F A;  2EC6 B;  2ODD A;  1REC A;  2JU0 A;  1K2H A;  5CCM A;  2EHB A;  1UHH A;  2V53 A;  3PFV A;  3E2I A;  1NX1 A;  2FCE A;  1K96 A;  1FBV A;  1PJU A;  2LEO A;  1BLQ A;  2JOJ A;  3FWC A;  1BMO A;  1OMR A;  3BOW B;  3C1V A;  1F54 A;  1DF0 A;  3FC3 A;  2D8N A;  1YVH A;  2NU4 I;  1TTX A;  1UWO A;  2JUL A;  4A4C A;  2E5R A;  1QLK A;  4GNK B;  2N17 A;  2JZM A;  1EJ3 A;  2QPO A;  1IJ6 A;  2UZ3 A;  2BCA A;  2P6B B;  5KTY A;  5HI7 A;  3GK4 X;  3DF0 A;  2F8P A;  1YR5 A;  1V1F A;  3OB1 B;  2ERW A;  1JFJ A;  1R6P A;  1DGV A;  5AAN A;  3TS5 C;  4OV2 A;  1TNW A;  4C0J A;  2AUC A;  1ALV A;  2LHL A;  1CDP A;  2JNF A;  1J7Q A;  4YI9 A;  2W0T A;  3VDU A;  5IBW A;  1TBQ R;  2JT3 A;  1CFF A;  1Y1B A;  1S3P A;  4SGB I;  2LMT A;  1PRW A;  2LVJ A;  5ER4 X;  4ETO A;  1F70 A;  2CBL A;  2KAV A;  2KI6 D;  3CR5 X;  4QJ5 B;  1TBN A;  1TN4 A;  2ORV A;  3GOX A;  2ZFD A;  1ZUZ A;  2DOQ A;  3D10 A;  3KHE A;  2BE6 A;  2OTG C;  1IY6 A;  2SGF I;  1X4S A;  1SCM B;  4HGU A;  5G08 A;  2OS8 C;  1SL7 A;  2F2P A;  1HT9 A;  1QAS A;  5DKQ A;  1QVI Y;  1RJV A;  1LA0 A;  1YTZ C;  2BKH B;  3O6B A;  2KI4 B;  2LC5 A;  3HCM A;  2PAL A;  3BOW A;  4HRG A;  2KI6 C;  2KNE A;  2GKV A;  1LVC D;  2NLN A;  1SL9 A;  3SJS A;  1KQM C;  1NX3 A;  3PN7 B;  1S26 D;  3UGL A;  3CZT X;  4OVN F;  1G8I A;  2JZI A;  2LUC A;  1YUR A;  1QX2 A;  1WRZ A;  1S1E A;  3RLZ A;  4AOM A;  2JA1 A;  1YX7 A;  1NX0 A;  3H4S E;  2B8T A;  2SGE I;  3MEK A;  1CFP A;  2KBM A;  5BPJ A;  2KYC A;  1KWO C;  2L51 A;  4MZK A;  1KSO A;  1M31 A;  1SGN I;  3SG7 A;  2BL0 C;  3KPX A;  3DVJ A;  2OPO A;  1SGE I;  1M63 B;  1NSH A;  4OR9 B;  3SIA A;  1V1H A;  3NSI A;  2LUY A;  1UHI A;  2LMU A;  5PAL A;  2QQD A;  2HQ8 A;  3OHM B;  2NZ0 A;  1SK6 D;  3FS7 A;  2K7O A;  4NDD A;  3BUM B;  3EVR A;  4E68 A;  2M1U A;  3KEV A;  1OYV I;  1PUL A;  4MN0 A;  2WND A;  1S6I A;  1QIV A;  3VE5 A;  2F33 A;  2IS9 A;  3TUY B;  3EK8 A;  2SGP I;  1E8A A;  2B1U A;  2KOT A;  2M7N A;  2H2K A;  3OXF A;  1A4P A;  4TNC A;  3JVT B;  1XVJ A;  2MAZ A;  5K89 A;  2O5G A;  4QJ4 B;  1R2U A;  2LAP A;  4M2Q A;  4GGF C;  5JJG A;  2SCP A;  3SG5 A;  3B4V C;  2HET A;  1SGR I;  2KGR A;  2PAS A;  1Z7K B;  3UEJ A;  1MR8 A;  3D00 A;  3GOF A;  2LCP A;  2KBI A;  2O60 A;  3WXA A;  1CT2 I;  1UVG A;  3D0Y B;  1HPT A;  3WHU B;  3O2P A;  1H8B A;  1OMU A;  1RFJ A;  1BJF A;  1PK0 D;  1XA5 A;  2BUS A;  1DS3 I;  1R79 A;  1U5I B;  1K93 D;  3AKB A;  4PE7 A;  2COL B;  1V1I A;  1BR1 B;  4NDB A;  3BJI A;  2BE4 A;  3EKH A;  1UVF A;  2LHI A;  2M29 A;  4MRX A;  3E3R A;  1LR9 A;  2JRF A;  1MXL C;  5CSN A;  1TUS A;  3LCP C;  1Y1A A;  1J7R A;  2LVK A;  2WC8 A;  3IQQ A;  1ZOT B;  4I5J A;  3UFF A;  5FUW A;  3KY9 A;  1JBA A;  2L0P A;  4P2Y B;  1CT4 I;  1SW8 A;  1DJW A;  1EH2 A;  1SGQ I;  1DJZ A;  2LLT A;  1GQM A;  3JTD B;  5D69 A;  2KGB C;  1OSA A;  2K2A A;  2LAN A;  2M8U A;  1KBF A;  1H4B A;  2N52 A;  1VRK A;  5HKW A;  1FW4 A;  2E30 A;  4MBE A;  1Y6W A;  5FYX A;  4DRW A;  1NWD A;  3EKJ A;  1IJ5 A;  1TBO A;  3RM1 A;  1DS2 I;  3CWG A;  2YQP A;  1X02 A;  1DGU A;  4DCK A;  1N0Y A;  1L2O C;  2K8M B;  1EL4 A;  4FQO A;  1K9K A;  1ZAC A;  2KAY A;  2KQY A;  2Y1M A;  4PHJ A;  2OVO A;  4ICB A;  2EC6 C;  4MZJ A;  1RRO A;  1WRL A;  1EG3 A;  1NCY A;  1CMF A;  1PPF I;  1IGV A;  3MSE B;  1U5I A;  1SGD I;  1TGS I;  2WCY A;  3RU0 A;  5CPV A;  1OZO A;  1DT7 B;  1G4Y R;  1LXF C;  5HLO A;  1EXR A;  1K95 A;  1NYA A;  3VGO A;  4YRU A;  1XO5 A;  2I7A A;  2MLE C;  1FI6 A;  2M3W A;  4HSZ A;  2FCD A;  1IQ5 A;  3GK2 A;  4PHK A;  4MVF A;  2LNK A;  1CHO I;  2ROW A;  2BCB A;  1M45 A;  1XFX O;  1IWQ A;  2CXJ A;  2LP3 A;  4OCI A;  4QJ3 B;  1CDM A;  3CGA A;  4CPV A;  1BU3 A;  1XFW O;  5JOL A;  2CTN A;  4C0K A;  4OKH A;  1KSM A;  1V1G A;  1WRK A;  1Q80 A;  2VRG A;  2E6W A;  2JXC A;  1B7T Y;  1JF2 A;  1LKJ A;  1VDD A;  4JCV E;  2F3Y A;  2KMR A;  1SR6 C;  3ZNI A;  2KMQ A;  1CE3 A;  1FPW A;  1OVO A;  1OMV A;  1QX7 A;  3EVV A;  1WDC C;  3BXK A;  2N71 A;  2SGQ I;  1DJH A;  2NCO A;  5DKN A;  3TDU A;  1B7T Z;  1Y1U A;  2JTZ A;  1J1D A;  1F8H A;  1K9U A;  3I5G B;  5GQQ C;  1OMT A;  1DJG A;  2KMP A;  5KSZ A;  1SKT A;  1CM1 A;  2R2I A;  4JWQ A;  1GJY A;  1W7J B;  1HQV A;  1BR4 B;  1SCM C;  4PE1 A;  1DVI A;  1TOT A;  4GPL B;  4JPZ B;  2K7C A;  3TDI A;  2WCF A;  1TUR A;  2M7L A;  2JC2 A;  2M9G A;  1CLL A;  4I5N B;  5KU1 A;  1K8U A;  1YUU A;  1OQP A;  1B8C A;  2KI4 C;  1MUX A;  3SG4 A;  1QVI Z;  1IQ3 A;  2NU3 I;  1NPQ A;  1F71 A;  1A75 B;  1QTX A;  3AKA A;  3DVM A;  4HRH A;  1BT6 A;  2MA2 A;  4AQI A;  1QV1 A;  2JXD A;  3VRN A;  1Y0V H;  2OTG B;  3PN7 C;  4YGD B;  5AXI A;  5CSJ A;  2KAX A;  1AVS A;  2QQE A;  1SMG A;  1SCV A;  1KFX S;  3TZ1 A;  5HYD A;  2KSP A;  1CDN A;  5CSF A;  1IKU A;  1DJY A;  2ZRT A;  2MHH A;  1B8L A;  1KFX L;  1BG1 A;  1ZFS A;  3DVK A;  1B9A A;  1B8R A;  3QTL D;  4MSP A;  2KCX A;  3I5I B;  2M5X A;  1UUS A;  1IW4 A;  1UHJ A;  1HDL A;  2B0U C;  3SEK C;  1MHO A;  1YRT B;  1QAT A;  3NSL A;  2N1A B;  3OL0 A;  3TDZ A;  3UGI A;  1FI5 A;  4GUK A;  5CSI A;  4E1P A;  5ER5 A;  1XFZ O;  2MLF C;  1DJI A;  1NUB A;  2GGZ A;  4MEW A;  1SRA A;  3BUO B;  1KK8 C;  3I5F B;  2J87 A;  3EK4 A;  3IF7 A;  2XRC A;  2KFF A;  3NSO A;  5AER A;  1J7P A;  1YUS A;  2FOT A;  4IL1 A;  2PMY A;  4NQG A;  4YGC B;  1XX6 A;  3TUY C;  1IY5 A;  2BL0 B;  4N5X A;  3CXL A;  1JF0 A;  2LUX A;  1SGP I;  5I2O A;  3JVT C;  1KK7 Y;  3PAT A;  2HF5 A;  1NP8 A;  1W4R A;  3TJQ A;  1RK9 A;  1TOP A;  4M2P A;  1KBE A;  1A75 A;  2NU2 I;  1PVA A;  1QJT A;  1NX2 A;  3I5H B;  3K21 A;  4OVO A;  1CLM A;  4PHM A;  5B8I B;  1KK7 Z;  2CNP A;  4UXH A;  1YX8 A;  2Y1N A;  1B47 A;  2JXL A;  1MWN A;  1S6C A;  4DS7 A;  1M8B A;  1KMA A;  2SGD I;  2KHN A;  1CGJ I;  4YI8 A;  2JW6 A;  4P5O E;  2L4I A;  4R1E A;  1PTQ A;  1G33 A;  4BY4 A;  2RGI A;  2LM5 A;  2GKR I;  2GV5 A;  2GVI A;  1JFK A;  1XFY O;  1EG4 A;  1CM4 A;  2LVI A;  1PTR A;  3OXG A;  3LL8 B;  1OZS A;  2NU1 I;  5HQ8 A;  2L98 A;  1W3S A;  1XFU O;  4PE0 A;  5D7F A;  3VRR A;  2ZRS A;  2JQ6 A;  2KFG A;  2LLS A;  1S5G Y;  2H61 A;  2SAS A;  3VRO A;  1A03 A;  4GGN A;  5EX3 A;  2HPS A;  1QV0 A;  2I2R E;  2MJW B;  1CT0 I;  2F3Z A;  3IQO A;  3JTD C;  1TCF A;  1D1O A;  3VDP A;  4N1G A;  2LLU A;  1XBT A;  2KQ6 A;  2E73 A;  4CLN A;  1S5G Z;  1SY9 A;  3A8R A;  1MQ1 A;  1AJ4 A;  2NCP A;  5EX0 A;  1QXP A;  1MXE A;  1UHK A;  1DMO A;  1FYB A;  1U5K A;  3UEY A;  5AFP A;  1QX5 B;  3D0Y A;  2HQW A;  2M97 A;  1PAL A;  3BUX B;  2FJU B;  4D1E A;  2FNF X;  1TIZ A;  3BUN B;  2J9R A;  2YUU A;  3SG6 A;  2G2B A;  2M49 B;  2JWW A;  4USL A;  3ICB A;  1YRU B;  2LMV A;  1BOD A;  1XK4 A;  2CCM A;  4ZCV A;  5CCL A;  2L50 A;  4ORC B;  2QQC A;  2Q91 A;  2LVV A;  1RWY A;  1A29 A;  4GGF A;  1AUI B;  1QIW A;  3O78 A;  3VRP A;  1J7O A;  1JWD A;  5DKR A;  4DIR A;  1MF8 B;  2ELI A;  3E59 A;  1XYD A;  2JPT A;  3CTN A;  3OB2 B;  2KFH A;  3PDN A;  2DIP A;  3CLN A;  2WVJ A;  2K7D A;  1F4Q A;  1UUC A;  1CTR A;  1N2D A;  2I18 A;  2ZN8 A;  1R0R I;  4I5L B;  5HKY A;  1Y1X A;  2Q4U A;  1GGZ A;  4A4B A;  1LIN A;  3PLF B;  2P6A C;  2V1C A;  5TNC A;  4GBA A;  5FUV A;  1LR8 A;  1FF1 A;  3AAJ A;  1N13 A;  1IH0 A;  4YBH B;  1ZMZ A;  2JT0 A;  1SL8 A;  4UXJ A;  4ORA B;  1ODB A;  2KMO A;  2CJS C;  4ORB B;  3BUW B;  1OMD A;  2JYY A;  2ZND A;  1AHR A;  5AEQ A;  3HH2 C;  1Y1C A;  1JSA A;  1C7W A;  2Y4Q A;  3NSK A;  2CT9 A;  2ENZ A;  1XFV O;  3I5G C;  3F45 A;  2JTT A;  3QRX A;  3TS5 B;  2QPT A;  2GGM A;  4UPG A;  4GAO A;  2NXQ A;  2L4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...