1BMOA

Bm-40, fs/ec domain pair
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
233
structure length
233
Chain Sequence
PCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BM-40
publication title Crystal structure of a pair of follistatin-like and EF-hand calcium-binding domains in BM-40.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Extracellular module
total genus 71
structure length 233
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
A PF09289 FOLN Follistatin/Osteonectin-like EGF domain
A PF10591 SPARC_Ca_bdg Secreted protein acidic and rich in cysteine Ca binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1bmoA02
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1bmoA01
2NLNA 4YI8A 5HYDA 2QQDA 4R1EA 1CTRA 2KOTA 1QX5B 1ZFSA 2TN4A 3E3RA 5KU1A 1ZACA 2LVVA 1NCYA 3DVKA 2BBMA 1MT1A 3FWBA 3OP0A 2WOSA 4BY5A 1BLQA 2KMRA 2LE9B 4ICBA 1TRFA 3GK1A 1CLMA 3PN7C 1RFJA 5FYXA 1OOJA 3EVRA 1SR6B 2Y4QA 1TN4A 1J7OA 3O78A 2PRUA 1A2XA 2JYYA 2L51A 1SCVA 1K94A 4GNKB 1LXFC 1S5GZ 2SGDI 1IQ5A 2K7OA 2JZMA 1CSOI 2CT9A 4XJKB 4MZLA 1CNPA 4DUQA 4MBEA 1SL8A 1N0YA 2LEOA 1A75A 1YTPA 1UHHA 2MLFC 3AKAA 2LLTA 3EVUA 1NYAA 2PALA 2ISDA 1HJAI 2BBNA 1M31A 2NU1I 3VRNA 4PE0A 2F2OA 1ALWA 1QIWA 3D0YA 1TOPA 1XO5A 1F55A 3VRRA 1PPFI 1QTXA 1CFPA 1A29A 1DGVA 1TCOB 1WDCB 2IS9A 1DJZA 2AAOA 4N5XA 2K7CA 1TBRR 1BT6A 4GPLB 2K7BA 2LMUA 1YX7A 1RECA 2O5GA 2KFGA 1CM1A 1NP8A 4PE1A 4MZKA 1K93D 1K9PA 1UVGA 1CMGA 2NU3I 5K89A 1NIWA 1DF0A 1CM4A 1OSAA 2KFHA 2SGQI 3FWCA 5I2OA 1B8LA 2KQYA 1BU3A 1L2OB 3D0YB 4M2QA 4OVOA 4ORBB 2MHHA 5DKRA 1KFUS 1NX0A 2M97A 1AJ5A 1M46A 3HH2C 1XYDA 3PM8A 1IGVA 4WQ2A 3KHEA 1B8RA 2N52A 3TJQA 1KQVA 5IBWA 1CT2I 1CT4I 2LHLA 4N1GA 2E30A 2BKHB 2LC5A 1OZOA 1M8CA 2KNEA 4PHNA 1CGII 2HQWA 1V1GA 2D8NA 2KAXA 1OZSA 2M9GA 1EL4A 1OMUA 3ZWHA 3FIAA 1TNXA 4YGEB 1N2DA 1FI5A 2ZN9A 1UUCA 3PN7B 2BCBA 2M3WA 1KFUL 1R6PA 1SK6D 2M7LA 4HRHA 1Y1CA 1YRTB 3RLZA 3NSIA 2QPTA 1Y1AA 1FYBA 4PDZA 3BUMB 2CXJA 4QJ3B 1SGRI 2SGFI 1BR1B 4U8DA 4GFTA 1LKJA 1SBJA 3EKHA 3CR4X 1W7IB 2R2IA 2HQ8A 4P2YB 4OVNF 1Q80A 4TNCA 2ZRSA 1DTLA 2H61C 1CB1A 3EK4A 1SPYA 1XFWO 2COLB 5CSIA 5DKQA 3VRPA 1JWDA 5CSNA 1MQ1A 1PVAA 4D1EA 1UHIA 4GGFC 5HLOA 2BL0C 1CDPA 1SGDI 2NXQA 1SGEI 1CKKA 3FS7A 1F4QA 4M2OA 1K2HA 1TURA 1NPQA 4ORAB 3TUYC 1TNWA 2LMVA 4NDBA 2KI6D 1JUOA 1AJ4A 2KYFA 1CFDA 1TCFA 1MUXA 1QX7A 4MVFA 1F70A 3SG5A 3QRXA 4DIRA 1OVOA 5G08A 2SGPI 3I5HC 5BPJA 2L4IA 4C0KA 1KMAA 3AAKA 1K95A 1XA5A 1XVJA 1H4BA 4OV2A 1GGZA 1YUTA 1TGSI 1FF1A 1QX2A 3BUNB 2JXLA 2KBMA 1U5IA 1JFJA 1KK8B 1UHKA 2E6WA 2ZRTA 2HPSA 4PALA 1PSRA 2EC6C 3TS5C 2OVOA 2CCMA 1XFUO 4P5OE 2G9BA 2L98A 2JTZA 1J7PA 1DGUA 2G2BA 3NSKA 4I5LB 2K7DA 2F3ZA 2LMTA 1PK0D 5AERA 1NX1A 1CDNA 4USLA 1KCYA 1EXRA 1EH2A 4AOMA 3LL8B 4YGCB 1G4YR 1S5GY 1U5IB 2LVIA 2L5XB 3DVJA 3TZ1A 3OB2B 5I2QA 2KI4C 1S1EA 1QIVA 1OE9B 2H61A 1YVHA 2ZNDA 1BMOA 2I7AA 3WNXB 4GGFA 5JJGA 3ICBA 1PALA 1K90D 3IQOA 2I2RE 4PHMA 1DJWA 3EK8A 2F8PA 3KEVA 3NSLA 3CZTX 1NWDA 1KFXL 3I5FC 1YUUA 4FTGA 5I8NA 3LLEA 1WRZA 2FJUB 2MRDA 2KMQA 2OTGC 1SNLA 1Y6WA 4BY4A 3LK1A 4CPVA 2PSRA 4NQGA 1JF2A 1FBVA 1NUBA 3JVTB 3GK2A 4PE7A 2EGDA 1NSHA 2BL0B 2LVJA 2NCOA 3DF0A 5KSZA 1KSMA 1WY9A 2LCPA 1BJFA 4GUKA 1BG1A 1W7JB 4UPGA 3TDIA 1LA0A 2F3YA 5AEQA 2KYCA 4CFQA 1JF0A 1UURA 2WC8A 2KDHA 1QVIZ 5D7FA 2WCFA 1S26D 1A75B 1KQMC 2KI6C 4ZCVA 2GKRI 2JNFA 2SGEI 3O4YA 2PVBA 1KWOB 4A4CA 2ZN8A 1KK7Z 4MLWA 2QACA 2WCYA 2KGRA 2JTTA 4N1FA 5CSFA 1C07A 2B1UA 1QASA 3I5IC 4OR9B 2JT0A 2GKVA 3CLNA 2ERWA 2LNKA 2L50A 1TNPA 2GGZA 2DOQA 3I5GC 5B8IB 4WQ3A 1S3PA 4XYNA 2EC6B 3TS5B 3ZNIA 1SKTA 3VROA 3DVEA 2Q4UA 1SMGA 2KFFA 3O6BA 3PFVA 1AHRA 3IQQA 3SGQI 1OMRA 1ZMZA 2LP2A 2WNDA 4MRYA 1CE3A 1FI6A 2EHBA 1DF0B 2K2AA 1R0RI 4MZJA 4Q04A 1MR8A 1CFCA 1SGNI 1OMVA 1B9AA 2ZKMX 5JHWC 2Y1MA 3SIBA 4E68A 1SYMA 1B7TZ 1K9UA 2JNXA 1IWQA 1CDLA 1DS3I 2BUSA 1IY6A 1AN1I 1PSBA 3A4UB 3EKJA 2CNPA 2KI4B 2JQ6A 1DMOA 1J55A 4YBHB 1CT0I 4WRIA 1QS7A 2L2EA 2N17A 1TTXA 1UWOA 3CGAA 4NDDA 1PJUA 2F3CI 1BUSA 1QATA 2JPTA 1GGWA 1ALVA 1YX8A 2M29A 1K8UA 1SCMC 3A8RA 1Y1XA 4MEWA 3AKBA 2KBIA 4PHKA 1QXPA 2AMIA 3PSRA 5DAEA 1H0ZA 2NU4I 4FQOA 1BOCA 2JT8A 1K9KA 3SG6A 2N71A 3NXAA 3I5FB 1G33A 2JOJA 2LUXA 2RGIA 3D10A 3EVVA 4HREE 1AVSA 4I5KA 2JU0A 1IJ5A 2M8UA 3BOWA 3SG3A 4F0ZB 5HKYA 2LHIA 1GJYA 1R2UA 2OTGB 2O60A 4L9MA 3VRQA 4AQIA 4JWQA 3SG2A 1DJXA 3BUXB 4DS7A 2H2KA 3HX4A 2ARPF 1S6JA 4ORCB 3TUYB 2QQCA 3OVOA 2LLSA 1IKUA 3TDZA 1RJVA 1IY5A 2K61A 5CPVA 2Q91A 3LK0A 1HDLA 1MHOA 1QJTA 1EJ3A 2SCPA 1J7QA 2FCDA 1MWNA 2GGMA 1IG5A 2JXCA 1ZOTB 4MRXA 1PRWA 1SW8A 1C7WA 1EG3A 2KSPA 2SASA 3HCMA 1BR4B 1N65A 1NCZA 2NCPA 3OHMB 1HPTA 1TNQA 1YVLA 2JULA 2M1UA 1S36A 5DKNA 1Y1BA 3CTNA 1IRJA 5HKZA 3WXAA 3WHUB 2JT3A 1B1GA 1CMFA 1SL7A 1UUSA 2M0RA 1GQMA 2OPOA 2MLEC 2ZFDA 2HF5A 2MBXA 1YUSA 1NX3A 1ZUZA 2K0JA 3PALA 1EG4A 2GKTI 2L0PA 1SL9A 1KFXS 2P6BB 5CSJA 1B47A 1LA3A 2LANA 1F8HA 2JZIA 4MN0A 4PHJA 2JWWA 1IH0A 1L7ZA 2JXDA 1AP4A 1UVFA 5KTYA 3F45A 1OMTA 1OYVI 2CTNA 2KAVA 3KF9A 1LR9A 1TIHA 1MXLC 2LVKA 2A4JA 1N13A 1BF5A 2OS8C 1LINA 3OX5A 5ER4X 5HLVA 5AANA 4DCKA 4YRUA 1CGJI 1SGYI 1SCMB 2LUCA 4OKHA 1QV0A 1YRUB 3C1VA 3WHTB 1F71A 2FCEA 1JSAA 1G8IA 1LVCD 1DT7B 2JRFA 2KGBC 1K96A 3B4VC 4XJKA 1D1OA 2FOTA 5GQQC 1QVIY 5PALA 2XRCA 1KSOA 2PASA 1H8BA 1KK7Y 2KMPA 2LP3A 1C7VA 2VRGA 1RK9A 4NDCA 2BKIB 4JQ0D 1E8AA 1SRAA 1Y0VH 3H4SE 5TNCA 1WLZA 1M8BA 3OB1B 1TIZA 3VGOA 1X02A 3AAJA 3DVMA 1WLMA 1TBQR 3I5HB 4M2PA 2BCXA 1M39A 1J1EA 4GBAA 3DF0B 1HT9A 1BODA 3CR5X 3SG7A 2BE6A 3JTDC 4IL1A 4CLNA 2I18A 1XK4C 2WORA 4GAOA 1B7TY 4YGBB 2MJWB 2KAYA 1SGQI 2ZNEA 1WRLA 2BE4A 4QJ5B 1CFFA 3K21A 4YI9A 4MSPA 1UP5A 1JC2A 2Y5IA 1Z7KB 3EK7A 5D69A 1RROA 1CLLA 3RM1A 1AK8A 1CHOI 1IJ6A 3BXKA 2WCEA 1MF8B 5HKWA 1KK8C 1YR5A 3KO0A 1DJIA 1S6CA 2NZ0A 3GOFA 2LLUA 3IF7A 3SIAA 4A4BA 4JPZB 2F2PA 1YU6C 2B0UC 1FW4A 2L4HA 1RWYA 4YGAA 1RTP1 3GK4X 3TDUA 2PMYA 3O2PA 2LAPA 2M49B 1DS2I 2LM5A 4DRWA 4PE4A 1SGPI 1XFXO 3SG4A 4HGUA 4SGBI 1OQPA 4ZCUA 2V53A 2WCBA 3BUWB 2OS8B 3BQ3A 2CBLA 1QLSA 3CWGA 4GGNA 1PCEA 4AQJA 5JOLA 4I5NB 2BECA 5J3XA 4C0JA 1CDMA 4HRGA 3SEKC 1DJYA 4C0LA 4QJ4B 1YTZC 5ER5A 1F4OA 3QTLD 2HETA 4ETOA 1SR6C 1JFKA 1B8CA 3DD4A 3PLFB 2NU0I 1JBAA 2KQ6A 1ODBA 1XFZO 1XFYO 2K2FA 2M5XA 2P6AC 2Y1NA 1YURA 3KPXA 1J7RA 5I2LA 5AXIA 2GV5A 1XK4A 3NSOA 2MA2A 1J1DA 3BYAA 3LCPC 1SY9A 2F33A 2I94A 1TUSA 1VRKA 3BUOB 1LR8A 3CS1A 1QLKA 3BOWB 4CFRA 1KQMB 4HSZA 1IQ3A 1PULA 4GI3C 2K8MB 1S6IA 3M0WA 3PATA 1QV1A 3JVTC 1UHJA 1Y1UA 2JC2A 1NCXA 3I5IB 1PVBA 4YGDB 4CIDA 1WDCC 3JTDB 1XFVO 4OCIA 1DVIA 2KMOA 3I5GB 4PCWA 1CLBA 1A4PA 3SGBI 1OMDA 2AUCA 2BCAA 4I5JA 1B4CA 3MSEB 1KWOC 3OX6A 1LR7A 1AUIB 1IW4A 5F6TA 1NX2A 1FPWA 2KHNA 2NU2I 2KCXA 1WRKA 1L2OC 1HQVA 1DJHA 1M63B 3CR2A 1M45A 5AFPA 1UHNA 2M7NA 1MXEA 1DJGA 1V1FA 2MAZA 1A03A 2M1KB 3SJSA 2LV7A 1F54A
chains in the Genus database with same CATH superfamily
2NLNA 4YI8A 3E3RA 5KU1A 3DVKA 3FWBA 3OP0A 2WOSA 4BY5A 2LE9B 3GK1A 2WCKA 3MEKA 1TN4A 1K94A 1S5GZ 1P9GA 2CT9A 1IIOA 1TUJA 4DUQA 1SL8A 3AKAA 1NYAA 2PALA 3VRRA 1PPFI 1CFPA 1DGVA 1TCOB 4N5XA 4GPLB 4IJ7A 1P28A 1RFHA 1CM1A 2ELIA 4INXA 1CM4A 3GOXA 3D0YB 1DQEA 1FARA 1M46A 3HH2C 2FNFX 1IGVA 2N52A 1CT2I 1CT4I 2PQ8A 2K9HA 2LC5A 3D77A 1CGII 2HQWA 2KAXA 2M9GA 1OMUA 3PN7B 2BCBA 3RLZA 3NSIA 2W0TA 1FYBA 4QJ3B 1SGRI 1BR1B 1LKJA 3CR4X 1OOIX 4P2YB 2QEBA 4TNCA 2ZRSA 4WP4A 2H61C 3EK4A 2COLB 1PVAA 5HLOA 3FS7A 1F4QA 1NPQA 2LMVA 1AJ4A 2KYFA 1CFDA 1QX7A 1F70A 1OVOA 4E1RA 3CZ2A 3I5HC 5BPJA 4C0KA 1YUTA 4PT1A 3EG5B 2E6WA 2HPSA 2CCMA 1XFUO 1OW4A 2K60A 4UXHA 1V1HA 3LL8B 1S5GY 3SS5A 1U5IB 1Z2CB 1QIVA 1OE9B 2H61A 1K7VA 2I7AA 2I2RE 1K7TA 5FUWA 5I8NA 1Y6WA 4CPVA 2PSRA 5EL2A 3GK2A 2WCYA 1NSHA 1BJFA 2Y0MA 1W7JB 1LA0A 3UO9A 2KYCA 1UURA 2WC8A 3UGDA 5D7FA 2JNFA 3O4YA 2ZN8A 1KK7Z 2QACA 2JTTA 4N1FA 3I5IC 2GKVA 2DOQA 5B8IB 1SKTA 2Q4UA 3O6BA 2KFFA 3PFVA 1OMRA 2EHBA 2K2AA 1B9AA 2ZKMX 5FI7A 5JHWC 1SYMA 3EKJA 4WRIA 1QS7A 1TTXA 3CGAA 4NDDA 2F3CI 2JPTA 1ALVA 1YX8A 1K8UA 3CDNA 4MEWA 1QXPA 3PJIA 2NU4I 4JKTA 3I5FB 2RGIA 3BOWA 2LHIA 4AQIA 3SG2A 4DS7A 2ARPF 4ORCB 1EJ3A 1J7QA 2GGMA 1ORGA 1ZOTB 4MRXA 1C7WA 2KSPA 2SASA 2J87A 5DKNA 1S36A 3D74A 3S0FA 1IRJA 1B1GA 1SL7A 2MLEC 1ZUZA 3PALA 2ENNA 2L0PA 1LA3A 2QQEA 1IH0A 4PHJA 1OYVI 3KF9A 2LVKA 2A4JA 1LINA 4DCKA 1SGYI 3R5BA 3B7AA 3WHTB 1G8IA 1K96A 5PALA 2PASA 1H8BA 1KK7Y 1C7VA 2BKIB 2WCHA 5J8FA 1TIZA 3VGOA 3DVMA 3AAJA 3I5HB 4M2PA 2UZ3A 3K1EA 1HT9A 1V1IA 3SG7A 1Q9BA 2ROWA 1XK4C 2ENZA 2L8EA 1SGQI 1CFFA 3B86A 4MSPA 1CLLA 1AK8A 1IJ6A 5HI7A 1KK8C 3KO0A 1DJIA 2NZ0A 3SIAA 1YU6C 1FW4A 3GK4X 2M49B 4PE4A 2V53A 3BQ3A 1CDMA 4QJ4B 2HETA 1JFKA 2L5YA 1WKXA 1Z4HA 4MPIA 2GV5A 1XK4A 2F33A 3NHIA 1TUSA 3CS1A 3BOWB 4HSZA 3OGNA 1QV1A 3I5IB 1NCXA 1XFVO 1DVIA 3D78A 3SGBI 3DZTA 2NU2I 1DJHA 3PM2A 1A03A 3SJSA 1F54A 2ERBA 2QQDA 1CTRA 3S0AA 1DC1A 2LVVA 1NCYA 1WGTA 1BLQA 2KMRA 2WC6A 2X52A 3PN7C 3EVRA 3O78A 2PRUA 1LXFC 1GM0A 2SGDI 1IQ5A 2JZMA 1LS8A 4MBEA 5D3OA 1N0YA 2LEOA 2PQLA 1A75A 4E1PA 1M31A 2NU1I 4PE0A 1Z2IA 3L4AA 3D0YA 1TOPA 1XO5A 1F55A 1WDCB 1DJZA 1RECA 2O5GA 1NP8A 3FSXA 1UVGA 2NU3I 1DF0A 5I2OA 1B8LA 2WCMA 4JD9A 4M2QA 2MHHA 1XYDA 1KBEA 2LHLA 4N1GA 1EL4A 3ZWHA 3FIAA 1FI5A 3E59A 3L47A 1KFUL 2CWGA 3VE5A 2QDIA 4U8DA 3O4XA 1SBJA 3EKHA 4OVNF 1SPYA 5CSIA 5DKQA 1NXUA 1MQ1A 2N1AB 1CDPA 1SGEI 1CKKA 4M2OA 1TURA 3R5AA 4ORAB 3FE9A 3TO9A 3N7HA 2KLEA 1KMAA 3AAKA 1K95A 1XVJA 1TGSI 1FF1A 1QX2A 3BUNB 1U5IA 1KK8B 7WGAA 2ZRTA 1PSRA 4P5OE 2L98A 2JTZA 4INWA 1FY7A 5CCMA 1EH2A 4YGCB 1YVHA 1OOGA 2QPOA 5DICA 3R5CA 2YGUA 1K90D 3IQOA 3EK8A 1NWDA 3I5FC 2L7XA 1YUUA 4FTGA 2KMQA 1SNLA 1TOTA 2V1CA 1JF2A 1NUBA 2BL0B 5AEQA 1JF0A 1QVIZ 1A75B 2KI6C 2KGRA 4OR9B 2JT0A 2L50A 2EC6B 3DVEA 1AHRA 3SGQI 2LP2A 1FI6A 1DF0B 1R0RI 4MZJA 4Q04A 1SGNI 2Y1MA 3SIBA 2JNXA 1DS3I 1CDLA 1AN1I 1PSBA 2KI4B 4YBHB 1PJUA 1GGWA 1DELA 2M29A 3A8RA 1Y1XA 4B6DA 2KBIA 3R5DA 3NXAA 2JOJA 2LUXA 4HREE 3EVVA 2JU0A 5HKYA 3SG3A 3V2LA 3VRQA 1DJXA 2H2KA 1S6JA 3TUYB 3TDZA 4FQTA 5CPVA 3LK0A 1MWNA 1PRWA 1TNQA 1Y1BA 1QWVA 5HL1A 5HKZA 3WXAA 1TWOA 2JT3A 1UUSA 2OPOA 1YUSA 2GKTI 1SL9A 1KFXS 2P71A 4JCVE 3B6XA 2LANA 1F8HA 3IVTA 4MN0A 2JWWA 2JXDA 1AP4A 2RIJA 1TIHA 5FUXA 1BF5A 5HLVA 1CGJI 1SCMB 2P70A 1YRUB 1F71A 3C1VA 2FCEA 1JSAA 4XJKA 1D1OA 5GQQC 1QVIY 3B87A 4NDCA 1SRAA 3D73A 1X02A 1WLMA 1BODA 1TBOA 4CLNA 2I18A 2WORA 3BJIA 2MJWB 2BE4A 4QJ5B 1XFRA 3K21A 2KLDA 1JC2A 2CJSC 2Y5IA 3EK7A 5D69A 3RM1A 3SS4A 1YR5A 1S6CA 2LLUA 4JPZB 2F2PA 2L4HA 1RWYA 4YGAA 1RTP1 2LAPA 1DS2I 4SGBI 1OQPA 4ZCUA 4GGNA 4AQJA 5JOLA 4I5NB 2CWFA 2BECA 4HRGA 1YTZC 5ER5A 3QTLD 4UXJA 2DB6A 1B8CA 3DD4A 1XBTA 2WCJA 1XFZO 3OL0A 1UHAA 3BJHA 2P6AC 2Y1NA 1YURA 3KPXA 1HEVA 2K8MB 3PATA 4YGDB 1WDCC 3JTDB 1OMDA 4I5JA 2PYQA 3MSEB 1KWOC 5F6TA 2KHNA 9WGAA 1OOFA 3B88A 1M45A 2M7NA 1MXEA 1DJGA 3CXLA 2M1KB 5HYDA 2KOTA 1QX5B 2TN4A 1ZACA 1S20A 3RZSA 1WTJA 4ICBA 1TRFA 2DKVA 1RFJA 5FYXA 1OOJA 3NGVA 1SR6B 2Y4QA 2ORWA 5E3PA 1A2XA 2JYYA 2RC4A 4XJKB 4MZLA 1UHHA 3EVUA 1HJAI 2BBNA 2F2OA 1ALWA 1QIWA 1QTXA 1A29A 2GVIA 2AAOA 1BT6A 2K7BA 4PE1A 4MZKA 1K93D 2SGQI 2KFHA 2KQYA 1R79A 4OVOA 4ORBB 5DKRA 1KFUS 1NX0A 2M97A 1C3YA 1AJ5A 3PM8A 4WQ2A 3KHEA 1B8RA 1KQVA 4KYNA 1OZOA 2KNEA 4PHNA 1V1GA 3NHTA 1N2DA 2M3WA 1R6PA 1SK6D 1YRTB 2QPTA 1W9ZA 3UNWA 3S0DA 4PDZA 3BUMB 2SGFI 4GFTA 2HQ8A 1XX6A 1Q80A 1CB1A 3VRPA 1JWDA 2QEOA 1VDDA 2BL0C 1SGDI 1TUZA 1TNWA 4NDBA 2KI6D 3UFFA 5I94A 4MVFA 3SG5A 3QRXA 4DIRA 5G08A 3FE8A 1H4BA 4OV2A 1GGZA 1JFJA 1UHKA 2B8TA 4PALA 2EC6C 3FSYA 2G2BA 3NSKA 2F3ZA 1CDNA 3CYZA 3VDUA 3E2IA 1EXRA 3CABA 2LVIA 2L5XB 3DVJA 3TZ1A 3OB2B 5I2QA 2KI4C 1S1EA 2KPHA 3ICBA 1PALA 1DJWA 3QMEA 2F8PA 3LLEA 1WRZA 2FJUB 4BY4A 3LK1A 3D76A 4NQGA 1KBFA 1FBVA 3TUYC 2EGDA 3DF0A 2LVJA 2NCOA 5KSZA 1KSMA 2LCPA 4GUKA 1BG1A 3TDIA 4CFQA 2WCFA 2SGEI 1KWOB 5CSFA 1C07A 1MJAA 2E73A 3CLNA 3CZ1A 2ORVA 2ODDA 3I5GC 3TS5B 4XYNA 1PTQA 1SMGA 3IQQA 5EX3A 1ZMZA 1X74A 1OMVA 1B7TZ 1K9UA 1IY6A 2BUSA 3A4UB 3OBVA 2CNPA 2JQ6A 1DMOA 5E3RA 1CT0I 2N17A 1BUSA 1SCMC 1DEKA 1Y8FA 2AMIA 3PSRA 1H0ZA 2L2CA 4FQOA 1BOCA 2JT8A 1K9KA 3SG6A 2N71A 4F0ZB 1IJ5A 2OTGB 2O60A 2LB7A 4JWQA 3HX4A 3OVOA 3TO6A 2K61A 5FI2A 2OD1A 2SCPA 2FCDA 2V1CC 2JXCA 1SW8A 1EG3A 3HCMA 1NCZA 3OHMB 2JULA 3WHUB 1GQMA 2ZFDA 2MBXA 1NX3A 1EG4A 5CSJA 1L7ZA 1UVFA 1P9ZA 3F45A 1OMTA 2CTNA 2BNXA 1MXLC 2E5RA 2VRWB 2YUUA 1N13A 5ER4X 4YRUA 1MJ9A 2JRFA 3B4VC 2FOTA 2XRCA 2LP3A 5J8CA 2VRGA 1RK9A 4UXIA 1C3ZA 1E8AA 1Y0VH 3H4SE 5TNCA 1WLZA 1M8BA 1TBQR 4GBAA 1J1EA 3DF0B 3CR5X 3S0BA 3JTDC 3TOBA 4IL1A 1B7TY 2KAYA 2ZNEA 4YI9A 1UP5A 1CHOI 1PTRA 2WCEA 2GIVA 1MF8B 1ULKA 5HKWA 3BFBA 4A4BA 3IF7A 3OXLA 2B0UC 3TDUA 3O2PA 3UOEA 1SGPI 4HGUA 1XFXO 3BUWB 2OS8B 2CBLA 1PCEA 3SEKC 4C0LA 3TOAA 1SR6C 3PLFB 2QEHA 2NU0I 2KQ6A 1ODBA 3DY9A 2K2FA 2M5XA 5I2LA 5AXIA 3LCPC 1J1DA 3BYAA 2JW6A 1SY9A 4FKDA 4CFRA 1IQ3A 4GI3C 3M0WA 3JVTC 1UHJA 1Y1UA 2JC2A 4CIDA 4OCIA 3I5GB 4PCWA 1CLBA 2BCAA 2AUCA 1B4CA 1AUIB 1NX2A 2KCXA 3CR2A 1V1FA 5E3QA 4R1EA 3R1PA 1ZFSA 3FE6A 1MT1A 2BBMA 3S0GA 2OU2A 5FUVA 5FI6A 3VDPA 1CLMA 2X3TA 1J7OA 2L51A 1SCVA 4GNKB 1T14A 2K7OA 1CSOI 1CNPA 3OXGA 5EX0A 1YTPA 2MLFC 2LUYA 2LLTA 2ISDA 3VRNA 2BAPA 2WGCA 2IS9A 2K7CA 1TBRR 2LMUA 1YX7A 2KFGA 2DIPA 1K7UA 1K9PA 1CMGA 4F7FA 5K89A 1NIWA 1OSAA 3FWCA 1BU3A 1L2OB 5CCLA 3TJQA 4DNCA 2JPOA 5IBWA 2E30A 2BKHB 1M8CA 2D8NA 1OZSA 2A20A 1TNXA 4YGEB 1UUCA 2ZN9A 2M7LA 4HRHA 1Y1CA 1Y1AA 3RU0A 2CXJA 1W7IB 2R2IA 3FC3A 1DTLA 3R72A 1XFWO 5CSNA 4D1EA 1UHIA 4GGFC 2NXQA 1K2HA 1JUOA 4OZDA 1TCFA 1MUXA 2SGPI 2L4IA 1XA5A 3S0EA 2JXLA 2KBMA 4A24A 3TS5C 2OVOA 2G9BA 1J7PA 1DGUA 4I5LB 2K7DA 2LMTA 1PK0D 5AERA 1NX1A 1FAQA 4USLA 1KCYA 4AOMA 1MJBA 1G4YR 3BFAA 2ZNDA 5HQ8A 1BMOA 3WNXB 4GGFA 5JJGA 2J9RA 4PHMA 2QEVA 3KEVA 3NSLA 3CZTX 1KFXL 2MRDA 2OTGC 4AMLA 3JVTB 4PE7A 1WY9A 4UPGA 2F3YA 3SS3A 2KDHA 3KY9A 1S26D 1KQMC 2GKRI 3QWPA 4ZCVA 2PVBA 3Q8IA 4A4CA 4MLWA 2B1UA 1QASA 2ERWA 2LNKA 1TNPA 2GGZA 4WQ3A 1S3PA 3ZNIA 3VROA 1CE3A 2WNDA 4MRYA 1CFCA 1MR8A 4E68A 1IWQA 1J55A 2L2EA 1UWOA 1QATA 3D00A 3AKBA 4PHKA 3UEYA 5DAEA 3UGIA 1G33A 3D10A 4I5KA 2JA1A 1AVSA 2M8UA 1GJYA 1R2UA 2WVJA 4L9MA 3BUXB 2QQCA 2LLSA 1IKUA 3UEJA 1RJVA 1IY5A 2Q91A 1HDLA 1MHOA 1QJTA 1IG5A 1BR4B 1N65A 2NCPA 1HPTA 1YVLA 2M1UA 3CTNA 3R1OA 1CMFA 2M0RA 1W4RA 2HF5A 2K0JA 2P6BB 2WC5A 1B47A 2JZIA 5KTYA 2OZUA 2KAVA 1LR9A 2OS8C 3BFHA 3OX5A 5AANA 2LUCA 4OKHA 1QV0A 2CWHA 1LVCD 1DT7B 2KGBC 3R1VA 1KSOA 2KMPA 4JQ0D 3OXFA 1ULNA 2GTEA 1W3SA 3OB1B 2YQPA 2BCXA 1M39A 2UVOA 2BE6A 1OOHA 5FUYA 4GAOA 4YGBB 1WRLA 1Z7KB 1XA6A 2QQ0A 1RROA 1X4SA 2H8VA 3PDNA 3BXKA 3GOFA 2WCLA 2PMYA 2LM5A 4DRWA 3SG4A 2WCBA 1QLSA 3CWGA 5J3XA 4C0JA 1DJYA 1F4OA 3L4LA 4ETOA 3CZ0A 1JBAA 1U5KA 1TBNA 1XFYO 1J7RA 1ULMA 1SSEB 1WGCA 3NSOA 2MA2A 2I94A 3TO7A 1VRKA 3BUOB 1LR8A 1QLKA 1KQMB 1PULA 3QAHA 1S6IA 3UGLA 1PVBA 3VB1A 2KMOA 1A4PA 3OX6A 1LR7A 1IW4A 1FPWA 3D75A 3DXLA 1WRKA 2FJYA 1L2OC 1HQVA 1M63B 5AFPA 1UHNA 2MAZA 3DYEA 2LV7A
chains in the Genus database with same CATH topology
2NLNA 4YI8A 5HYDA 2QQDA 4R1EA 1CTRA 2KOTA 1QX5B 1ZFSA 2TN4A 3E3RA 5KU1A 1ZACA 2LVVA 1NCYA 3DVKA 2BBMA 1MT1A 3FWBA 3OP0A 2WOSA 4BY5A 1BLQA 2KMRA 5FUVA 2LE9B 3VDPA 4ICBA 1TRFA 3GK1A 1CLMA 3PN7C 1RFJA 5FYXA 1OOJA 3EVRA 1SR6B 2Y4QA 2ORWA 3MEKA 1TN4A 1J7OA 3O78A 2PRUA 1A2XA 2JYYA 2L51A 1SCVA 1K94A 4GNKB 1LXFC 1S5GZ 2SGDI 1IQ5A 2K7OA 2JZMA 1CSOI 2CT9A 4XJKB 4MZLA 1CNPA 4DUQA 4MBEA 1SL8A 3OXGA 1N0YA 2LEOA 5EX0A 1A75A 1YTPA 1UHHA 2MLFC 3AKAA 2LUYA 2LLTA 3EVUA 1NYAA 2PALA 2ISDA 1HJAI 4E1PA 2BBNA 1M31A 2NU1I 3VRNA 4PE0A 2F2OA 1ALWA 1QIWA 3D0YA 1TOPA 1XO5A 1F55A 3VRRA 1PPFI 1QTXA 1CFPA 1A29A 1DGVA 1TCOB 2GVIA 1WDCB 2IS9A 1DJZA 2AAOA 4N5XA 2K7CA 1TBRR 1BT6A 4GPLB 2K7BA 2LMUA 1YX7A 1RECA 2O5GA 2KFGA 1RFHA 1CM1A 1NP8A 4PE1A 2DIPA 4MZKA 1K93D 1K9PA 1UVGA 2ELIA 1CMGA 2NU3I 5K89A 1NIWA 1DF0A 1CM4A 1OSAA 2KFHA 2SGQI 3FWCA 5I2OA 1B8LA 2KQYA 1R79A 3GOXA 1BU3A 1L2OB 3D0YB 4M2QA 4OVOA 4ORBB 2MHHA 5DKRA 1KFUS 1NX0A 2M97A 1FARA 1AJ5A 5CCLA 1M46A 3HH2C 2FNFX 1XYDA 3PM8A 1IGVA 4WQ2A 3KHEA 1B8RA 2N52A 3TJQA 1KBEA 1KQVA 5IBWA 1CT2I 1CT4I 2LHLA 4N1GA 2E30A 2BKHB 2K9HA 2LC5A 1OZOA 1M8CA 2KNEA 4PHNA 1CGII 2HQWA 1V1GA 2D8NA 2KAXA 1OZSA 2M9GA 2A20A 1EL4A 1OMUA 3ZWHA 3FIAA 1TNXA 4YGEB 1N2DA 1FI5A 2ZN9A 1UUCA 3PN7B 3E59A 2BCBA 2M3WA 1KFUL 1R6PA 1SK6D 2M7LA 4HRHA 1Y1CA 1YRTB 3RLZA 3NSIA 2QPTA 2W0TA 1Y1AA 1FYBA 4PDZA 3BUMB 2CXJA 4QJ3B 1SGRI 2SGFI 3RU0A 3VE5A 1BR1B 4U8DA 4GFTA 1LKJA 1SBJA 3EKHA 3CR4X 1W7IB 2R2IA 2HQ8A 4P2YB 3FC3A 4OVNF 1Q80A 4TNCA 2ZRSA 1DTLA 1XX6A 2H61C 1CB1A 3EK4A 1SPYA 1XFWO 2COLB 5CSIA 5DKQA 3VRPA 1JWDA 5CSNA 1MQ1A 1PVAA 4D1EA 1UHIA 4GGFC 1VDDA 5HLOA 2BL0C 2N1AB 1CDPA 1SGDI 2NXQA 1SGEI 1CKKA 3FS7A 1F4QA 4M2OA 1K2HA 1TURA 1NPQA 4ORAB 3TUYC 1TNWA 2LMVA 4NDBA 2KI6D 3UFFA 1JUOA 1AJ4A 2KYFA 1CFDA 1TCFA 1MUXA 1QX7A 4MVFA 1F70A 3SG5A 3QRXA 4DIRA 1OVOA 4E1RA 5G08A 2SGPI 3I5HC 5BPJA 2L4IA 4C0KA 1KMAA 3AAKA 1K95A 1XA5A 1XVJA 1H4BA 4OV2A 1GGZA 1YUTA 1TGSI 1FF1A 1QX2A 3BUNB 2JXLA 2KBMA 1U5IA 1JFJA 1KK8B 4A24A 1UHKA 2E6WA 2ZRTA 2HPSA 4PALA 1PSRA 2EC6C 3TS5C 2B8TA 2CCMA 2OVOA 1XFUO 4P5OE 2G9BA 2L98A 2JTZA 1J7PA 1DGUA 2G2BA 3NSKA 4I5LB 2K7DA 2F3ZA 2LMTA 1PK0D 5AERA 1NX1A 1FAQA 1CDNA 4USLA 3VDUA 3E2IA 5CCMA 1KCYA 1EXRA 1EH2A 4UXHA 4AOMA 1V1HA 3LL8B 4YGCB 1G4YR 1S5GY 1U5IB 2LVIA 2L5XB 3DVJA 3TZ1A 3OB2B 5I2QA 2KI4C 1S1EA 1QIVA 1OE9B 2H61A 1YVHA 2ZNDA 5HQ8A 2QPOA 1BMOA 2I7AA 3WNXB 4GGFA 5JJGA 3ICBA 1PALA 1K90D 3IQOA 2J9RA 2I2RE 4PHMA 1DJWA 3EK8A 2F8PA 3KEVA 3NSLA 5FUWA 3CZTX 1NWDA 1KFXL 3I5FC 2L7XA 1YUUA 4FTGA 5I8NA 3LLEA 2JA1A 1WRZA 2FJUB 2MRDA 2KMQA 2OTGC 1SNLA 1Y6WA 4BY4A 3LK1A 4CPVA 1TOTA 2V1CA 2PSRA 4NQGA 1JF2A 1KBFA 1FBVA 1NUBA 3JVTB 3GK2A 4PE7A 2EGDA 1NSHA 2BL0B 2LVJA 2NCOA 3DF0A 5KSZA 1KSMA 1WY9A 2LCPA 1BJFA 4GUKA 1BG1A 1W7JB 4UPGA 3TDIA 1LA0A 2F3YA 5AEQA 2KYCA 4CFQA 1JF0A 1UURA 2WC8A 3UGDA 2KDHA 1QVIZ 5D7FA 2WCFA 1S26D 3KY9A 1A75B 1KQMC 2KI6C 4ZCVA 2GKRI 2JNFA 2SGEI 3QWPA 3O4YA 2PVBA 1KWOB 4A4CA 2ZN8A 1KK7Z 4MLWA 2QACA 2WCYA 2KGRA 2JTTA 4N1FA 5CSFA 1C07A 2B1UA 1QASA 3I5IC 4OR9B 2E73A 2JT0A 2GKVA 3CLNA 2ERWA 2LNKA 2L50A 1TNPA 2ORVA 2GGZA 2DOQA 2ODDA 3I5GC 5B8IB 4WQ3A 1S3PA 4XYNA 2EC6B 3TS5B 3ZNIA 1SKTA 3VROA 3DVEA 1PTQA 2Q4UA 1SMGA 2KFFA 3O6BA 3PFVA 1AHRA 3IQQA 5EX3A 3SGQI 1OMRA 1ZMZA 2LP2A 2WNDA 4MRYA 1CE3A 1FI6A 2EHBA 1DF0B 2K2AA 1R0RI 4MZJA 4Q04A 1MR8A 1CFCA 1SGNI 1X74A 1OMVA 1B9AA 2ZKMX 5JHWC 2Y1MA 3SIBA 4E68A 1SYMA 1B7TZ 1K9UA 2JNXA 1IWQA 1CDLA 1DS3I 2BUSA 1IY6A 1AN1I 1PSBA 3A4UB 3EKJA 2CNPA 2KI4B 2JQ6A 1DMOA 1J55A 4YBHB 1CT0I 4WRIA 1QS7A 2L2EA 2N17A 1TTXA 1UWOA 3CGAA 4NDDA 1PJUA 2F3CI 1BUSA 1QATA 2JPTA 1GGWA 1ALVA 1YX8A 2M29A 1K8UA 1SCMC 3A8RA 3D00A 1Y1XA 4MEWA 4B6DA 3AKBA 2KBIA 4PHKA 3UEYA 1QXPA 1Y8FA 2AMIA 3PSRA 5DAEA 1H0ZA 2NU4I 4FQOA 1BOCA 3UGIA 2JT8A 1K9KA 3SG6A 2N71A 3NXAA 3I5FB 1G33A 2JOJA 2LUXA 2RGIA 3D10A 3EVVA 4HREE 1AVSA 4I5KA 2JU0A 1IJ5A 2M8UA 3BOWA 3SG3A 4F0ZB 5HKYA 2LHIA 1GJYA 1R2UA 2OTGB 2O60A 2WVJA 4L9MA 3VRQA 4AQIA 4JWQA 3SG2A 1DJXA 3BUXB 4DS7A 2H2KA 3HX4A 2ARPF 1S6JA 4ORCB 3TUYB 2QQCA 3OVOA 2LLSA 1IKUA 3TDZA 3UEJA 1RJVA 1IY5A 2K61A 5CPVA 2Q91A 3LK0A 1HDLA 2OD1A 1MHOA 1QJTA 1EJ3A 2SCPA 1J7QA 2FCDA 1MWNA 2GGMA 2V1CC 1IG5A 2JXCA 1ZOTB 4MRXA 1PRWA 1SW8A 1C7WA 1EG3A 2KSPA 2SASA 3HCMA 1BR4B 2J87A 1N65A 1NCZA 2NCPA 3OHMB 1HPTA 1TNQA 1YVLA 2JULA 2M1UA 1S36A 5DKNA 1Y1BA 3CTNA 1IRJA 5HKZA 3WXAA 3WHUB 2JT3A 1B1GA 1CMFA 1SL7A 1UUSA 2M0RA 1GQMA 2OPOA 2MLEC 2ZFDA 2HF5A 2MBXA 1W4RA 1YUSA 1NX3A 1ZUZA 2K0JA 3PALA 2ENNA 1EG4A 2GKTI 2L0PA 1SL9A 1KFXS 2P6BB 4JCVE 5CSJA 1B47A 1LA3A 2LANA 2QQEA 1F8HA 2JZIA 4MN0A 4PHJA 2JWWA 1IH0A 1L7ZA 2JXDA 1AP4A 1UVFA 5KTYA 3F45A 1OMTA 1OYVI 2CTNA 2KAVA 3KF9A 1LR9A 1TIHA 1MXLC 2E5RA 2LVKA 2VRWB 2YUUA 5FUXA 2A4JA 1N13A 1BF5A 2OS8C 1LINA 3OX5A 5ER4X 5HLVA 5AANA 4DCKA 4YRUA 1CGJI 1SGYI 1SCMB 2LUCA 4OKHA 1QV0A 1YRUB 3C1VA 3WHTB 1F71A 2FCEA 1JSAA 1G8IA 1LVCD 1DT7B 2JRFA 2KGBC 1K96A 3B4VC 4XJKA 1D1OA 2FOTA 5GQQC 1QVIY 5PALA 2XRCA 1KSOA 2PASA 1H8BA 1KK7Y 2KMPA 2LP3A 1C7VA 2VRGA 1RK9A 4UXIA 4NDCA 2BKIB 4JQ0D 3OXFA 1E8AA 1SRAA 1Y0VH 1W3SA 3H4SE 5TNCA 1WLZA 1M8BA 3OB1B 1TIZA 3VGOA 1X02A 3AAJA 3DVMA 1WLMA 1TBQR 3I5HB 4M2PA 2UZ3A 2YQPA 2BCXA 1M39A 1J1EA 4GBAA 3DF0B 1HT9A 1BODA 3CR5X 1V1IA 3SG7A 1TBOA 2BE6A 3JTDC 4IL1A 2ROWA 5FUYA 4CLNA 2I18A 1XK4C 2WORA 4GAOA 1B7TY 4YGBB 2ENZA 2L8EA 3BJIA 2MJWB 2KAYA 1SGQI 2ZNEA 1WRLA 2BE4A 4QJ5B 1CFFA 3K21A 4YI9A 4MSPA 1UP5A 1JC2A 2Y5IA 1XA6A 3EK7A 5D69A 1RROA 1X4SA 1Z7KB 2CJSC 2QQ0A 1CLLA 3RM1A 1AK8A 1CHOI 1IJ6A 3PDNA 3BXKA 1PTRA 2WCEA 1MF8B 5HI7A 5HKWA 1KK8C 1YR5A 3KO0A 1DJIA 1S6CA 2NZ0A 3GOFA 2LLUA 3IF7A 3SIAA 4A4BA 4JPZB 2F2PA 1YU6C 3OXLA 2B0UC 1FW4A 2L4HA 1RWYA 4YGAA 1RTP1 3GK4X 3TDUA 2PMYA 3O2PA 2LAPA 2M49B 1DS2I 2LM5A 4DRWA 4PE4A 1SGPI 1XFXO 3SG4A 4HGUA 4SGBI 1OQPA 4ZCUA 2V53A 2WCBA 3BUWB 2OS8B 3BQ3A 2CBLA 1QLSA 3CWGA 4GGNA 1PCEA 4AQJA 5JOLA 4I5NB 2BECA 5J3XA 4C0JA 1CDMA 4HRGA 3SEKC 1DJYA 4C0LA 4QJ4B 1YTZC 5ER5A 1F4OA 3QTLD 4UXJA 2DB6A 2HETA 4ETOA 1SR6C 1JFKA 1B8CA 3DD4A 3PLFB 2NU0I 1JBAA 1XBTA 2KQ6A 1ODBA 1U5KA 1TBNA 3OL0A 1XFZO 1XFYO 2K2FA 2M5XA 2P6AC 2Y1NA 1YURA 3KPXA 1J7RA 5I2LA 5AXIA 2GV5A 1XK4A 3NSOA 2MA2A 1J1DA 3BYAA 3LCPC 1SY9A 2F33A 2JW6A 4FKDA 2I94A 1TUSA 1VRKA 3BUOB 1LR8A 3CS1A 1QLKA 3BOWB 4CFRA 1KQMB 4HSZA 1IQ3A 1PULA 4GI3C 2K8MB 1S6IA 3M0WA 3PATA 1QV1A 3JVTC 1UHJA 1Y1UA 2JC2A 1NCXA 3I5IB 3UGLA 1PVBA 4YGDB 4CIDA 1WDCC 3JTDB 1XFVO 4OCIA 1DVIA 2KMOA 3I5GB 4PCWA 1CLBA 1A4PA 3SGBI 1OMDA 2AUCA 2BCAA 4I5JA 1B4CA 3MSEB 1KWOC 3OX6A 1LR7A 1AUIB 1IW4A 5F6TA 1NX2A 1FPWA 2KHNA 2NU2I 2KCXA 1WRKA 1L2OC 1HQVA 1DJHA 1M63B 3CR2A 1M45A 5AFPA 1UHNA 2M7NA 1MXEA 1DJGA 1V1FA 2MAZA 1A03A 3CXLA 2M1KB 3SJSA 2LV7A 1F54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NLN A;  4YI8 A;  5HYD A;  2QQD A;  4R1E A;  1CTR A;  2KOT A;  1QX5 B;  1ZFS A;  2TN4 A;  3E3R A;  5KU1 A;  1ZAC A;  2LVV A;  1NCY A;  3DVK A;  2BBM A;  1MT1 A;  3FWB A;  3OP0 A;  2WOS A;  4BY5 A;  1BLQ A;  2KMR A;  2LE9 B;  4ICB A;  1TRF A;  3GK1 A;  1CLM A;  3PN7 C;  1RFJ A;  5FYX A;  1OOJ A;  3EVR A;  1SR6 B;  2Y4Q A;  1TN4 A;  1J7O A;  3O78 A;  2PRU A;  1A2X A;  2JYY A;  2L51 A;  1SCV A;  1K94 A;  4GNK B;  1LXF C;  1S5G Z;  2SGD I;  1IQ5 A;  2K7O A;  2JZM A;  1CSO I;  2CT9 A;  4XJK B;  4MZL A;  1CNP A;  4DUQ A;  4MBE A;  1SL8 A;  1N0Y A;  2LEO A;  1A75 A;  1YTP A;  1UHH A;  2MLF C;  3AKA A;  2LLT A;  3EVU A;  1NYA A;  2PAL A;  2ISD A;  1HJA I;  2BBN A;  1M31 A;  2NU1 I;  3VRN A;  4PE0 A;  2F2O A;  1ALW A;  1QIW A;  3D0Y A;  1TOP A;  1XO5 A;  1F55 A;  3VRR A;  1PPF I;  1QTX A;  1CFP A;  1A29 A;  1DGV A;  1TCO B;  1WDC B;  2IS9 A;  1DJZ A;  2AAO A;  4N5X A;  2K7C A;  1TBR R;  1BT6 A;  4GPL B;  2K7B A;  2LMU A;  1YX7 A;  1REC A;  2O5G A;  2KFG A;  1CM1 A;  1NP8 A;  4PE1 A;  4MZK A;  1K93 D;  1K9P A;  1UVG A;  1CMG A;  2NU3 I;  5K89 A;  1NIW A;  1DF0 A;  1CM4 A;  1OSA A;  2KFH A;  2SGQ I;  3FWC A;  5I2O A;  1B8L A;  2KQY A;  1BU3 A;  1L2O B;  3D0Y B;  4M2Q A;  4OVO A;  4ORB B;  2MHH A;  5DKR A;  1KFU S;  1NX0 A;  2M97 A;  1AJ5 A;  1M46 A;  3HH2 C;  1XYD A;  3PM8 A;  1IGV A;  4WQ2 A;  3KHE A;  1B8R A;  2N52 A;  3TJQ A;  1KQV A;  5IBW A;  1CT2 I;  1CT4 I;  2LHL A;  4N1G A;  2E30 A;  2BKH B;  2LC5 A;  1OZO A;  1M8C A;  2KNE A;  4PHN A;  1CGI I;  2HQW A;  1V1G A;  2D8N A;  2KAX A;  1OZS A;  2M9G A;  1EL4 A;  1OMU A;  3ZWH A;  3FIA A;  1TNX A;  4YGE B;  1N2D A;  1FI5 A;  2ZN9 A;  1UUC A;  3PN7 B;  2BCB A;  2M3W A;  1KFU L;  1R6P A;  1SK6 D;  2M7L A;  4HRH A;  1Y1C A;  1YRT B;  3RLZ A;  3NSI A;  2QPT A;  1Y1A A;  1FYB A;  4PDZ A;  3BUM B;  2CXJ A;  4QJ3 B;  1SGR I;  2SGF I;  1BR1 B;  4U8D A;  4GFT A;  1LKJ A;  1SBJ A;  3EKH A;  3CR4 X;  1W7I B;  2R2I A;  2HQ8 A;  4P2Y B;  4OVN F;  1Q80 A;  4TNC A;  2ZRS A;  1DTL A;  2H61 C;  1CB1 A;  3EK4 A;  1SPY A;  1XFW O;  2COL B;  5CSI A;  5DKQ A;  3VRP A;  1JWD A;  5CSN A;  1MQ1 A;  1PVA A;  4D1E A;  1UHI A;  4GGF C;  5HLO A;  2BL0 C;  1CDP A;  1SGD I;  2NXQ A;  1SGE I;  1CKK A;  3FS7 A;  1F4Q A;  4M2O A;  1K2H A;  1TUR A;  1NPQ A;  4ORA B;  3TUY C;  1TNW A;  2LMV A;  4NDB A;  2KI6 D;  1JUO A;  1AJ4 A;  2KYF A;  1CFD A;  1TCF A;  1MUX A;  1QX7 A;  4MVF A;  1F70 A;  3SG5 A;  3QRX A;  4DIR A;  1OVO A;  5G08 A;  2SGP I;  3I5H C;  5BPJ A;  2L4I A;  4C0K A;  1KMA A;  3AAK A;  1K95 A;  1XA5 A;  1XVJ A;  1H4B A;  4OV2 A;  1GGZ A;  1YUT A;  1TGS I;  1FF1 A;  1QX2 A;  3BUN B;  2JXL A;  2KBM A;  1U5I A;  1JFJ A;  1KK8 B;  1UHK A;  2E6W A;  2ZRT A;  2HPS A;  4PAL A;  1PSR A;  2EC6 C;  3TS5 C;  2OVO A;  2CCM A;  1XFU O;  4P5O E;  2G9B A;  2L98 A;  2JTZ A;  1J7P A;  1DGU A;  2G2B A;  3NSK A;  4I5L B;  2K7D A;  2F3Z A;  2LMT A;  1PK0 D;  5AER A;  1NX1 A;  1CDN A;  4USL A;  1KCY A;  1EXR A;  1EH2 A;  4AOM A;  3LL8 B;  4YGC B;  1G4Y R;  1S5G Y;  1U5I B;  2LVI A;  2L5X B;  3DVJ A;  3TZ1 A;  3OB2 B;  5I2Q A;  2KI4 C;  1S1E A;  1QIV A;  1OE9 B;  2H61 A;  1YVH A;  2ZND A;  1BMO A;  2I7A A;  3WNX B;  4GGF A;  5JJG A;  3ICB A;  1PAL A;  1K90 D;  3IQO A;  2I2R E;  4PHM A;  1DJW A;  3EK8 A;  2F8P A;  3KEV A;  3NSL A;  3CZT X;  1NWD A;  1KFX L;  3I5F C;  1YUU A;  4FTG A;  5I8N A;  3LLE A;  1WRZ A;  2FJU B;  2MRD A;  2KMQ A;  2OTG C;  1SNL A;  1Y6W A;  4BY4 A;  3LK1 A;  4CPV A;  2PSR A;  4NQG A;  1JF2 A;  1FBV A;  1NUB A;  3JVT B;  3GK2 A;  4PE7 A;  2EGD A;  1NSH A;  2BL0 B;  2LVJ A;  2NCO A;  3DF0 A;  5KSZ A;  1KSM A;  1WY9 A;  2LCP A;  1BJF A;  4GUK A;  1BG1 A;  1W7J B;  4UPG A;  3TDI A;  1LA0 A;  2F3Y A;  5AEQ A;  2KYC A;  4CFQ A;  1JF0 A;  1UUR A;  2WC8 A;  2KDH A;  1QVI Z;  5D7F A;  2WCF A;  1S26 D;  1A75 B;  1KQM C;  2KI6 C;  4ZCV A;  2GKR I;  2JNF A;  2SGE I;  3O4Y A;  2PVB A;  1KWO B;  4A4C A;  2ZN8 A;  1KK7 Z;  4MLW A;  2QAC A;  2WCY A;  2KGR A;  2JTT A;  4N1F A;  5CSF A;  1C07 A;  2B1U A;  1QAS A;  3I5I C;  4OR9 B;  2JT0 A;  2GKV A;  3CLN A;  2ERW A;  2LNK A;  2L50 A;  1TNP A;  2GGZ A;  2DOQ A;  3I5G C;  5B8I B;  4WQ3 A;  1S3P A;  4XYN A;  2EC6 B;  3TS5 B;  3ZNI A;  1SKT A;  3VRO A;  3DVE A;  2Q4U A;  1SMG A;  2KFF A;  3O6B A;  3PFV A;  1AHR A;  3IQQ A;  3SGQ I;  1OMR A;  1ZMZ A;  2LP2 A;  2WND A;  4MRY A;  1CE3 A;  1FI6 A;  2EHB A;  1DF0 B;  2K2A A;  1R0R I;  4MZJ A;  4Q04 A;  1MR8 A;  1CFC A;  1SGN I;  1OMV A;  1B9A A;  2ZKM X;  5JHW C;  2Y1M A;  3SIB A;  4E68 A;  1SYM A;  1B7T Z;  1K9U A;  2JNX A;  1IWQ A;  1CDL A;  1DS3 I;  2BUS A;  1IY6 A;  1AN1 I;  1PSB A;  3A4U B;  3EKJ A;  2CNP A;  2KI4 B;  2JQ6 A;  1DMO A;  1J55 A;  4YBH B;  1CT0 I;  4WRI A;  1QS7 A;  2L2E A;  2N17 A;  1TTX A;  1UWO A;  3CGA A;  4NDD A;  1PJU A;  2F3C I;  1BUS A;  1QAT A;  2JPT A;  1GGW A;  1ALV A;  1YX8 A;  2M29 A;  1K8U A;  1SCM C;  3A8R A;  1Y1X A;  4MEW A;  3AKB A;  2KBI A;  4PHK A;  1QXP A;  2AMI A;  3PSR A;  5DAE A;  1H0Z A;  2NU4 I;  4FQO A;  1BOC A;  2JT8 A;  1K9K A;  3SG6 A;  2N71 A;  3NXA A;  3I5F B;  1G33 A;  2JOJ A;  2LUX A;  2RGI A;  3D10 A;  3EVV A;  4HRE E;  1AVS A;  4I5K A;  2JU0 A;  1IJ5 A;  2M8U A;  3BOW A;  3SG3 A;  4F0Z B;  5HKY A;  2LHI A;  1GJY A;  1R2U A;  2OTG B;  2O60 A;  4L9M A;  3VRQ A;  4AQI A;  4JWQ A;  3SG2 A;  1DJX A;  3BUX B;  4DS7 A;  2H2K A;  3HX4 A;  2ARP F;  1S6J A;  4ORC B;  3TUY B;  2QQC A;  3OVO A;  2LLS A;  1IKU A;  3TDZ A;  1RJV A;  1IY5 A;  2K61 A;  5CPV A;  2Q91 A;  3LK0 A;  1HDL A;  1MHO A;  1QJT A;  1EJ3 A;  2SCP A;  1J7Q A;  2FCD A;  1MWN A;  2GGM A;  1IG5 A;  2JXC A;  1ZOT B;  4MRX A;  1PRW A;  1SW8 A;  1C7W A;  1EG3 A;  2KSP A;  2SAS A;  3HCM A;  1BR4 B;  1N65 A;  1NCZ A;  2NCP A;  3OHM B;  1HPT A;  1TNQ A;  1YVL A;  2JUL A;  2M1U A;  1S36 A;  5DKN A;  1Y1B A;  3CTN A;  1IRJ A;  5HKZ A;  3WXA A;  3WHU B;  2JT3 A;  1B1G A;  1CMF A;  1SL7 A;  1UUS A;  2M0R A;  1GQM A;  2OPO A;  2MLE C;  2ZFD A;  2HF5 A;  2MBX A;  1YUS A;  1NX3 A;  1ZUZ A;  2K0J A;  3PAL A;  1EG4 A;  2GKT I;  2L0P A;  1SL9 A;  1KFX S;  2P6B B;  5CSJ A;  1B47 A;  1LA3 A;  2LAN A;  1F8H A;  2JZI A;  4MN0 A;  4PHJ A;  2JWW A;  1IH0 A;  1L7Z A;  2JXD A;  1AP4 A;  1UVF A;  5KTY A;  3F45 A;  1OMT A;  1OYV I;  2CTN A;  2KAV A;  3KF9 A;  1LR9 A;  1TIH A;  1MXL C;  2LVK A;  2A4J A;  1N13 A;  1BF5 A;  2OS8 C;  1LIN A;  3OX5 A;  5ER4 X;  5HLV A;  5AAN A;  4DCK A;  4YRU A;  1CGJ I;  1SGY I;  1SCM B;  2LUC A;  4OKH A;  1QV0 A;  1YRU B;  3C1V A;  3WHT B;  1F71 A;  2FCE A;  1JSA A;  1G8I A;  1LVC D;  1DT7 B;  2JRF A;  2KGB C;  1K96 A;  3B4V C;  4XJK A;  1D1O A;  2FOT A;  5GQQ C;  1QVI Y;  5PAL A;  2XRC A;  1KSO A;  2PAS A;  1H8B A;  1KK7 Y;  2KMP A;  2LP3 A;  1C7V A;  2VRG A;  1RK9 A;  4NDC A;  2BKI B;  4JQ0 D;  1E8A A;  1SRA A;  1Y0V H;  3H4S E;  5TNC A;  1WLZ A;  1M8B A;  3OB1 B;  1TIZ A;  3VGO A;  1X02 A;  3AAJ A;  3DVM A;  1WLM A;  1TBQ R;  3I5H B;  4M2P A;  2BCX A;  1M39 A;  1J1E A;  4GBA A;  3DF0 B;  1HT9 A;  1BOD A;  3CR5 X;  3SG7 A;  2BE6 A;  3JTD C;  4IL1 A;  4CLN A;  2I18 A;  1XK4 C;  2WOR A;  4GAO A;  1B7T Y;  4YGB B;  2MJW B;  2KAY A;  1SGQ I;  2ZNE A;  1WRL A;  2BE4 A;  4QJ5 B;  1CFF A;  3K21 A;  4YI9 A;  4MSP A;  1UP5 A;  1JC2 A;  2Y5I A;  1Z7K B;  3EK7 A;  5D69 A;  1RRO A;  1CLL A;  3RM1 A;  1AK8 A;  1CHO I;  1IJ6 A;  3BXK A;  2WCE A;  1MF8 B;  5HKW A;  1KK8 C;  1YR5 A;  3KO0 A;  1DJI A;  1S6C A;  2NZ0 A;  3GOF A;  2LLU A;  3IF7 A;  3SIA A;  4A4B A;  4JPZ B;  2F2P A;  1YU6 C;  2B0U C;  1FW4 A;  2L4H A;  1RWY A;  4YGA A;  1RTP 1;  3GK4 X;  3TDU A;  2PMY A;  3O2P A;  2LAP A;  2M49 B;  1DS2 I;  2LM5 A;  4DRW A;  4PE4 A;  1SGP I;  1XFX O;  3SG4 A;  4HGU A;  4SGB I;  1OQP A;  4ZCU A;  2V53 A;  2WCB A;  3BUW B;  2OS8 B;  3BQ3 A;  2CBL A;  1QLS A;  3CWG A;  4GGN A;  1PCE A;  4AQJ A;  5JOL A;  4I5N B;  2BEC A;  5J3X A;  4C0J A;  1CDM A;  4HRG A;  3SEK C;  1DJY A;  4C0L A;  4QJ4 B;  1YTZ C;  5ER5 A;  1F4O A;  3QTL D;  2HET A;  4ETO A;  1SR6 C;  1JFK A;  1B8C A;  3DD4 A;  3PLF B;  2NU0 I;  1JBA A;  2KQ6 A;  1ODB A;  1XFZ O;  1XFY O;  2K2F A;  2M5X A;  2P6A C;  2Y1N A;  1YUR A;  3KPX A;  1J7R A;  5I2L A;  5AXI A;  2GV5 A;  1XK4 A;  3NSO A;  2MA2 A;  1J1D A;  3BYA A;  3LCP C;  1SY9 A;  2F33 A;  2I94 A;  1TUS A;  1VRK A;  3BUO B;  1LR8 A;  3CS1 A;  1QLK A;  3BOW B;  4CFR A;  1KQM B;  4HSZ A;  1IQ3 A;  1PUL A;  4GI3 C;  2K8M B;  1S6I A;  3M0W A;  3PAT A;  1QV1 A;  3JVT C;  1UHJ A;  1Y1U A;  2JC2 A;  1NCX A;  3I5I B;  1PVB A;  4YGD B;  4CID A;  1WDC C;  3JTD B;  1XFV O;  4OCI A;  1DVI A;  2KMO A;  3I5G B;  4PCW A;  1CLB A;  1A4P A;  3SGB I;  1OMD A;  2AUC A;  2BCA A;  4I5J A;  1B4C A;  3MSE B;  1KWO C;  3OX6 A;  1LR7 A;  1AUI B;  1IW4 A;  5F6T A;  1NX2 A;  1FPW A;  2KHN A;  2NU2 I;  2KCX A;  1WRK A;  1L2O C;  1HQV A;  1DJH A;  1M63 B;  3CR2 A;  1M45 A;  5AFP A;  1UHN A;  2M7N A;  1MXE A;  1DJG A;  1V1F A;  2MAZ A;  1A03 A;  2M1K B;  3SJS A;  2LV7 A;  1F54 A; 
#chains in the Genus database with same CATH topology
 2NLN A;  4YI8 A;  3E3R A;  5KU1 A;  3DVK A;  3FWB A;  3OP0 A;  2WOS A;  4BY5 A;  2LE9 B;  3GK1 A;  2WCK A;  3MEK A;  1TN4 A;  1K94 A;  1S5G Z;  1P9G A;  2CT9 A;  1IIO A;  1TUJ A;  4DUQ A;  1SL8 A;  3AKA A;  1NYA A;  2PAL A;  3VRR A;  1PPF I;  1CFP A;  1DGV A;  1TCO B;  4N5X A;  4GPL B;  4IJ7 A;  1P28 A;  1RFH A;  1CM1 A;  2ELI A;  4INX A;  1CM4 A;  3GOX A;  3D0Y B;  1DQE A;  1FAR A;  1M46 A;  3HH2 C;  2FNF X;  1IGV A;  2N52 A;  1CT2 I;  1CT4 I;  2PQ8 A;  2K9H A;  2LC5 A;  3D77 A;  1CGI I;  2HQW A;  2KAX A;  2M9G A;  1OMU A;  3PN7 B;  2BCB A;  3RLZ A;  3NSI A;  2W0T A;  1FYB A;  4QJ3 B;  1SGR I;  1BR1 B;  1LKJ A;  3CR4 X;  1OOI X;  4P2Y B;  2QEB A;  4TNC A;  2ZRS A;  4WP4 A;  2H61 C;  3EK4 A;  2COL B;  1PVA A;  5HLO A;  3FS7 A;  1F4Q A;  1NPQ A;  2LMV A;  1AJ4 A;  2KYF A;  1CFD A;  1QX7 A;  1F70 A;  1OVO A;  4E1R A;  3CZ2 A;  3I5H C;  5BPJ A;  4C0K A;  1YUT A;  4PT1 A;  3EG5 B;  2E6W A;  2HPS A;  2CCM A;  1XFU O;  1OW4 A;  2K60 A;  4UXH A;  1V1H A;  3LL8 B;  1S5G Y;  3SS5 A;  1U5I B;  1Z2C B;  1QIV A;  1OE9 B;  2H61 A;  1K7V A;  2I7A A;  2I2R E;  1K7T A;  5FUW A;  5I8N A;  1Y6W A;  4CPV A;  2PSR A;  5EL2 A;  3GK2 A;  2WCY A;  1NSH A;  1BJF A;  2Y0M A;  1W7J B;  1LA0 A;  3UO9 A;  2KYC A;  1UUR A;  2WC8 A;  3UGD A;  5D7F A;  2JNF A;  3O4Y A;  2ZN8 A;  1KK7 Z;  2QAC A;  2JTT A;  4N1F A;  3I5I C;  2GKV A;  2DOQ A;  5B8I B;  1SKT A;  2Q4U A;  3O6B A;  2KFF A;  3PFV A;  1OMR A;  2EHB A;  2K2A A;  1B9A A;  2ZKM X;  5FI7 A;  5JHW C;  1SYM A;  3EKJ A;  4WRI A;  1QS7 A;  1TTX A;  3CGA A;  4NDD A;  2F3C I;  2JPT A;  1ALV A;  1YX8 A;  1K8U A;  3CDN A;  4MEW A;  1QXP A;  3PJI A;  2NU4 I;  4JKT A;  3I5F B;  2RGI A;  3BOW A;  2LHI A;  4AQI A;  3SG2 A;  4DS7 A;  2ARP F;  4ORC B;  1EJ3 A;  1J7Q A;  2GGM A;  1ORG A;  1ZOT B;  4MRX A;  1C7W A;  2KSP A;  2SAS A;  2J87 A;  5DKN A;  1S36 A;  3D74 A;  3S0F A;  1IRJ A;  1B1G A;  1SL7 A;  2MLE C;  1ZUZ A;  3PAL A;  2ENN A;  2L0P A;  1LA3 A;  2QQE A;  1IH0 A;  4PHJ A;  1OYV I;  3KF9 A;  2LVK A;  2A4J A;  1LIN A;  4DCK A;  1SGY I;  3R5B A;  3B7A A;  3WHT B;  1G8I A;  1K96 A;  5PAL A;  2PAS A;  1H8B A;  1KK7 Y;  1C7V A;  2BKI B;  2WCH A;  5J8F A;  1TIZ A;  3VGO A;  3DVM A;  3AAJ A;  3I5H B;  4M2P A;  2UZ3 A;  3K1E A;  1HT9 A;  1V1I A;  3SG7 A;  1Q9B A;  2ROW A;  1XK4 C;  2ENZ A;  2L8E A;  1SGQ I;  1CFF A;  3B86 A;  4MSP A;  1CLL A;  1AK8 A;  1IJ6 A;  5HI7 A;  1KK8 C;  3KO0 A;  1DJI A;  2NZ0 A;  3SIA A;  1YU6 C;  1FW4 A;  3GK4 X;  2M49 B;  4PE4 A;  2V53 A;  3BQ3 A;  1CDM A;  4QJ4 B;  2HET A;  1JFK A;  2L5Y A;  1WKX A;  1Z4H A;  4MPI A;  2GV5 A;  1XK4 A;  2F33 A;  3NHI A;  1TUS A;  3CS1 A;  3BOW B;  4HSZ A;  3OGN A;  1QV1 A;  3I5I B;  1NCX A;  1XFV O;  1DVI A;  3D78 A;  3SGB I;  3DZT A;  2NU2 I;  1DJH A;  3PM2 A;  1A03 A;  3SJS A;  1F54 A;  2ERB A;  2QQD A;  1CTR A;  3S0A A;  1DC1 A;  2LVV A;  1NCY A;  1WGT A;  1BLQ A;  2KMR A;  2WC6 A;  2X52 A;  3PN7 C;  3EVR A;  3O78 A;  2PRU A;  1LXF C;  1GM0 A;  2SGD I;  1IQ5 A;  2JZM A;  1LS8 A;  4MBE A;  5D3O A;  1N0Y A;  2LEO A;  2PQL A;  1A75 A;  4E1P A;  1M31 A;  2NU1 I;  4PE0 A;  1Z2I A;  3L4A A;  3D0Y A;  1TOP A;  1XO5 A;  1F55 A;  1WDC B;  1DJZ A;  1REC A;  2O5G A;  1NP8 A;  3FSX A;  1UVG A;  2NU3 I;  1DF0 A;  5I2O A;  1B8L A;  2WCM A;  4JD9 A;  4M2Q A;  2MHH A;  1XYD A;  1KBE A;  2LHL A;  4N1G A;  1EL4 A;  3ZWH A;  3FIA A;  1FI5 A;  3E59 A;  3L47 A;  1KFU L;  2CWG A;  3VE5 A;  2QDI A;  4U8D A;  3O4X A;  1SBJ A;  3EKH A;  4OVN F;  1SPY A;  5CSI A;  5DKQ A;  1NXU A;  1MQ1 A;  2N1A B;  1CDP A;  1SGE I;  1CKK A;  4M2O A;  1TUR A;  3R5A A;  4ORA B;  3FE9 A;  3TO9 A;  3N7H A;  2KLE A;  1KMA A;  3AAK A;  1K95 A;  1XVJ A;  1TGS I;  1FF1 A;  1QX2 A;  3BUN B;  1U5I A;  1KK8 B;  7WGA A;  2ZRT A;  1PSR A;  4P5O E;  2L98 A;  2JTZ A;  4INW A;  1FY7 A;  5CCM A;  1EH2 A;  4YGC B;  1YVH A;  1OOG A;  2QPO A;  5DIC A;  3R5C A;  2YGU A;  1K90 D;  3IQO A;  3EK8 A;  1NWD A;  3I5F C;  2L7X A;  1YUU A;  4FTG A;  2KMQ A;  1SNL A;  1TOT A;  2V1C A;  1JF2 A;  1NUB A;  2BL0 B;  5AEQ A;  1JF0 A;  1QVI Z;  1A75 B;  2KI6 C;  2KGR A;  4OR9 B;  2JT0 A;  2L50 A;  2EC6 B;  3DVE A;  1AHR A;  3SGQ I;  2LP2 A;  1FI6 A;  1DF0 B;  1R0R I;  4MZJ A;  4Q04 A;  1SGN I;  2Y1M A;  3SIB A;  2JNX A;  1DS3 I;  1CDL A;  1AN1 I;  1PSB A;  2KI4 B;  4YBH B;  1PJU A;  1GGW A;  1DEL A;  2M29 A;  3A8R A;  1Y1X A;  4B6D A;  2KBI A;  3R5D A;  3NXA A;  2JOJ A;  2LUX A;  4HRE E;  3EVV A;  2JU0 A;  5HKY A;  3SG3 A;  3V2L A;  3VRQ A;  1DJX A;  2H2K A;  1S6J A;  3TUY B;  3TDZ A;  4FQT A;  5CPV A;  3LK0 A;  1MWN A;  1PRW A;  1TNQ A;  1Y1B A;  1QWV A;  5HL1 A;  5HKZ A;  3WXA A;  1TWO A;  2JT3 A;  1UUS A;  2OPO A;  1YUS A;  2GKT I;  1SL9 A;  1KFX S;  2P71 A;  4JCV E;  3B6X A;  2LAN A;  1F8H A;  3IVT A;  4MN0 A;  2JWW A;  2JXD A;  1AP4 A;  2RIJ A;  1TIH A;  5FUX A;  1BF5 A;  5HLV A;  1CGJ I;  1SCM B;  2P70 A;  1YRU B;  1F71 A;  3C1V A;  2FCE A;  1JSA A;  4XJK A;  1D1O A;  5GQQ C;  1QVI Y;  3B87 A;  4NDC A;  1SRA A;  3D73 A;  1X02 A;  1WLM A;  1BOD A;  1TBO A;  4CLN A;  2I18 A;  2WOR A;  3BJI A;  2MJW B;  2BE4 A;  4QJ5 B;  1XFR A;  3K21 A;  2KLD A;  1JC2 A;  2CJS C;  2Y5I A;  3EK7 A;  5D69 A;  3RM1 A;  3SS4 A;  1YR5 A;  1S6C A;  2LLU A;  4JPZ B;  2F2P A;  2L4H A;  1RWY A;  4YGA A;  1RTP 1;  2LAP A;  1DS2 I;  4SGB I;  1OQP A;  4ZCU A;  4GGN A;  4AQJ A;  5JOL A;  4I5N B;  2CWF A;  2BEC A;  4HRG A;  1YTZ C;  5ER5 A;  3QTL D;  4UXJ A;  2DB6 A;  1B8C A;  3DD4 A;  1XBT A;  2WCJ A;  1XFZ O;  3OL0 A;  1UHA A;  3BJH A;  2P6A C;  2Y1N A;  1YUR A;  3KPX A;  1HEV A;  2K8M B;  3PAT A;  4YGD B;  1WDC C;  3JTD B;  1OMD A;  4I5J A;  2PYQ A;  3MSE B;  1KWO C;  5F6T A;  2KHN A;  9WGA A;  1OOF A;  3B88 A;  1M45 A;  2M7N A;  1MXE A;  1DJG A;  3CXL A;  2M1K B;  5HYD A;  2KOT A;  1QX5 B;  2TN4 A;  1ZAC A;  1S20 A;  3RZS A;  1WTJ A;  4ICB A;  1TRF A;  2DKV A;  1RFJ A;  5FYX A;  1OOJ A;  3NGV A;  1SR6 B;  2Y4Q A;  2ORW A;  5E3P A;  1A2X A;  2JYY A;  2RC4 A;  4XJK B;  4MZL A;  1UHH A;  3EVU A;  1HJA I;  2BBN A;  2F2O A;  1ALW A;  1QIW A;  1QTX A;  1A29 A;  2GVI A;  2AAO A;  1BT6 A;  2K7B A;  4PE1 A;  4MZK A;  1K93 D;  2SGQ I;  2KFH A;  2KQY A;  1R79 A;  4OVO A;  4ORB B;  5DKR A;  1KFU S;  1NX0 A;  2M97 A;  1C3Y A;  1AJ5 A;  3PM8 A;  4WQ2 A;  3KHE A;  1B8R A;  1KQV A;  4KYN A;  1OZO A;  2KNE A;  4PHN A;  1V1G A;  3NHT A;  1N2D A;  2M3W A;  1R6P A;  1SK6 D;  1YRT B;  2QPT A;  1W9Z A;  3UNW A;  3S0D A;  4PDZ A;  3BUM B;  2SGF I;  4GFT A;  2HQ8 A;  1XX6 A;  1Q80 A;  1CB1 A;  3VRP A;  1JWD A;  2QEO A;  1VDD A;  2BL0 C;  1SGD I;  1TUZ A;  1TNW A;  4NDB A;  2KI6 D;  3UFF A;  5I94 A;  4MVF A;  3SG5 A;  3QRX A;  4DIR A;  5G08 A;  3FE8 A;  1H4B A;  4OV2 A;  1GGZ A;  1JFJ A;  1UHK A;  2B8T A;  4PAL A;  2EC6 C;  3FSY A;  2G2B A;  3NSK A;  2F3Z A;  1CDN A;  3CYZ A;  3VDU A;  3E2I A;  1EXR A;  3CAB A;  2LVI A;  2L5X B;  3DVJ A;  3TZ1 A;  3OB2 B;  5I2Q A;  2KI4 C;  1S1E A;  2KPH A;  3ICB A;  1PAL A;  1DJW A;  3QME A;  2F8P A;  3LLE A;  1WRZ A;  2FJU B;  4BY4 A;  3LK1 A;  3D76 A;  4NQG A;  1KBF A;  1FBV A;  3TUY C;  2EGD A;  3DF0 A;  2LVJ A;  2NCO A;  5KSZ A;  1KSM A;  2LCP A;  4GUK A;  1BG1 A;  3TDI A;  4CFQ A;  2WCF A;  2SGE I;  1KWO B;  5CSF A;  1C07 A;  1MJA A;  2E73 A;  3CLN A;  3CZ1 A;  2ORV A;  2ODD A;  3I5G C;  3TS5 B;  4XYN A;  1PTQ A;  1SMG A;  3IQQ A;  5EX3 A;  1ZMZ A;  1X74 A;  1OMV A;  1B7T Z;  1K9U A;  1IY6 A;  2BUS A;  3A4U B;  3OBV A;  2CNP A;  2JQ6 A;  1DMO A;  5E3R A;  1CT0 I;  2N17 A;  1BUS A;  1SCM C;  1DEK A;  1Y8F A;  2AMI A;  3PSR A;  1H0Z A;  2L2C A;  4FQO A;  1BOC A;  2JT8 A;  1K9K A;  3SG6 A;  2N71 A;  4F0Z B;  1IJ5 A;  2OTG B;  2O60 A;  2LB7 A;  4JWQ A;  3HX4 A;  3OVO A;  3TO6 A;  2K61 A;  5FI2 A;  2OD1 A;  2SCP A;  2FCD A;  2V1C C;  2JXC A;  1SW8 A;  1EG3 A;  3HCM A;  1NCZ A;  3OHM B;  2JUL A;  3WHU B;  1GQM A;  2ZFD A;  2MBX A;  1NX3 A;  1EG4 A;  5CSJ A;  1L7Z A;  1UVF A;  1P9Z A;  3F45 A;  1OMT A;  2CTN A;  2BNX A;  1MXL C;  2E5R A;  2VRW B;  2YUU A;  1N13 A;  5ER4 X;  4YRU A;  1MJ9 A;  2JRF A;  3B4V C;  2FOT A;  2XRC A;  2LP3 A;  5J8C A;  2VRG A;  1RK9 A;  4UXI A;  1C3Z A;  1E8A A;  1Y0V H;  3H4S E;  5TNC A;  1WLZ A;  1M8B A;  1TBQ R;  4GBA A;  1J1E A;  3DF0 B;  3CR5 X;  3S0B A;  3JTD C;  3TOB A;  4IL1 A;  1B7T Y;  2KAY A;  2ZNE A;  4YI9 A;  1UP5 A;  1CHO I;  1PTR A;  2WCE A;  2GIV A;  1MF8 B;  1ULK A;  5HKW A;  3BFB A;  4A4B A;  3IF7 A;  3OXL A;  2B0U C;  3TDU A;  3O2P A;  3UOE A;  1SGP I;  4HGU A;  1XFX O;  3BUW B;  2OS8 B;  2CBL A;  1PCE A;  3SEK C;  4C0L A;  3TOA A;  1SR6 C;  3PLF B;  2QEH A;  2NU0 I;  2KQ6 A;  1ODB A;  3DY9 A;  2K2F A;  2M5X A;  5I2L A;  5AXI A;  3LCP C;  1J1D A;  3BYA A;  2JW6 A;  1SY9 A;  4FKD A;  4CFR A;  1IQ3 A;  4GI3 C;  3M0W A;  3JVT C;  1UHJ A;  1Y1U A;  2JC2 A;  4CID A;  4OCI A;  3I5G B;  4PCW A;  1CLB A;  2BCA A;  2AUC A;  1B4C A;  1AUI B;  1NX2 A;  2KCX A;  3CR2 A;  1V1F A;  5E3Q A;  4R1E A;  3R1P A;  1ZFS A;  3FE6 A;  1MT1 A;  2BBM A;  3S0G A;  2OU2 A;  5FUV A;  5FI6 A;  3VDP A;  1CLM A;  2X3T A;  1J7O A;  2L51 A;  1SCV A;  4GNK B;  1T14 A;  2K7O A;  1CSO I;  1CNP A;  3OXG A;  5EX0 A;  1YTP A;  2MLF C;  2LUY A;  2LLT A;  2ISD A;  3VRN A;  2BAP A;  2WGC A;  2IS9 A;  2K7C A;  1TBR R;  2LMU A;  1YX7 A;  2KFG A;  2DIP A;  1K7U A;  1K9P A;  1CMG A;  4F7F A;  5K89 A;  1NIW A;  1OSA A;  3FWC A;  1BU3 A;  1L2O B;  5CCL A;  3TJQ A;  4DNC A;  2JPO A;  5IBW A;  2E30 A;  2BKH B;  1M8C A;  2D8N A;  1OZS A;  2A20 A;  1TNX A;  4YGE B;  1UUC A;  2ZN9 A;  2M7L A;  4HRH A;  1Y1C A;  1Y1A A;  3RU0 A;  2CXJ A;  1W7I B;  2R2I A;  3FC3 A;  1DTL A;  3R72 A;  1XFW O;  5CSN A;  4D1E A;  1UHI A;  4GGF C;  2NXQ A;  1K2H A;  1JUO A;  4OZD A;  1TCF A;  1MUX A;  2SGP I;  2L4I A;  1XA5 A;  3S0E A;  2JXL A;  2KBM A;  4A24 A;  3TS5 C;  2OVO A;  2G9B A;  1J7P A;  1DGU A;  4I5L B;  2K7D A;  2LMT A;  1PK0 D;  5AER A;  1NX1 A;  1FAQ A;  4USL A;  1KCY A;  4AOM A;  1MJB A;  1G4Y R;  3BFA A;  2ZND A;  5HQ8 A;  1BMO A;  3WNX B;  4GGF A;  5JJG A;  2J9R A;  4PHM A;  2QEV A;  3KEV A;  3NSL A;  3CZT X;  1KFX L;  2MRD A;  2OTG C;  4AML A;  3JVT B;  4PE7 A;  1WY9 A;  4UPG A;  2F3Y A;  3SS3 A;  2KDH A;  3KY9 A;  1S26 D;  1KQM C;  2GKR I;  3QWP A;  4ZCV A;  2PVB A;  3Q8I A;  4A4C A;  4MLW A;  2B1U A;  1QAS A;  2ERW A;  2LNK A;  1TNP A;  2GGZ A;  4WQ3 A;  1S3P A;  3ZNI A;  3VRO A;  1CE3 A;  2WND A;  4MRY A;  1CFC A;  1MR8 A;  4E68 A;  1IWQ A;  1J55 A;  2L2E A;  1UWO A;  1QAT A;  3D00 A;  3AKB A;  4PHK A;  3UEY A;  5DAE A;  3UGI A;  1G33 A;  3D10 A;  4I5K A;  2JA1 A;  1AVS A;  2M8U A;  1GJY A;  1R2U A;  2WVJ A;  4L9M A;  3BUX B;  2QQC A;  2LLS A;  1IKU A;  3UEJ A;  1RJV A;  1IY5 A;  2Q91 A;  1HDL A;  1MHO A;  1QJT A;  1IG5 A;  1BR4 B;  1N65 A;  2NCP A;  1HPT A;  1YVL A;  2M1U A;  3CTN A;  3R1O A;  1CMF A;  2M0R A;  1W4R A;  2HF5 A;  2K0J A;  2P6B B;  2WC5 A;  1B47 A;  2JZI A;  5KTY A;  2OZU A;  2KAV A;  1LR9 A;  2OS8 C;  3BFH A;  3OX5 A;  5AAN A;  2LUC A;  4OKH A;  1QV0 A;  2CWH A;  1LVC D;  1DT7 B;  2KGB C;  3R1V A;  1KSO A;  2KMP A;  4JQ0 D;  3OXF A;  1ULN A;  2GTE A;  1W3S A;  3OB1 B;  2YQP A;  2BCX A;  1M39 A;  2UVO A;  2BE6 A;  1OOH A;  5FUY A;  4GAO A;  4YGB B;  1WRL A;  1Z7K B;  1XA6 A;  2QQ0 A;  1RRO A;  1X4S A;  2H8V A;  3PDN A;  3BXK A;  3GOF A;  2WCL A;  2PMY A;  2LM5 A;  4DRW A;  3SG4 A;  2WCB A;  1QLS A;  3CWG A;  5J3X A;  4C0J A;  1DJY A;  1F4O A;  3L4L A;  4ETO A;  3CZ0 A;  1JBA A;  1U5K A;  1TBN A;  1XFY O;  1J7R A;  1ULM A;  1SSE B;  1WGC A;  3NSO A;  2MA2 A;  2I94 A;  3TO7 A;  1VRK A;  3BUO B;  1LR8 A;  1QLK A;  1KQM B;  1PUL A;  3QAH A;  1S6I A;  3UGL A;  1PVB A;  3VB1 A;  2KMO A;  1A4P A;  3OX6 A;  1LR7 A;  1IW4 A;  1FPW A;  3D75 A;  3DXL A;  1WRK A;  2FJY A;  1L2O C;  1HQV A;  1M63 B;  5AFP A;  1UHN A;  2MAZ A;  3DYE A;  2LV7 A; 
#chains in the Genus database with same CATH homology
 2NLN A;  4YI8 A;  5HYD A;  2QQD A;  4R1E A;  1CTR A;  2KOT A;  1QX5 B;  1ZFS A;  2TN4 A;  3E3R A;  5KU1 A;  1ZAC A;  2LVV A;  1NCY A;  3DVK A;  2BBM A;  1MT1 A;  3FWB A;  3OP0 A;  2WOS A;  4BY5 A;  1BLQ A;  2KMR A;  5FUV A;  2LE9 B;  3VDP A;  4ICB A;  1TRF A;  3GK1 A;  1CLM A;  3PN7 C;  1RFJ A;  5FYX A;  1OOJ A;  3EVR A;  1SR6 B;  2Y4Q A;  2ORW A;  3MEK A;  1TN4 A;  1J7O A;  3O78 A;  2PRU A;  1A2X A;  2JYY A;  2L51 A;  1SCV A;  1K94 A;  4GNK B;  1LXF C;  1S5G Z;  2SGD I;  1IQ5 A;  2K7O A;  2JZM A;  1CSO I;  2CT9 A;  4XJK B;  4MZL A;  1CNP A;  4DUQ A;  4MBE A;  1SL8 A;  3OXG A;  1N0Y A;  2LEO A;  5EX0 A;  1A75 A;  1YTP A;  1UHH A;  2MLF C;  3AKA A;  2LUY A;  2LLT A;  3EVU A;  1NYA A;  2PAL A;  2ISD A;  1HJA I;  4E1P A;  2BBN A;  1M31 A;  2NU1 I;  3VRN A;  4PE0 A;  2F2O A;  1ALW A;  1QIW A;  3D0Y A;  1TOP A;  1XO5 A;  1F55 A;  3VRR A;  1PPF I;  1QTX A;  1CFP A;  1A29 A;  1DGV A;  1TCO B;  2GVI A;  1WDC B;  2IS9 A;  1DJZ A;  2AAO A;  4N5X A;  2K7C A;  1TBR R;  1BT6 A;  4GPL B;  2K7B A;  2LMU A;  1YX7 A;  1REC A;  2O5G A;  2KFG A;  1RFH A;  1CM1 A;  1NP8 A;  4PE1 A;  2DIP A;  4MZK A;  1K93 D;  1K9P A;  1UVG A;  2ELI A;  1CMG A;  2NU3 I;  5K89 A;  1NIW A;  1DF0 A;  1CM4 A;  1OSA A;  2KFH A;  2SGQ I;  3FWC A;  5I2O A;  1B8L A;  2KQY A;  1R79 A;  3GOX A;  1BU3 A;  1L2O B;  3D0Y B;  4M2Q A;  4OVO A;  4ORB B;  2MHH A;  5DKR A;  1KFU S;  1NX0 A;  2M97 A;  1FAR A;  1AJ5 A;  5CCL A;  1M46 A;  3HH2 C;  2FNF X;  1XYD A;  3PM8 A;  1IGV A;  4WQ2 A;  3KHE A;  1B8R A;  2N52 A;  3TJQ A;  1KBE A;  1KQV A;  5IBW A;  1CT2 I;  1CT4 I;  2LHL A;  4N1G A;  2E30 A;  2BKH B;  2K9H A;  2LC5 A;  1OZO A;  1M8C A;  2KNE A;  4PHN A;  1CGI I;  2HQW A;  1V1G A;  2D8N A;  2KAX A;  1OZS A;  2M9G A;  2A20 A;  1EL4 A;  1OMU A;  3ZWH A;  3FIA A;  1TNX A;  4YGE B;  1N2D A;  1FI5 A;  2ZN9 A;  1UUC A;  3PN7 B;  3E59 A;  2BCB A;  2M3W A;  1KFU L;  1R6P A;  1SK6 D;  2M7L A;  4HRH A;  1Y1C A;  1YRT B;  3RLZ A;  3NSI A;  2QPT A;  2W0T A;  1Y1A A;  1FYB A;  4PDZ A;  3BUM B;  2CXJ A;  4QJ3 B;  1SGR I;  2SGF I;  3RU0 A;  3VE5 A;  1BR1 B;  4U8D A;  4GFT A;  1LKJ A;  1SBJ A;  3EKH A;  3CR4 X;  1W7I B;  2R2I A;  2HQ8 A;  4P2Y B;  3FC3 A;  4OVN F;  1Q80 A;  4TNC A;  2ZRS A;  1DTL A;  1XX6 A;  2H61 C;  1CB1 A;  3EK4 A;  1SPY A;  1XFW O;  2COL B;  5CSI A;  5DKQ A;  3VRP A;  1JWD A;  5CSN A;  1MQ1 A;  1PVA A;  4D1E A;  1UHI A;  4GGF C;  1VDD A;  5HLO A;  2BL0 C;  2N1A B;  1CDP A;  1SGD I;  2NXQ A;  1SGE I;  1CKK A;  3FS7 A;  1F4Q A;  4M2O A;  1K2H A;  1TUR A;  1NPQ A;  4ORA B;  3TUY C;  1TNW A;  2LMV A;  4NDB A;  2KI6 D;  3UFF A;  1JUO A;  1AJ4 A;  2KYF A;  1CFD A;  1TCF A;  1MUX A;  1QX7 A;  4MVF A;  1F70 A;  3SG5 A;  3QRX A;  4DIR A;  1OVO A;  4E1R A;  5G08 A;  2SGP I;  3I5H C;  5BPJ A;  2L4I A;  4C0K A;  1KMA A;  3AAK A;  1K95 A;  1XA5 A;  1XVJ A;  1H4B A;  4OV2 A;  1GGZ A;  1YUT A;  1TGS I;  1FF1 A;  1QX2 A;  3BUN B;  2JXL A;  2KBM A;  1U5I A;  1JFJ A;  1KK8 B;  4A24 A;  1UHK A;  2E6W A;  2ZRT A;  2HPS A;  4PAL A;  1PSR A;  2EC6 C;  3TS5 C;  2B8T A;  2CCM A;  2OVO A;  1XFU O;  4P5O E;  2G9B A;  2L98 A;  2JTZ A;  1J7P A;  1DGU A;  2G2B A;  3NSK A;  4I5L B;  2K7D A;  2F3Z A;  2LMT A;  1PK0 D;  5AER A;  1NX1 A;  1FAQ A;  1CDN A;  4USL A;  3VDU A;  3E2I A;  5CCM A;  1KCY A;  1EXR A;  1EH2 A;  4UXH A;  4AOM A;  1V1H A;  3LL8 B;  4YGC B;  1G4Y R;  1S5G Y;  1U5I B;  2LVI A;  2L5X B;  3DVJ A;  3TZ1 A;  3OB2 B;  5I2Q A;  2KI4 C;  1S1E A;  1QIV A;  1OE9 B;  2H61 A;  1YVH A;  2ZND A;  5HQ8 A;  2QPO A;  1BMO A;  2I7A A;  3WNX B;  4GGF A;  5JJG A;  3ICB A;  1PAL A;  1K90 D;  3IQO A;  2J9R A;  2I2R E;  4PHM A;  1DJW A;  3EK8 A;  2F8P A;  3KEV A;  3NSL A;  5FUW A;  3CZT X;  1NWD A;  1KFX L;  3I5F C;  2L7X A;  1YUU A;  4FTG A;  5I8N A;  3LLE A;  2JA1 A;  1WRZ A;  2FJU B;  2MRD A;  2KMQ A;  2OTG C;  1SNL A;  1Y6W A;  4BY4 A;  3LK1 A;  4CPV A;  1TOT A;  2V1C A;  2PSR A;  4NQG A;  1JF2 A;  1KBF A;  1FBV A;  1NUB A;  3JVT B;  3GK2 A;  4PE7 A;  2EGD A;  1NSH A;  2BL0 B;  2LVJ A;  2NCO A;  3DF0 A;  5KSZ A;  1KSM A;  1WY9 A;  2LCP A;  1BJF A;  4GUK A;  1BG1 A;  1W7J B;  4UPG A;  3TDI A;  1LA0 A;  2F3Y A;  5AEQ A;  2KYC A;  4CFQ A;  1JF0 A;  1UUR A;  2WC8 A;  3UGD A;  2KDH A;  1QVI Z;  5D7F A;  2WCF A;  1S26 D;  3KY9 A;  1A75 B;  1KQM C;  2KI6 C;  4ZCV A;  2GKR I;  2JNF A;  2SGE I;  3QWP A;  3O4Y A;  2PVB A;  1KWO B;  4A4C A;  2ZN8 A;  1KK7 Z;  4MLW A;  2QAC A;  2WCY A;  2KGR A;  2JTT A;  4N1F A;  5CSF A;  1C07 A;  2B1U A;  1QAS A;  3I5I C;  4OR9 B;  2E73 A;  2JT0 A;  2GKV A;  3CLN A;  2ERW A;  2LNK A;  2L50 A;  1TNP A;  2ORV A;  2GGZ A;  2DOQ A;  2ODD A;  3I5G C;  5B8I B;  4WQ3 A;  1S3P A;  4XYN A;  2EC6 B;  3TS5 B;  3ZNI A;  1SKT A;  3VRO A;  3DVE A;  1PTQ A;  2Q4U A;  1SMG A;  2KFF A;  3O6B A;  3PFV A;  1AHR A;  3IQQ A;  5EX3 A;  3SGQ I;  1OMR A;  1ZMZ A;  2LP2 A;  2WND A;  4MRY A;  1CE3 A;  1FI6 A;  2EHB A;  1DF0 B;  2K2A A;  1R0R I;  4MZJ A;  4Q04 A;  1MR8 A;  1CFC A;  1SGN I;  1X74 A;  1OMV A;  1B9A A;  2ZKM X;  5JHW C;  2Y1M A;  3SIB A;  4E68 A;  1SYM A;  1B7T Z;  1K9U A;  2JNX A;  1IWQ A;  1CDL A;  1DS3 I;  2BUS A;  1IY6 A;  1AN1 I;  1PSB A;  3A4U B;  3EKJ A;  2CNP A;  2KI4 B;  2JQ6 A;  1DMO A;  1J55 A;  4YBH B;  1CT0 I;  4WRI A;  1QS7 A;  2L2E A;  2N17 A;  1TTX A;  1UWO A;  3CGA A;  4NDD A;  1PJU A;  2F3C I;  1BUS A;  1QAT A;  2JPT A;  1GGW A;  1ALV A;  1YX8 A;  2M29 A;  1K8U A;  1SCM C;  3A8R A;  3D00 A;  1Y1X A;  4MEW A;  4B6D A;  3AKB A;  2KBI A;  4PHK A;  3UEY A;  1QXP A;  1Y8F A;  2AMI A;  3PSR A;  5DAE A;  1H0Z A;  2NU4 I;  4FQO A;  1BOC A;  3UGI A;  2JT8 A;  1K9K A;  3SG6 A;  2N71 A;  3NXA A;  3I5F B;  1G33 A;  2JOJ A;  2LUX A;  2RGI A;  3D10 A;  3EVV A;  4HRE E;  1AVS A;  4I5K A;  2JU0 A;  1IJ5 A;  2M8U A;  3BOW A;  3SG3 A;  4F0Z B;  5HKY A;  2LHI A;  1GJY A;  1R2U A;  2OTG B;  2O60 A;  2WVJ A;  4L9M A;  3VRQ A;  4AQI A;  4JWQ A;  3SG2 A;  1DJX A;  3BUX B;  4DS7 A;  2H2K A;  3HX4 A;  2ARP F;  1S6J A;  4ORC B;  3TUY B;  2QQC A;  3OVO A;  2LLS A;  1IKU A;  3TDZ A;  3UEJ A;  1RJV A;  1IY5 A;  2K61 A;  5CPV A;  2Q91 A;  3LK0 A;  1HDL A;  2OD1 A;  1MHO A;  1QJT A;  1EJ3 A;  2SCP A;  1J7Q A;  2FCD A;  1MWN A;  2GGM A;  2V1C C;  1IG5 A;  2JXC A;  1ZOT B;  4MRX A;  1PRW A;  1SW8 A;  1C7W A;  1EG3 A;  2KSP A;  2SAS A;  3HCM A;  1BR4 B;  2J87 A;  1N65 A;  1NCZ A;  2NCP A;  3OHM B;  1HPT A;  1TNQ A;  1YVL A;  2JUL A;  2M1U A;  1S36 A;  5DKN A;  1Y1B A;  3CTN A;  1IRJ A;  5HKZ A;  3WXA A;  3WHU B;  2JT3 A;  1B1G A;  1CMF A;  1SL7 A;  1UUS A;  2M0R A;  1GQM A;  2OPO A;  2MLE C;  2ZFD A;  2HF5 A;  2MBX A;  1W4R A;  1YUS A;  1NX3 A;  1ZUZ A;  2K0J A;  3PAL A;  2ENN A;  1EG4 A;  2GKT I;  2L0P A;  1SL9 A;  1KFX S;  2P6B B;  4JCV E;  5CSJ A;  1B47 A;  1LA3 A;  2LAN A;  2QQE A;  1F8H A;  2JZI A;  4MN0 A;  4PHJ A;  2JWW A;  1IH0 A;  1L7Z A;  2JXD A;  1AP4 A;  1UVF A;  5KTY A;  3F45 A;  1OMT A;  1OYV I;  2CTN A;  2KAV A;  3KF9 A;  1LR9 A;  1TIH A;  1MXL C;  2E5R A;  2LVK A;  2VRW B;  2YUU A;  5FUX A;  2A4J A;  1N13 A;  1BF5 A;  2OS8 C;  1LIN A;  3OX5 A;  5ER4 X;  5HLV A;  5AAN A;  4DCK A;  4YRU A;  1CGJ I;  1SGY I;  1SCM B;  2LUC A;  4OKH A;  1QV0 A;  1YRU B;  3C1V A;  3WHT B;  1F71 A;  2FCE A;  1JSA A;  1G8I A;  1LVC D;  1DT7 B;  2JRF A;  2KGB C;  1K96 A;  3B4V C;  4XJK A;  1D1O A;  2FOT A;  5GQQ C;  1QVI Y;  5PAL A;  2XRC A;  1KSO A;  2PAS A;  1H8B A;  1KK7 Y;  2KMP A;  2LP3 A;  1C7V A;  2VRG A;  1RK9 A;  4UXI A;  4NDC A;  2BKI B;  4JQ0 D;  3OXF A;  1E8A A;  1SRA A;  1Y0V H;  1W3S A;  3H4S E;  5TNC A;  1WLZ A;  1M8B A;  3OB1 B;  1TIZ A;  3VGO A;  1X02 A;  3AAJ A;  3DVM A;  1WLM A;  1TBQ R;  3I5H B;  4M2P A;  2UZ3 A;  2YQP A;  2BCX A;  1M39 A;  1J1E A;  4GBA A;  3DF0 B;  1HT9 A;  1BOD A;  3CR5 X;  1V1I A;  3SG7 A;  1TBO A;  2BE6 A;  3JTD C;  4IL1 A;  2ROW A;  5FUY A;  4CLN A;  2I18 A;  1XK4 C;  2WOR A;  4GAO A;  1B7T Y;  4YGB B;  2ENZ A;  2L8E A;  3BJI A;  2MJW B;  2KAY A;  1SGQ I;  2ZNE A;  1WRL A;  2BE4 A;  4QJ5 B;  1CFF A;  3K21 A;  4YI9 A;  4MSP A;  1UP5 A;  1JC2 A;  2Y5I A;  1XA6 A;  3EK7 A;  5D69 A;  1RRO A;  1X4S A;  1Z7K B;  2CJS C;  2QQ0 A;  1CLL A;  3RM1 A;  1AK8 A;  1CHO I;  1IJ6 A;  3PDN A;  3BXK A;  1PTR A;  2WCE A;  1MF8 B;  5HI7 A;  5HKW A;  1KK8 C;  1YR5 A;  3KO0 A;  1DJI A;  1S6C A;  2NZ0 A;  3GOF A;  2LLU A;  3IF7 A;  3SIA A;  4A4B A;  4JPZ B;  2F2P A;  1YU6 C;  3OXL A;  2B0U C;  1FW4 A;  2L4H A;  1RWY A;  4YGA A;  1RTP 1;  3GK4 X;  3TDU A;  2PMY A;  3O2P A;  2LAP A;  2M49 B;  1DS2 I;  2LM5 A;  4DRW A;  4PE4 A;  1SGP I;  1XFX O;  3SG4 A;  4HGU A;  4SGB I;  1OQP A;  4ZCU A;  2V53 A;  2WCB A;  3BUW B;  2OS8 B;  3BQ3 A;  2CBL A;  1QLS A;  3CWG A;  4GGN A;  1PCE A;  4AQJ A;  5JOL A;  4I5N B;  2BEC A;  5J3X A;  4C0J A;  1CDM A;  4HRG A;  3SEK C;  1DJY A;  4C0L A;  4QJ4 B;  1YTZ C;  5ER5 A;  1F4O A;  3QTL D;  4UXJ A;  2DB6 A;  2HET A;  4ETO A;  1SR6 C;  1JFK A;  1B8C A;  3DD4 A;  3PLF B;  2NU0 I;  1JBA A;  1XBT A;  2KQ6 A;  1ODB A;  1U5K A;  1TBN A;  3OL0 A;  1XFZ O;  1XFY O;  2K2F A;  2M5X A;  2P6A C;  2Y1N A;  1YUR A;  3KPX A;  1J7R A;  5I2L A;  5AXI A;  2GV5 A;  1XK4 A;  3NSO A;  2MA2 A;  1J1D A;  3BYA A;  3LCP C;  1SY9 A;  2F33 A;  2JW6 A;  4FKD A;  2I94 A;  1TUS A;  1VRK A;  3BUO B;  1LR8 A;  3CS1 A;  1QLK A;  3BOW B;  4CFR A;  1KQM B;  4HSZ A;  1IQ3 A;  1PUL A;  4GI3 C;  2K8M B;  1S6I A;  3M0W A;  3PAT A;  1QV1 A;  3JVT C;  1UHJ A;  1Y1U A;  2JC2 A;  1NCX A;  3I5I B;  3UGL A;  1PVB A;  4YGD B;  4CID A;  1WDC C;  3JTD B;  1XFV O;  4OCI A;  1DVI A;  2KMO A;  3I5G B;  4PCW A;  1CLB A;  1A4P A;  3SGB I;  1OMD A;  2AUC A;  2BCA A;  4I5J A;  1B4C A;  3MSE B;  1KWO C;  3OX6 A;  1LR7 A;  1AUI B;  1IW4 A;  5F6T A;  1NX2 A;  1FPW A;  2KHN A;  2NU2 I;  2KCX A;  1WRK A;  1L2O C;  1HQV A;  1DJH A;  1M63 B;  3CR2 A;  1M45 A;  5AFP A;  1UHN A;  2M7N A;  1MXE A;  1DJG A;  1V1F A;  2MAZ A;  1A03 A;  3CXL A;  2M1K B;  3SJS A;  2LV7 A;  1F54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...