1BMOA

Bm-40, fs/ec domain pair
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
233
structure length
233
Chain Sequence
b'PCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BM-40
publication title Crystal structure of a pair of follistatin-like and EF-hand calcium-binding domains in BM-40.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Extracellular module
total genus 71
structure length 233
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
A PF09289 FOLN Follistatin/Osteonectin-like EGF domain
A PF10591 SPARC_Ca_bdg Secreted protein acidic and rich in cysteine Ca binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1bmoA02
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1bmoA01
2ZN8A 2H2KA 1S6JA 3SG6A 4ZCUA 2I18A 2KYFA 1S6CA 4ORBB 2N17A 3HH2C 2JU0A 2ZNDA 2KI4C 3O4YA 4M2OA 1A75B 1BR1B 1DJIA 5ER5A 2KGRA 2GGMA 2LANA 1MF8B 4WQ2A 4OVOA 3FIAA 1J55A 1S5GY 2OS8C 3VROA 4MSPA 4DRWA 5HYDA 4TNCA 1C07A 2PMYA 5AEQA 1KFXL 2JT0A 2AAOA 1BLQA 1A29A 1BODA 5DAEA 3DVEA 2B1UA 5I8NA 1KMAA 2NU1I 2KOTA 1CB1A 1FF1A 1F55A 1IQ5A 1NX1A 3I5GC 3DVMA 1TURA 1SL9A 2BBNA 2KYCA 4BY4A 1XFWO 2L5XB 4PHNA 1YU6C 1UHIA 2Y1MA 2LP2A 2FOTA 4QJ5B 4PALA 1K95A 2LHIA 3CGAA 2SCPA 2M1KB 1BT6A 1SGRI 3NSKA 3TS5B 4I5NB 2WCBA 4MBEA 1KCYA 2K7BA 1YX7A 5JOLA 2NZ0A 1RFJA 2N52A 1UHHA 1LVCD 2NCOA 4PE7A 4PHJA 1QASA 4NQGA 1Y1UA 3DVKA 3OP0A 3BUMB 1KQMC 3BOWB 3EVVA 3KEVA 4DCKA 5GQQC 1NSHA 1R2UA 3WXAA 5I2QA 1MR8A 1F54A 3WNXB 1K9UA 1TNPA 3TDUA 3SG5A 3VRQA 2KAYA 2M49B 2ZRSA 4NDCA 2LE9B 2SGDI 1MWNA 2OVOA 2JQ6A 1JFKA 4JWQA 1NX2A 4GAOA 3OB1B 1UP5A 5CPVA 3KO0A 2BKHB 3TDZA 1CDMA 4C0JA 2JYYA 1ZMZA 1SR6B 1L2OB 2BL0C 1SGPI 1JUOA 2L98A 3VRRA 1TRFA 1H0ZA 4MZLA 1BMOA 2F33A 1CMGA 3VRPA 1H4BA 4CIDA 4OVNF 2L51A 1SL7A 2LVVA 4YGCB 2L0PA 3RLZA 3D0YA 3PN7C 4DUQA 1V1GA 5JJGA 1QIWA 2GKTI 1KQVA 1YR5A 1ZACA 1SGDI 1UUSA 3DF0A 1IG5A 1SGEI 1DTLA 3I5IC 4GUKA 1AJ5A 2COLB 1G33A 1CDLA 5AXIA 1W7JB 3IQQA 2L2EA 1NCYA 3A4UB 3O2PA 4JPZB 2BCAA 1ZFSA 1N2DA 4D1EA 2GKVA 1XFVO 3GOFA 1SBJA 1NUBA 2E30A 2JULA 3HCMA 3BUOB 2OPOA 1BF5A 3BYAA 4CPVA 1D1OA 4Q04A 1QXPA 3OHMB 1CT2I 1A2XA 2KI6D 1SCVA 3I5HB 3IF7A 2K7CA 3TUYC 1AN1I 1HQVA 2MAZA 1UHKA 3GK2A 1ALVA 5DKNA 1QX5B 1Y1BA 2WCYA 2FJUB 2LMUA 2HETA 2XRCA 1M63B 1QVIY 1HT9A 4PE0A 4YI8A 2NCPA 4FQOA 4A4BA 1K93D 3TDIA 1LXFC 1SKTA 2JWWA 1TOPA 4L9MA 1SL8A 1M31A 2M9GA 4PHMA 1WDCC 1XFUO 2DOQA 4OR9B 1HJAI 4AOMA 3CR5X 3D10A 3IQOA 2ISDA 2K2AA 1NIWA 2LHLA 2WORA 5JHWC 1A03A 2E6WA 2BECA 4R1EA 2LLSA 1BR4B 5G08A 3WHTB 1C7WA 1F70A 2NLNA 1DGVA 1OQPA 1NP8A 1TNWA 4MZKA 3BXKA 3SG2A 1PSRA 1BJFA 1OOJA 1PULA 3FWBA 4YGDB 2NU4I 5HLVA 2KI4B 2PASA 4USLA 2MLEC 1U5IB 2KI6C 4OV2A 1B8RA 2CTNA 1XYDA 4YGEB 1DS3I 2OS8B 1KWOC 2LVKA 5BPJA 2F3ZA 1TIHA 2M3WA 3EKJA 3DF0B 2MA2A 1FYBA 2NU2I 1YUSA 1MT1A 1IY6A 1RECA 1RK9A 3JTDC 3NSLA 1FPWA 5CSNA 2M97A 1S1EA 4JQ0D 1DVIA 2BKIB 2LUXA 1EH2A 1CGJI 1CSOI 1CT4I 4C0LA 1CLMA 1SNLA 2G9BA 2JT3A 1ODBA 1NCZA 4GNKB 1WY9A 5F6TA 1DS2I 3PSRA 2LLTA 3MSEB 1GGWA 3OX5A 2SASA 4MLWA 4PDZA 1BOCA 2LM5A 2CBLA 3KPXA 1DGUA 1DJHA 2GGZA 1TUSA 3OB2B 2KFGA 4CFQA 2NXQA 3LK1A 2I2RE 1ALWA 3BUWB 1TNXA 2KQYA 2KQ6A 2EC6C 1IY5A 2LNKA 2FCDA 2ZKMX 5CSFA 3WHUB 2KSPA 1K2HA 2F3YA 1OYVI 1KQMB 1N65A 2QQCA 1K90D 2CCMA 5I2OA 2PVBA 1N13A 3QTLD 1QLSA 1XFYO 1AVSA 3PM8A 1OMRA 5AERA 1OMVA 2QPTA 2LEOA 2HPSA 3EVUA 1QX2A 1CM4A 1M8CA 1QLKA 1YVHA 2QACA 1AP4A 1F8HA 2CNPA 1IKUA 4CFRA 4FTGA 4PHKA 1GGZA 4F0ZB 2VRGA 2K2FA 4HRGA 1H8BA 3SEKC 1KFUL 1S5GZ 1NPQA 4GGNA 4HSZA 1QV1A 2AUCA 1CFCA 4MRXA 1NWDA 3NXAA 1QX7A 1J1EA 1OMTA 5AANA 1Y0VH 1F71A 1CHOI 3O78A 2NU3I 1PRWA 1HPTA 4U8DA 1KSOA 1JBAA 1YVLA 2CT9A 1B8LA 3PN7B 2JTTA 4NDBA 1PPFI 2BE6A 2WC8A 1W7IB 2M0RA 1MQ1A 3NSOA 2OTGC 3TJQA 3I5IB 4GBAA 2KHNA 3HX4A 1FBVA 2F8PA 1KK7Y 4MVFA 2K0JA 4DIRA 2M7LA 4GGFC 2PRUA 2JNFA 2K7DA 5HKZA 1JSAA 1R6PA 1B7TY 1CLBA 2JRFA 3NSIA 1CE3A 2P6BB 1MUXA 1K9KA 1OMDA 1QS7A 2ZFDA 1SRAA 1B9AA 2LVIA 1KK8C 1MXEA 1DF0A 1SK6D 2JXCA 1IGVA 1UVFA 1SMGA 3SGQI 3SG4A 1NX0A 3SIAA 3BUXB 4E68A 2LV7A 1FI5A 1EXRA 3SGBI 1B4CA 3O6BA 1A75A 1LA0A 2BBMA 1WLMA 3TUYB 3LLEA 1SPYA 2LMTA 1EG3A 4AQJA 1YRTB 3EVRA 4PE4A 2F2PA 3OVOA 3JVTC 1MHOA 1N0YA 2HQWA 1FI6A 2JC2A 4CLNA 2LCPA 4YI9A 2N71A 3LK0A 2KGBC 1WDCB 5CSJA 5AFPA 2M8UA 2MJWB 3AKBA 4OKHA 3VRNA 5K89A 1UUCA 1PK0D 1NX3A 2JPTA 4HRHA 1S36A 2JOJA 2MBXA 1OSAA 3K21A 4YGBB 4XYNA 2KMRA 2KMOA 3AKAA 4UPGA 2M5XA 2KMQA 1TN4A 1CDNA 1TGSI 2QQDA 4PE1A 2L50A 3PLFB 5I2LA 1AUIB 2JXDA 4P2YB 3DVJA 1EJ3A 2Y1NA 3CS1A 3B4VC 1IJ6A 1QIVA 2KNEA 3LCPC 1S3PA 3BQ3A 1SGQI 2WCEA 4ORCB 1PCEA 1KWOB 1YRUB 2Y5IA 2SGPI 3BOWA 2SGQI 1LKJA 1SCMC 1SY9A 1UURA 3SJSA 4OCIA 5J3XA 3D0YB 4M2QA 4HGUA 2D8NA 2LLUA 2O5GA 1GJYA 2SGEI 3EK4A 3I5FC 3JTDB 1UWOA 1X02A 2KDHA 4GGFA 4MEWA 5HLOA 1TNQA 2KBIA 1CTRA 1JF0A 2H61C 1WRZA 2I7AA 1MXLC 3CR4X 4ZCVA 3I5GB 1OE9B 1SYMA 3CLNA 1QVIZ 1ZOTB 1CGII 1TTXA 1KSMA 1PVBA 1WRKA 1YUTA 1R0RI 2MHHA 1DF0B 4DS7A 1F4QA 4XJKA 3TZ1A 1S6IA 4IL1A 1VRKA 3SIBA 5DKRA 2FCEA 1QV0A 4YBHB 1K94A 2EC6B 5PALA 1TCOB 3EKHA 1Y1AA 2M7NA 1CM1A 3H4SE 2BCXA 4ICBA 4WQ3A 2I94A 2LMVA 4SGBI 1KFXS 1LA3A 2GKRI 2R2IA 1TCFA 1XVJA 1CFPA 2KMPA 1Q80A 3FS7A 4GFTA 5ER4X 1K9PA 2HQ8A 2JZMA 1A4PA 1WLZA 5KSZA 2NU0I 3CZTX 1SGNI 1SW8A 3C1VA 2F3CI 1AHRA 1BG1A 1CMFA 1QATA 1AJ4A 3F45A 2A4JA 4ETOA 1IH0A 1F4OA 2O60A 2V53A 1PALA 2K8MB 2WCFA 1IJ5A 2K61A 1UHJA 5CSIA 2EGDA 4P5OE 2BL0B 2LP3A 1B47A 3OX6A 1YTPA 1AK8A 2ERWA 1B1GA 3TS5C 2ZNEA 1NCXA 1ZUZA 3RM1A 1DMOA 1LR7A 1Z7KB 2MLFC 1IRJA 4BY5A 3DD4A 4N1GA 1YX8A 5HKWA 1RJVA 1XFZO 2OTGB 1K8UA 1PJUA 1Y1XA 2RGIA 4MRYA 4YGAA 4I5KA 1J7RA 1DJGA 2WOSA 5KU1A 1CFDA 1KFUS 2L4HA 2IS9A 4C0KA 1XK4C 2KFHA 3ZWHA 2HF5A 1FW4A 2M29A 3PALA 2H61A 1L7ZA 1OZOA 3GK1A 1M8BA 2G2BA 3SG3A 3VGOA 3CR2A 1KK8B 1CNPA 3E3RA 3CWGA 1JF2A 1LR8A 3BUNB 3GK4X 1C7VA 4NDDA 1PVAA 1WRLA 1GQMA 2BE4A 1SR6C 2F2OA 1L2OC 2LUCA 2ZN9A 2JZIA 3CTNA 4XJKB 1JC2A 1CLLA 5FYXA 1U5IA 2BCBA 2CXJA 3A8RA 4GPLB 2ZRTA 1J7PA 1UHNA 2LAPA 4ORAB 5B8IB 1DJWA 2KBMA 3QRXA 5HKYA 2PSRA 1IQ3A 1XO5A 1V1FA 2LVJA 3JVTB 1QTXA 1M46A 5DKQA 4AQIA 1IWQA 1RTP1 1RROA 2B0UC 3KHEA 1PSBA 1G8IA 2WNDA 1LR9A 1LINA 2PALA 4MN0A 1G4YR 1TBQR 1OVOA 1JFJA 1DJZA 2L4IA 2Q91A 1S26D 1J7QA 1M45A 2JNXA 1YTZC 2M1UA 3SG7A 1UVGA 2ARPF 1CT0I 2K7OA 2JTZA 3KF9A 2KAVA 4MZJA 5IBWA 2GV5A 1SGYI 3AAJA 4QJ3B 4I5JA 1CKKA 3EK8A 1CDPA 4M2PA 1EG4A 2JXLA 4QJ4B 5KTYA 1IW4A 1KK7Z 1OZSA 2KFFA 5D7FA 1XA5A 1E8AA 1OMUA 1NYAA 1Y6WA 2TN4A 3I5HC 1HDLA 1YUUA 1M39A 2EHBA 1B8CA 1B7TZ 2AMIA 3PATA 1EL4A 2SGFI 3LL8B 3M0WA 3PFVA 4YRUA 1SCMB 1JWDA 1Y1CA 1BUSA 4WRIA 1QJTA 2JT8A 1DJYA 4N1FA 1TBRR 3ZNIA 3I5FB 1DT7B 1XK4A 1DJXA 4HREE 4GI3C 2Y4QA 2MRDA 1J7OA 1RWYA 2BUSA 1J1DA 4I5LB 2KAXA 3FWCA 4A4CA 5D69A 3EK7A 1XFXO 2LC5A 4N5XA 1YURA 1CFFA 1BU3A 3AAKA 4PCWA 5TNCA 3ICBA 2KCXA 1K96A 2P6AC 2Q4UA 1TIZA
chains in the Genus database with same CATH superfamily
2ZN8A 3SG6A 2N17A 3HH2C 2GTEA 5J8FA 2ZNDA 2KI4C 3O4YA 4M2OA 2WVJA 1BR1B 2OS8C 5HYDA 3D77A 4TNCA 1BLQA 1BODA 2WCKA 5DAEA 5E3RA 4WP4A 1FF1A 3FSYA 3D74A 4BY4A 4QJ5B 1TBOA 4I5NB 2WCBA 1YX7A 5JOLA 1UHHA 4PE7A 1Y1UA 3DY9A 3S0BA 3KEVA 5I2QA 3WNXB 1TNPA 2PYQA 2OVOA 4GAOA 2BKHB 2JYYA 1SR6B 1SGPI 2L98A 1TRFA 1H0ZA 1BMOA 2F33A 1CMGA 1XA6A 1H4BA 3B86A 4OVNF 4CIDA 2L51A 1SL7A 2LVVA 1W9ZA 3PN7C 4DUQA 1QIWA 3VB1A 4PT1A 3DF0A 1DTLA 4GUKA 1AJ5A 5D3OA 3IQQA 2L2EA 3A4UB 2UVOA 1SBJA 2JULA 4A24A 1BF5A 2KI6D 1OOIX 1AN1I 3TUYC 2QEOA 1UHKA 2LMUA 4A4BA 4L9MA 1WDCC 1XFUO 3D10A 3BFHA 1A03A 2BECA 1BR4B 1F70A 1C7WA 5CCMA 1OQPA 1TNWA 1OOJA 2NU4I 2KI4B 2PASA 2MLEC 3NHIA 1XYDA 1DS3I 2OS8B 1KWOC 2F3ZA 2M3WA 2MA2A 1FYBA 1YUSA 1RECA 1RK9A 3JTDC 3FE8A 1CLMA 2G9BA 4GNKB 3D73A 1BOCA 2LM5A 2J87A 1TNXA 4FKDA 3WHUB 1VDDA 1DC1A 1N65A 1XFYO 1QX2A 3O4XA 2QACA 1IKUA 4PHKA 2VRGA 1H8BA 4GGNA 1S5GZ 1ULNA 2AUCA 5FI7A 2NU3I 1YVLA 4NDBA 3PN7B 2JTTA 3NSOA 3TJQA 2QQEA 1FBVA 2K0JA 2M7LA 3SS4A 5HKZA 1JSAA 2JRFA 1FY7A 1MUXA 1K9KA 1OMDA 1QS7A 2ZFDA 1B9AA 1MXEA 1SK6D 1UVFA 1IGVA 5EX3A 3CDNA 1NX0A 3SIAA 3TUYB 2GVIA 1SPYA 1YRTB 2F2PA 2N71A 1WDCB 2M8UA 3VRNA 5K89A 4UXJA 2QEVA 1S36A 1OSAA 1NXUA 2LUYA 2CWFA 1TN4A 2QQDA 3PLFB 2YUUA 3CZ0A 3LCPC 1S3PA 3BQ3A 1KWOB 2WCJA 5J3XA 4M2QA 2D8NA 5CCLA 2SGEI 3EK4A 3I5FC 3JTDB 1X02A 1CTRA 3RU0A 3TOBA 1CGII 1KSMA 1WRKA 2ORWA 4IL1A 5DKRA 1QV0A 5PALA 1CM1A 4SGBI 2GKRI 1TCFA 1CFPA 1K7VA 1Q80A 3FS7A 1K9PA 2HQ8A 2JZMA 1MJ9A 1WLZA 3CZTX 1SW8A 1AJ4A 4ETOA 1PALA 2K8MB 2BL0B 3OX6A 1AK8A 1YX8A 1XFZO 1K8UA 4JKTA 3FE9A 1KBEA 2RGIA 4I5KA 5KU1A 1CFDA 2KFHA 2M29A 2H61A 1OZOA 4NDDA 4YI8A 1GQMA 3E2IA 2ZN9A 1L2OC 4XJKB 3QAHA 1JC2A 1U5IA 2CXJA 4GPLB 1J7PA 2ZRTA 3QRXA 1XO5A 1V1FA 4DNCA 1IWQA 2B0UC 1PSBA 1DQEA 1JFJA 1J7QA 1YTZC 2ARPF 1UVGA 1CT0I 2GIVA 5IBWA 2GV5A 4AMLA 1CKKA 2QEHA 1R79A 4QJ4B 5KTYA 1OZSA 1XA5A 1E8AA 2AMIA 3CZ1A 2SGFI 3LL8B 1JWDA 1Y1CA 1BUSA 2JT8A 4N1FA 3DZTA 3I5FB 4GI3C 2Y4QA 2PQLA 2BUSA 2KAXA 4A4CA 3EK7A 3KY9A 1XFXO 1YURA 1CFFA 3IVTA 5TNCA 3ICBA 1DELA 1TIZA 1S6JA 2JU0A 5ER5A 2LANA 1J55A 5AEQA 3EG5B 1A29A 2B1UA 1KMAA 2KOTA 1CB1A 1F55A 1SL9A 2KYCA 4PHNA 1UHIA 2FOTA 3CGAA 2SCPA 3DXLA 1SGRI 1U5KA 4MBEA 1KCYA 2N52A 1QASA 4NQGA 3OP0A 3BUMB 1KQMC 3EVVA 4DCKA 1NSHA 2X3TA 1MR8A 3R5DA 3VRQA 2KAYA 3S0FA 3OB1B 5CPVA 3K1EA 3KO0A 1CDMA 1ZMZA 1L2OB 2QDIA 2GKTI 1KQVA 1YR5A 3S0EA 1ZACA 3OXLA 2P71A 1SGEI 3I5IC 1CDLA 4JPZB 3O2PA 2GKVA 1Q9BA 1NUBA 2E30A 3BUOB 2OPOA 4CPVA 1D1OA 1CT2I 2K7CA 3GK2A 2KLDA 2WCYA 1Y1BA 2FJUB 2HETA 4PE0A 2NCPA 3S0AA 1M31A 1KBFA 2DOQA 4OR9B 1HJAI 1XBTA 3CR5X 2N1AB 2K2AA 3FE6A 3WHTB 2X52A 1V1IA 1NP8A 4MZKA 4YGDB 4USLA 1U5IB 2KI6C 4OV2A 1ULKA 5BPJA 2VRWB 3UO9A 1IY6A 3NSLA 2M97A 1S1EA 4JQ0D 2LUXA 1EH2A 1CSOI 4C0LA 2JT3A 1NCZA 2LLTA 1GGWA 3OX5A 4MLWA 2CBLA 3TO9A 1T14A 2ENNA 2EC6C 2LNKA 2KSPA 1OYVI 1KQMB 3BJIA 5I2OA 2PVBA 3PM8A 5AERA 1OMVA 2QPTA 2LEOA 1CM4A 1YVHA 9WGAA 4CFRA 4FQTA 4HRGA 3SEKC 1KFUL 4HSZA 4MRXA 3NXAA 4KYNA 3SS3A 1OMTA 1F71A 3CXLA 1B8LA 2BE6A 2RC4A 3I5IB 4GBAA 1KK7Y 4MVFA 4GGFC 2PRUA 2JNFA 4INXA 2K7DA 3PJIA 3R1PA 1B7TY 1V1HA 1SMGA 1SSEB 1EXRA 3SGBI 3EVRA 3JVTC 1MHOA 2HQWA 2JC2A 4CLNA 2LCPA 1RFHA 2MJWB 4OKHA 1PK0D 2MBXA 4XYNA 2BNXA 2KMOA 3UGIA 3AKAA 4UPGA 2M5XA 1CDNA 1X4SA 1C3YA 3DVJA 2Y1NA 3CS1A 3TOAA 2KNEA 1SGQI 1YRUB 2SGPI 2PQ8A 2SGQI 1SCMC 3SJSA 4OCIA 2O5GA 1GJYA 2OU2A 1UWOA 2KDHA 1TNQA 3R1VA 5DICA 4ZCVA 2DB6A 1OE9B 2MHHA 1DF0B 4XJKA 2WC5A 4YBHB 2JPOA 1K94A 2EC6B 4ICBA 4WQ3A 2KMPA 5ER4X 1IIOA 3B6XA 5KSZA 3R5CA 1SGNI 1BG1A 2O60A 2WCFA 2V53A 2K61A 2EGDA 3TS5C 3OXFA 1ZUZA 3RM1A 1DMOA 2MLFC 4BY5A 5HKWA 3L47A 5E3PA 4MRYA 4YGAA 1DJGA 2L4HA 4C0KA 1XK4C 3PDNA 2HF5A 3GK1A 1M8BA 3SG3A 1TUJA 3CWGA 1C7VA 1PVAA 1CLLA 5FYXA 1UHNA 2LAPA 1X74A 1HEVA 3D76A 2PSRA 3JVTB 4AQIA 3KHEA 1LR9A 2QPOA 4MN0A 1TBQR 2Q91A 1S26D 2JTZA 5HQ8A 4QJ3B 4I5JA 2KLEA 3EK8A 4M2PA 1EG4A 1OMUA 2KFFA 1Y6WA 3S0DA 4JD9A 1YUUA 2H8VA 3M0WA 1SCMB 1QJTA 1Z2CB 3ZNIA 1J7OA 3OBVA 5FI2A 4I5LB 3R72A 3AAKA 2QQCA 2Q4UA 2KYFA 1S6CA 4ORBB 1W4RA 2ORVA 4JCVE 1DJIA 3QMEA 2GGMA 4WQ2A 3FIAA 4MSPA 2CJSC 1C07A 2ENZA 2JT0A 3DVEA 5I8NA 2NU1I 2A20A 1IQ5A 1NX1A 3I5GC 2UZ3A 3DVMA 1TURA 2BBNA 2L5XB 2WC6A 1YU6C 2DKVA 2Y1MA 4PALA 1K95A 2LHIA 2M1KB 1BT6A 3NSKA 3TS5B 2NZ0A 1RFJA 3DVKA 1PTQA 3R5BA 3WXAA 1F54A 3SG5A 2M49B 2ZRSA 4NDCA 1MWNA 4JWQA 1JFKA 1NX2A 1UP5A 3DYEA 3TDZA 2FNFX 3UEYA 3VRRA 3VE5A 1C3ZA 4MZLA 3RLZA 3D0YA 1V1GA 5JJGA 5HL1A 1IG5A 2COLB 1Z4HA 1NCYA 2BCAA 1N2DA 4D1EA 3HCMA 4Q04A 1QXPA 2P70A 3PM2A 1ALVA 5DKNA 1QX5B 1M63B 1S20A 1QVIY 4FQOA 1K93D 3TDIA 1LXFC 1SKTA 2JWWA 1TOPA 2M9GA 4PHMA 3V2LA 4AOMA 3IQOA 2ISDA 4MPIA 2E6WA 5G08A 1PSRA 1BJFA 3FWBA 5HLVA 1K7TA 1B8RA 2CTNA 4YGEB 2LVKA 1TUZA 2QQ0A 3EKJA 2NU2I 2BKIB 1CT4I 1P9GA 1CGJI 1SNLA 1ODBA 3QWPA 5F6TA 1WY9A 3KPXA 1TBNA 1DGUA 2GGZA 3OB2B 4CFQA 5I94A 2KQYA 1IY5A 2FCDA 2ZKMX 5CSFA 1UHAA 1K90D 2JW6A 1OMRA 1OOGA 2HPSA 2RIJA 1M8CA 3FC3A 1QLKA 1AP4A 1WGCA 4FTGA 2V1CC 1NPQA 3BFBA 3R5AA 1QV1A 1CFCA 1NWDA 3UGLA 3UOEA 1QX7A 1J1EA 1Y0VH 3O78A 1PRWA 4U8DA 1KSOA 1JBAA 1PPFI 1W7IB 2M0RA 3Q8IA 1MQ1A 3TO7A 1CLBA 1CE3A 2P6BB 1SRAA 2LVIA 1KK8C 1DF0A 3SGQI 3BUXB 4E68A 1FI5A 1B4CA 1XX6A 3O6BA 1A75A 1WLMA 3LLEA 2LMTA 3OVOA 1FI6A 2ODDA 2KGBC 5CSJA 3AKBA 2KPHA 1NX3A 2JPTA 4HRHA 3K21A 2KMRA 4YGBB 2ROWA 1FARA 2KMQA 1TGSI 4PE1A 2L50A 5I2LA 2JXDA 3B4VC 1IJ6A 2WCEA 4ORCB 2YQPA 3BOWA 1SY9A 1Z2IA 3D0YB 4HGUA 2LLUA 4GGFA 5HLOA 2I7AA 1WRZA 1MXLC 3B87A 3CLNA 1ZOTB 4INWA 2E5RA 1TTXA 1PVBA 1YUTA 2L2CA 4DS7A 3NHTA 1F4QA 3TZ1A 1TCOB 2J9RA 3EKHA 1Y1AA 2M7NA 1GM0A 2BCXA 2I94A 2LMVA 1KFXS 1LA3A 1OOFA 4GFTA 1A4PA 1CMFA 1QATA 3F45A 1IH0A 3UNWA 1UHJA 5CSIA 4P5OE 1B1GA 1NCXA 1Z7KB 1IRJA 3DD4A 1RJVA 1PJUA 3D75A 1J7RA 2IS9A 4OZDA 3ZWHA 4E1PA 1FW4A 3PALA 3UFFA 2G2BA 3VGOA 1ORGA 3CR2A 3TO6A 1KK8B 1LR8A 3CTNA 2BCBA 2L5YA 3A8RA 4ORAB 1WTJA 5B8IB 2KBMA 5HKYA 2LVJA 1QTXA 1M46A 2WNDA 1LINA 1G4YR 1OVOA 1DJZA 2WCLA 2M1UA 3SG7A 3KF9A 2KAVA 1SGYI 1CDPA 2JXLA 1KK7Z 5D7FA 3I5HC 1B7TZ 3PATA 1EL4A 3PFVA 4YRUA 1XK4A 1Y8FA 2MRDA 1J1DA 2ELIA 3FWCA 2LC5A 4N5XA 4F7FA 1JF2A 4UXIA 2H2KA 2FJYA 4ZCUA 2I18A 2L8EA 1A75B 2KGRA 4OVOA 1MF8B 1S5GY 3VROA 4DRWA 2PMYA 3UGDA 1KFXL 2AAOA 2YGUA 1XFWO 3B7AA 2LP2A 1TWOA 2K7BA 1LVCD 2NCOA 4PHJA 3BOWB 5GQQC 1R2UA 1QWVA 1K9UA 3NGVA 2LE9B 2SGDI 2JQ6A 4C0JA 2BL0C 1JUOA 3VRPA 3FSXA 3L4AA 4YGCB 2L0PA 1WGTA 1OW4A 1SGDI 1UUSA 1G33A 5AXIA 1W7JB 5FI6A 1ZFSA 1MJAA 1XFVO 3GOFA 3BYAA 3OHMB 1A2XA 1SCVA 3I5HB 3IF7A 1HQVA 2MAZA 2XRCA 3R1OA 1HT9A 3L4LA 5EL2A 1SL8A 2LB7A 5HI7A 1NIWA 2LHLA 2WORA 5FUWA 5JHWC 3CYZA 4R1EA 2LLSA 4E1RA 2NLNA 1DGVA 3BXKA 3SG2A 1PTRA 1PULA 4B6DA 1TIHA 2QEBA 3DF0B 1MT1A 2DIPA 1FPWA 5CSNA 1DVIA 4IJ7A 1DS2I 3PSRA 1FAQA 3MSEB 2SASA 4PDZA 2BAPA 1DJHA 1TUSA 3CABA 5E3QA 2KFGA 2NXQA 3LK1A 2I2RE 1ALWA 3BUWB 3S0GA 2KQ6A 1XFRA 1K2HA 2F3YA 2CCMA 3QTLD 1N13A 1QLSA 1AVSA 3EVUA 1F8HA 2CNPA 1GGZA 4F0ZB 2K2FA 3RZSA 5AANA 1CHOI 2CT9A 3SS5A 2WC8A 2OTGC 2Y0MA 1LS8A 2KHNA 3B88A 3HX4A 7WGAA 3GOXA 2F8PA 4DIRA 1R6PA 1P9ZA 3NSIA 3UEJA 3D00A 5FUXA 2JXCA 3SG4A 2LV7A 1TOTA 3BJHA 1LA0A 2BBMA 2CWGA 1EG3A 4AQJA 4PE4A 1N0YA 3VDUA 4YI9A 3LK0A 1DEKA 5AFPA 1UUCA 2V1CA 2JOJA 3E59A 3OXGA 5J8CA 3MEKA 1AUIB 4P2YB 1EJ3A 1QIVA 1PCEA 2Y5IA 5FUYA 2OZUA 1LKJA 1UURA 3VDPA 2L7XA 1WKXA 4MEWA 2CWHA 2K9HA 2KBIA 1JF0A 2H61C 3CR4X 3I5GB 1SYMA 1QVIZ 1R0RI 1S6IA 1VRKA 3SIBA 2FCEA 3H4SE 3OGNA 2WCHA 2R2IA 1XVJA 2ERBA 2K60A 5EX0A 2NU0I 2F3CI 3C1VA 1AHRA 3D78A 2E73A 2A4JA 1F4OA 1IJ5A 2LP3A 1B47A 2B8TA 3CZ2A 1YTPA 2ERWA 2ZNEA 1LR7A 2OD1A 4N1GA 2OTGB 1Y1XA 2WOSA 1KFUS 3N7HA 1L7ZA 1ULMA 1CNPA 3E3RA 3BUNB 3GK4X 3OL0A 1P28A 1WRLA 1HPTA 2BE4A 2LUCA 1SR6C 2F2OA 2JZIA 1OOHA 3BFAA 1W3SA 1DJWA 2WGCA 1IQ3A 5DKQA 1RTP1 1RROA 1K7UA 1G8IA 2PALA 2L4IA 1M45A 2JNXA 2K7OA 4MZJA 1MJBA 3AAJA 4UXHA 1IW4A 1NYAA 2TN4A 1HDLA 1M39A 2EHBA 1B8CA 4WRIA 1DJYA 2W0TA 1TBRR 1DT7B 2WCMA 2JA1A 1DJXA 4HREE 1RWYA 5D69A 5FUVA 1BU3A 4PCWA 2P6AC 2KCXA 1K96A 3TDUA
chains in the Genus database with same CATH topology
2ZN8A 2H2KA 1S6JA 3SG6A 4ZCUA 2I18A 4UXIA 2KYFA 1S6CA 4ORBB 1W4RA 2N17A 2ORVA 3HH2C 2L8EA 2JU0A 4JCVE 2ZNDA 2KI4C 3O4YA 4M2OA 2WVJA 1A75B 1BR1B 1DJIA 5ER5A 2KGRA 2GGMA 2LANA 1MF8B 4WQ2A 4OVOA 3FIAA 1J55A 1S5GY 2OS8C 3VROA 4MSPA 4DRWA 5HYDA 4TNCA 1C07A 2CJSC 2PMYA 5AEQA 2ENZA 3UGDA 1KFXL 2JT0A 2AAOA 1BLQA 1A29A 1BODA 5DAEA 3DVEA 2B1UA 5I8NA 1KMAA 2NU1I 2KOTA 1CB1A 1FF1A 2A20A 1F55A 1IQ5A 1NX1A 3I5GC 2UZ3A 3DVMA 1TURA 1SL9A 2BBNA 2KYCA 4BY4A 1XFWO 2L5XB 4PHNA 1YU6C 1UHIA 2Y1MA 2LP2A 2FOTA 4QJ5B 4PALA 1TBOA 1K95A 2LHIA 3CGAA 2SCPA 2M1KB 1BT6A 1SGRI 1U5KA 3NSKA 3TS5B 4I5NB 2WCBA 4MBEA 1KCYA 2K7BA 1YX7A 5JOLA 2NZ0A 1RFJA 2N52A 1UHHA 1LVCD 2NCOA 4PE7A 4PHJA 1QASA 4NQGA 1Y1UA 3DVKA 3OP0A 3BUMB 1PTQA 1KQMC 3BOWB 3EVVA 3KEVA 4DCKA 5GQQC 1NSHA 1R2UA 3WXAA 5I2QA 1MR8A 1F54A 3WNXB 1K9UA 1TNPA 3TDUA 3SG5A 3VRQA 2KAYA 2M49B 2ZRSA 4NDCA 2LE9B 2SGDI 1MWNA 2OVOA 2JQ6A 1JFKA 4JWQA 1NX2A 4GAOA 3OB1B 1UP5A 5CPVA 3KO0A 2BKHB 3TDZA 2FNFX 3UEYA 1CDMA 4C0JA 2JYYA 1ZMZA 1SR6B 1L2OB 2BL0C 1SGPI 1JUOA 2L98A 3VRRA 1TRFA 3VE5A 1H0ZA 4MZLA 1BMOA 2F33A 1CMGA 1XA6A 3VRPA 1H4BA 4CIDA 4OVNF 2L51A 1SL7A 2LVVA 4YGCB 2L0PA 3RLZA 3D0YA 3PN7C 4DUQA 1V1GA 5JJGA 1QIWA 2GKTI 1KQVA 1YR5A 1ZACA 1SGDI 3OXLA 1UUSA 3DF0A 1IG5A 1SGEI 1DTLA 3I5IC 4GUKA 1AJ5A 2COLB 1G33A 1CDLA 5AXIA 1W7JB 3IQQA 2L2EA 1NCYA 3A4UB 3O2PA 4JPZB 2BCAA 1ZFSA 1N2DA 4D1EA 2GKVA 1XFVO 3GOFA 1SBJA 1NUBA 2E30A 2JULA 3HCMA 4A24A 3BUOB 2OPOA 1BF5A 3BYAA 4CPVA 1D1OA 4Q04A 1QXPA 3OHMB 1CT2I 1A2XA 2KI6D 1SCVA 3I5HB 3IF7A 2K7CA 3TUYC 1AN1I 1HQVA 2MAZA 1UHKA 3GK2A 1ALVA 5DKNA 1QX5B 1Y1BA 2WCYA 2FJUB 2LMUA 2HETA 2XRCA 1M63B 1QVIY 1HT9A 4PE0A 4YI8A 2NCPA 4FQOA 4A4BA 1K93D 3TDIA 1LXFC 1SKTA 2JWWA 1TOPA 4L9MA 1SL8A 1M31A 2M9GA 4PHMA 1KBFA 1WDCC 1XFUO 2DOQA 4OR9B 1HJAI 5HI7A 4AOMA 1XBTA 3CR5X 3D10A 3IQOA 2ISDA 2N1AB 2K2AA 1NIWA 2LHLA 2WORA 5FUWA 5JHWC 1A03A 2E6WA 2BECA 4R1EA 2LLSA 1BR4B 5G08A 3WHTB 1C7WA 1F70A 4E1RA 5CCMA 2NLNA 1DGVA 1OQPA 1V1IA 1NP8A 1TNWA 4MZKA 3BXKA 3SG2A 1PTRA 1PSRA 1BJFA 1OOJA 1PULA 3FWBA 4YGDB 2NU4I 5HLVA 2KI4B 2PASA 4USLA 2MLEC 1U5IB 4B6DA 2KI6C 4OV2A 1B8RA 2CTNA 1XYDA 4YGEB 1DS3I 2OS8B 1KWOC 2LVKA 5BPJA 2F3ZA 1TIHA 2M3WA 2QQ0A 2VRWB 3EKJA 3DF0B 2MA2A 1FYBA 2NU2I 1YUSA 1MT1A 1IY6A 2DIPA 1RECA 1RK9A 3JTDC 3NSLA 1FPWA 5CSNA 2M97A 1S1EA 4JQ0D 1DVIA 2BKIB 2LUXA 1EH2A 1CGJI 1CSOI 1CT4I 4C0LA 1CLMA 1SNLA 2G9BA 2JT3A 1ODBA 1NCZA 4GNKB 1WY9A 5F6TA 1DS2I 3PSRA 3QWPA 1FAQA 2LLTA 3MSEB 1GGWA 3OX5A 2SASA 4MLWA 4PDZA 1BOCA 2LM5A 2CBLA 3KPXA 1TBNA 1DGUA 1DJHA 2GGZA 1TUSA 3OB2B 2KFGA 4CFQA 2NXQA 3LK1A 2I2RE 1ALWA 3BUWB 2J87A 1TNXA 2KQYA 2KQ6A 2ENNA 2EC6C 4FKDA 1IY5A 2LNKA 2FCDA 2ZKMX 5CSFA 3WHUB 2KSPA 1K2HA 1VDDA 2F3YA 1OYVI 1KQMB 1N65A 3BJIA 2QQCA 1K90D 2CCMA 5I2OA 2PVBA 1N13A 2JW6A 1QLSA 3QTLD 1XFYO 1AVSA 3PM8A 1OMRA 5AERA 1OMVA 2QPTA 2LEOA 2HPSA 3EVUA 1QX2A 1CM4A 1M8CA 3FC3A 1QLKA 1YVHA 2QACA 1AP4A 1F8HA 2CNPA 1IKUA 4CFRA 4FTGA 4PHKA 1GGZA 4F0ZB 2V1CC 2VRGA 2K2FA 4HRGA 1H8BA 3SEKC 1KFUL 1S5GZ 1NPQA 4GGNA 4HSZA 1QV1A 2AUCA 1CFCA 4MRXA 1NWDA 3UGLA 3NXAA 1QX7A 1J1EA 1OMTA 5AANA 1Y0VH 1F71A 1CHOI 3O78A 2NU3I 1PRWA 1HPTA 4U8DA 1KSOA 1JBAA 1YVLA 3CXLA 2CT9A 1B8LA 3PN7B 2JTTA 4NDBA 1PPFI 2BE6A 2WC8A 1W7IB 2M0RA 1MQ1A 3NSOA 2OTGC 3TJQA 3I5IB 4GBAA 2KHNA 3HX4A 2QQEA 3GOXA 1FBVA 2F8PA 1KK7Y 4MVFA 2K0JA 4DIRA 2M7LA 4GGFC 2PRUA 2JNFA 2K7DA 5HKZA 1JSAA 3E2IA 1R6PA 1B7TY 1CLBA 2JRFA 3NSIA 1CE3A 2P6BB 1MUXA 1K9KA 1V1HA 1OMDA 1QS7A 3UEJA 2ZFDA 1SRAA 1B9AA 2LVIA 1KK8C 3D00A 1MXEA 5FUXA 1DF0A 1SK6D 2JXCA 1IGVA 1UVFA 1SMGA 5EX3A 3SGQI 3SG4A 1NX0A 3SIAA 3BUXB 4E68A 2LV7A 1FI5A 1EXRA 1TOTA 1B4CA 1XX6A 3O6BA 1A75A 1LA0A 2BBMA 3SGBI 1WLMA 3TUYB 3LLEA 2GVIA 1SPYA 2LMTA 1EG3A 4AQJA 1YRTB 3EVRA 4PE4A 2F2PA 3OVOA 3JVTC 1MHOA 1N0YA 3VDUA 2HQWA 1FI6A 2JC2A 4CLNA 2LCPA 1RFHA 4YI9A 2N71A 3LK0A 2KGBC 2ODDA 1WDCB 5CSJA 5AFPA 2M8UA 2MJWB 3AKBA 4OKHA 3VRNA 5K89A 1UUCA 4UXJA 2V1CA 1PK0D 1NX3A 2JPTA 4HRHA 1S36A 2JOJA 2MBXA 1OSAA 3K21A 4YGBB 4XYNA 2KMRA 2ROWA 2KMOA 3UGIA 3AKAA 4UPGA 2M5XA 2LUYA 1FARA 2KMQA 3E59A 1TN4A 1CDNA 1TGSI 2QQDA 4PE1A 3OXGA 2L50A 1X4SA 3PLFB 5I2LA 1AUIB 2JXDA 4P2YB 3MEKA 3DVJA 1EJ3A 2Y1NA 3CS1A 3B4VC 1IJ6A 2YUUA 1QIVA 2KNEA 3LCPC 1S3PA 3BQ3A 1SGQI 2WCEA 4ORCB 2YQPA 1PCEA 1KWOB 1YRUB 2Y5IA 2SGPI 3BOWA 2SGQI 5FUYA 1LKJA 1SCMC 1SY9A 1UURA 3SJSA 3VDPA 2L7XA 4OCIA 5J3XA 3D0YB 4M2QA 4HGUA 2D8NA 2LLUA 2O5GA 1GJYA 5CCLA 2SGEI 3EK4A 3I5FC 3JTDB 1UWOA 1X02A 2KDHA 4GGFA 4MEWA 5HLOA 2K9HA 1TNQA 2KBIA 1CTRA 1JF0A 2H61C 1WRZA 2I7AA 1MXLC 3CR4X 4ZCVA 2DB6A 3RU0A 3I5GB 1OE9B 1SYMA 3CLNA 1QVIZ 1ZOTB 2E5RA 1CGII 1TTXA 1KSMA 1PVBA 1WRKA 1YUTA 1R0RI 2MHHA 1DF0B 4DS7A 1F4QA 4XJKA 3TZ1A 1S6IA 2ORWA 4IL1A 1VRKA 3SIBA 5DKRA 2FCEA 1QV0A 4YBHB 1K94A 2EC6B 5PALA 1TCOB 2J9RA 3EKHA 1Y1AA 2M7NA 1CM1A 3H4SE 2BCXA 4ICBA 4WQ3A 2I94A 2LMVA 4SGBI 1KFXS 1LA3A 2GKRI 2R2IA 1TCFA 1XVJA 1CFPA 2KMPA 1Q80A 3FS7A 4GFTA 5ER4X 1K9PA 2HQ8A 2JZMA 5EX0A 1A4PA 3OXFA 1WLZA 5KSZA 2NU0I 3CZTX 1SGNI 1SW8A 3C1VA 2F3CI 1AHRA 1BG1A 1CMFA 1QATA 2E73A 1AJ4A 3F45A 2A4JA 4ETOA 1IH0A 1F4OA 2O60A 2V53A 1PALA 2K8MB 2WCFA 1IJ5A 2K61A 1UHJA 5CSIA 2EGDA 4P5OE 2BL0B 2LP3A 1B47A 2B8TA 3OX6A 1YTPA 1AK8A 2ERWA 1B1GA 3TS5C 2ZNEA 1NCXA 1ZUZA 3RM1A 1DMOA 1LR7A 1Z7KB 2MLFC 2OD1A 1IRJA 4BY5A 3DD4A 4N1GA 1YX8A 5HKWA 1RJVA 1XFZO 2OTGB 1K8UA 1PJUA 1KBEA 1Y1XA 2RGIA 4MRYA 4YGAA 4I5KA 1J7RA 1DJGA 2WOSA 5KU1A 1CFDA 1KFUS 2L4HA 2IS9A 4C0KA 1XK4C 3PDNA 2KFHA 3ZWHA 2HF5A 1FW4A 2M29A 3PALA 4E1PA 2H61A 1L7ZA 1OZOA 3GK1A 1M8BA 2G2BA 3UFFA 3SG3A 3VGOA 3CR2A 1KK8B 1CNPA 3E3RA 3CWGA 1JF2A 1LR8A 3BUNB 3GK4X 1C7VA 3OL0A 4NDDA 1PVAA 1WRLA 1GQMA 2BE4A 1SR6C 2F2OA 1L2OC 2LUCA 2ZN9A 2JZIA 3CTNA 4XJKB 1JC2A 1CLLA 5FYXA 1U5IA 2BCBA 2CXJA 3A8RA 4GPLB 2ZRTA 1J7PA 1UHNA 2LAPA 4ORAB 1W3SA 1X74A 5B8IB 1DJWA 2KBMA 3QRXA 5HKYA 2PSRA 1IQ3A 1XO5A 1V1FA 2LVJA 3JVTB 1QTXA 1M46A 5DKQA 4AQIA 1IWQA 1RTP1 1RROA 2B0UC 3KHEA 1PSBA 1G8IA 2WNDA 1LR9A 1LINA 2QPOA 2PALA 4MN0A 1G4YR 1TBQR 1OVOA 1JFJA 1DJZA 2L4IA 2Q91A 1S26D 1J7QA 1M45A 2JNXA 1YTZC 2M1UA 3SG7A 1UVGA 2ARPF 1CT0I 2K7OA 2JTZA 3KF9A 5HQ8A 2KAVA 4MZJA 5IBWA 2GV5A 1SGYI 3AAJA 4QJ3B 4I5JA 1CKKA 3EK8A 4UXHA 1CDPA 1R79A 4M2PA 1EG4A 2JXLA 4QJ4B 5KTYA 1IW4A 1KK7Z 1OZSA 2KFFA 5D7FA 1XA5A 1E8AA 1OMUA 1NYAA 1Y6WA 2TN4A 3I5HC 1HDLA 1YUUA 1M39A 2EHBA 1B8CA 1B7TZ 2AMIA 3PATA 1EL4A 2SGFI 3LL8B 3M0WA 3PFVA 4YRUA 1SCMB 1JWDA 1Y1CA 1BUSA 4WRIA 1QJTA 2JT8A 1DJYA 4N1FA 2W0TA 1TBRR 3ZNIA 3I5FB 1DT7B 1XK4A 2JA1A 1DJXA 4HREE 1Y8FA 4GI3C 2Y4QA 2MRDA 1J7OA 1RWYA 2BUSA 1J1DA 2ELIA 4I5LB 2KAXA 3FWCA 4A4CA 5D69A 3EK7A 3KY9A 1XFXO 2LC5A 4N5XA 1YURA 1CFFA 5FUVA 1BU3A 3AAKA 4PCWA 5TNCA 3ICBA 2KCXA 1K96A 2P6AC 2Q4UA 1TIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZN8 A;  2H2K A;  1S6J A;  3SG6 A;  4ZCU A;  2I18 A;  2KYF A;  1S6C A;  4ORB B;  2N17 A;  3HH2 C;  2JU0 A;  2ZND A;  2KI4 C;  3O4Y A;  4M2O A;  1A75 B;  1BR1 B;  1DJI A;  5ER5 A;  2KGR A;  2GGM A;  2LAN A;  1MF8 B;  4WQ2 A;  4OVO A;  3FIA A;  1J55 A;  1S5G Y;  2OS8 C;  3VRO A;  4MSP A;  4DRW A;  5HYD A;  4TNC A;  1C07 A;  2PMY A;  5AEQ A;  1KFX L;  2JT0 A;  2AAO A;  1BLQ A;  1A29 A;  1BOD A;  5DAE A;  3DVE A;  2B1U A;  5I8N A;  1KMA A;  2NU1 I;  2KOT A;  1CB1 A;  1FF1 A;  1F55 A;  1IQ5 A;  1NX1 A;  3I5G C;  3DVM A;  1TUR A;  1SL9 A;  2BBN A;  2KYC A;  4BY4 A;  1XFW O;  2L5X B;  4PHN A;  1YU6 C;  1UHI A;  2Y1M A;  2LP2 A;  2FOT A;  4QJ5 B;  4PAL A;  1K95 A;  2LHI A;  3CGA A;  2SCP A;  2M1K B;  1BT6 A;  1SGR I;  3NSK A;  3TS5 B;  4I5N B;  2WCB A;  4MBE A;  1KCY A;  2K7B A;  1YX7 A;  5JOL A;  2NZ0 A;  1RFJ A;  2N52 A;  1UHH A;  1LVC D;  2NCO A;  4PE7 A;  4PHJ A;  1QAS A;  4NQG A;  1Y1U A;  3DVK A;  3OP0 A;  3BUM B;  1KQM C;  3BOW B;  3EVV A;  3KEV A;  4DCK A;  5GQQ C;  1NSH A;  1R2U A;  3WXA A;  5I2Q A;  1MR8 A;  1F54 A;  3WNX B;  1K9U A;  1TNP A;  3TDU A;  3SG5 A;  3VRQ A;  2KAY A;  2M49 B;  2ZRS A;  4NDC A;  2LE9 B;  2SGD I;  1MWN A;  2OVO A;  2JQ6 A;  1JFK A;  4JWQ A;  1NX2 A;  4GAO A;  3OB1 B;  1UP5 A;  5CPV A;  3KO0 A;  2BKH B;  3TDZ A;  1CDM A;  4C0J A;  2JYY A;  1ZMZ A;  1SR6 B;  1L2O B;  2BL0 C;  1SGP I;  1JUO A;  2L98 A;  3VRR A;  1TRF A;  1H0Z A;  4MZL A;  1BMO A;  2F33 A;  1CMG A;  3VRP A;  1H4B A;  4CID A;  4OVN F;  2L51 A;  1SL7 A;  2LVV A;  4YGC B;  2L0P A;  3RLZ A;  3D0Y A;  3PN7 C;  4DUQ A;  1V1G A;  5JJG A;  1QIW A;  2GKT I;  1KQV A;  1YR5 A;  1ZAC A;  1SGD I;  1UUS A;  3DF0 A;  1IG5 A;  1SGE I;  1DTL A;  3I5I C;  4GUK A;  1AJ5 A;  2COL B;  1G33 A;  1CDL A;  5AXI A;  1W7J B;  3IQQ A;  2L2E A;  1NCY A;  3A4U B;  3O2P A;  4JPZ B;  2BCA A;  1ZFS A;  1N2D A;  4D1E A;  2GKV A;  1XFV O;  3GOF A;  1SBJ A;  1NUB A;  2E30 A;  2JUL A;  3HCM A;  3BUO B;  2OPO A;  1BF5 A;  3BYA A;  4CPV A;  1D1O A;  4Q04 A;  1QXP A;  3OHM B;  1CT2 I;  1A2X A;  2KI6 D;  1SCV A;  3I5H B;  3IF7 A;  2K7C A;  3TUY C;  1AN1 I;  1HQV A;  2MAZ A;  1UHK A;  3GK2 A;  1ALV A;  5DKN A;  1QX5 B;  1Y1B A;  2WCY A;  2FJU B;  2LMU A;  2HET A;  2XRC A;  1M63 B;  1QVI Y;  1HT9 A;  4PE0 A;  4YI8 A;  2NCP A;  4FQO A;  4A4B A;  1K93 D;  3TDI A;  1LXF C;  1SKT A;  2JWW A;  1TOP A;  4L9M A;  1SL8 A;  1M31 A;  2M9G A;  4PHM A;  1WDC C;  1XFU O;  2DOQ A;  4OR9 B;  1HJA I;  4AOM A;  3CR5 X;  3D10 A;  3IQO A;  2ISD A;  2K2A A;  1NIW A;  2LHL A;  2WOR A;  5JHW C;  1A03 A;  2E6W A;  2BEC A;  4R1E A;  2LLS A;  1BR4 B;  5G08 A;  3WHT B;  1C7W A;  1F70 A;  2NLN A;  1DGV A;  1OQP A;  1NP8 A;  1TNW A;  4MZK A;  3BXK A;  3SG2 A;  1PSR A;  1BJF A;  1OOJ A;  1PUL A;  3FWB A;  4YGD B;  2NU4 I;  5HLV A;  2KI4 B;  2PAS A;  4USL A;  2MLE C;  1U5I B;  2KI6 C;  4OV2 A;  1B8R A;  2CTN A;  1XYD A;  4YGE B;  1DS3 I;  2OS8 B;  1KWO C;  2LVK A;  5BPJ A;  2F3Z A;  1TIH A;  2M3W A;  3EKJ A;  3DF0 B;  2MA2 A;  1FYB A;  2NU2 I;  1YUS A;  1MT1 A;  1IY6 A;  1REC A;  1RK9 A;  3JTD C;  3NSL A;  1FPW A;  5CSN A;  2M97 A;  1S1E A;  4JQ0 D;  1DVI A;  2BKI B;  2LUX A;  1EH2 A;  1CGJ I;  1CSO I;  1CT4 I;  4C0L A;  1CLM A;  1SNL A;  2G9B A;  2JT3 A;  1ODB A;  1NCZ A;  4GNK B;  1WY9 A;  5F6T A;  1DS2 I;  3PSR A;  2LLT A;  3MSE B;  1GGW A;  3OX5 A;  2SAS A;  4MLW A;  4PDZ A;  1BOC A;  2LM5 A;  2CBL A;  3KPX A;  1DGU A;  1DJH A;  2GGZ A;  1TUS A;  3OB2 B;  2KFG A;  4CFQ A;  2NXQ A;  3LK1 A;  2I2R E;  1ALW A;  3BUW B;  1TNX A;  2KQY A;  2KQ6 A;  2EC6 C;  1IY5 A;  2LNK A;  2FCD A;  2ZKM X;  5CSF A;  3WHU B;  2KSP A;  1K2H A;  2F3Y A;  1OYV I;  1KQM B;  1N65 A;  2QQC A;  1K90 D;  2CCM A;  5I2O A;  2PVB A;  1N13 A;  3QTL D;  1QLS A;  1XFY O;  1AVS A;  3PM8 A;  1OMR A;  5AER A;  1OMV A;  2QPT A;  2LEO A;  2HPS A;  3EVU A;  1QX2 A;  1CM4 A;  1M8C A;  1QLK A;  1YVH A;  2QAC A;  1AP4 A;  1F8H A;  2CNP A;  1IKU A;  4CFR A;  4FTG A;  4PHK A;  1GGZ A;  4F0Z B;  2VRG A;  2K2F A;  4HRG A;  1H8B A;  3SEK C;  1KFU L;  1S5G Z;  1NPQ A;  4GGN A;  4HSZ A;  1QV1 A;  2AUC A;  1CFC A;  4MRX A;  1NWD A;  3NXA A;  1QX7 A;  1J1E A;  1OMT A;  5AAN A;  1Y0V H;  1F71 A;  1CHO I;  3O78 A;  2NU3 I;  1PRW A;  1HPT A;  4U8D A;  1KSO A;  1JBA A;  1YVL A;  2CT9 A;  1B8L A;  3PN7 B;  2JTT A;  4NDB A;  1PPF I;  2BE6 A;  2WC8 A;  1W7I B;  2M0R A;  1MQ1 A;  3NSO A;  2OTG C;  3TJQ A;  3I5I B;  4GBA A;  2KHN A;  3HX4 A;  1FBV A;  2F8P A;  1KK7 Y;  4MVF A;  2K0J A;  4DIR A;  2M7L A;  4GGF C;  2PRU A;  2JNF A;  2K7D A;  5HKZ A;  1JSA A;  1R6P A;  1B7T Y;  1CLB A;  2JRF A;  3NSI A;  1CE3 A;  2P6B B;  1MUX A;  1K9K A;  1OMD A;  1QS7 A;  2ZFD A;  1SRA A;  1B9A A;  2LVI A;  1KK8 C;  1MXE A;  1DF0 A;  1SK6 D;  2JXC A;  1IGV A;  1UVF A;  1SMG A;  3SGQ I;  3SG4 A;  1NX0 A;  3SIA A;  3BUX B;  4E68 A;  2LV7 A;  1FI5 A;  1EXR A;  3SGB I;  1B4C A;  3O6B A;  1A75 A;  1LA0 A;  2BBM A;  1WLM A;  3TUY B;  3LLE A;  1SPY A;  2LMT A;  1EG3 A;  4AQJ A;  1YRT B;  3EVR A;  4PE4 A;  2F2P A;  3OVO A;  3JVT C;  1MHO A;  1N0Y A;  2HQW A;  1FI6 A;  2JC2 A;  4CLN A;  2LCP A;  4YI9 A;  2N71 A;  3LK0 A;  2KGB C;  1WDC B;  5CSJ A;  5AFP A;  2M8U A;  2MJW B;  3AKB A;  4OKH A;  3VRN A;  5K89 A;  1UUC A;  1PK0 D;  1NX3 A;  2JPT A;  4HRH A;  1S36 A;  2JOJ A;  2MBX A;  1OSA A;  3K21 A;  4YGB B;  4XYN A;  2KMR A;  2KMO A;  3AKA A;  4UPG A;  2M5X A;  2KMQ A;  1TN4 A;  1CDN A;  1TGS I;  2QQD A;  4PE1 A;  2L50 A;  3PLF B;  5I2L A;  1AUI B;  2JXD A;  4P2Y B;  3DVJ A;  1EJ3 A;  2Y1N A;  3CS1 A;  3B4V C;  1IJ6 A;  1QIV A;  2KNE A;  3LCP C;  1S3P A;  3BQ3 A;  1SGQ I;  2WCE A;  4ORC B;  1PCE A;  1KWO B;  1YRU B;  2Y5I A;  2SGP I;  3BOW A;  2SGQ I;  1LKJ A;  1SCM C;  1SY9 A;  1UUR A;  3SJS A;  4OCI A;  5J3X A;  3D0Y B;  4M2Q A;  4HGU A;  2D8N A;  2LLU A;  2O5G A;  1GJY A;  2SGE I;  3EK4 A;  3I5F C;  3JTD B;  1UWO A;  1X02 A;  2KDH A;  4GGF A;  4MEW A;  5HLO A;  1TNQ A;  2KBI A;  1CTR A;  1JF0 A;  2H61 C;  1WRZ A;  2I7A A;  1MXL C;  3CR4 X;  4ZCV A;  3I5G B;  1OE9 B;  1SYM A;  3CLN A;  1QVI Z;  1ZOT B;  1CGI I;  1TTX A;  1KSM A;  1PVB A;  1WRK A;  1YUT A;  1R0R I;  2MHH A;  1DF0 B;  4DS7 A;  1F4Q A;  4XJK A;  3TZ1 A;  1S6I A;  4IL1 A;  1VRK A;  3SIB A;  5DKR A;  2FCE A;  1QV0 A;  4YBH B;  1K94 A;  2EC6 B;  5PAL A;  1TCO B;  3EKH A;  1Y1A A;  2M7N A;  1CM1 A;  3H4S E;  2BCX A;  4ICB A;  4WQ3 A;  2I94 A;  2LMV A;  4SGB I;  1KFX S;  1LA3 A;  2GKR I;  2R2I A;  1TCF A;  1XVJ A;  1CFP A;  2KMP A;  1Q80 A;  3FS7 A;  4GFT A;  5ER4 X;  1K9P A;  2HQ8 A;  2JZM A;  1A4P A;  1WLZ A;  5KSZ A;  2NU0 I;  3CZT X;  1SGN I;  1SW8 A;  3C1V A;  2F3C I;  1AHR A;  1BG1 A;  1CMF A;  1QAT A;  1AJ4 A;  3F45 A;  2A4J A;  4ETO A;  1IH0 A;  1F4O A;  2O60 A;  2V53 A;  1PAL A;  2K8M B;  2WCF A;  1IJ5 A;  2K61 A;  1UHJ A;  5CSI A;  2EGD A;  4P5O E;  2BL0 B;  2LP3 A;  1B47 A;  3OX6 A;  1YTP A;  1AK8 A;  2ERW A;  1B1G A;  3TS5 C;  2ZNE A;  1NCX A;  1ZUZ A;  3RM1 A;  1DMO A;  1LR7 A;  1Z7K B;  2MLF C;  1IRJ A;  4BY5 A;  3DD4 A;  4N1G A;  1YX8 A;  5HKW A;  1RJV A;  1XFZ O;  2OTG B;  1K8U A;  1PJU A;  1Y1X A;  2RGI A;  4MRY A;  4YGA A;  4I5K A;  1J7R A;  1DJG A;  2WOS A;  5KU1 A;  1CFD A;  1KFU S;  2L4H A;  2IS9 A;  4C0K A;  1XK4 C;  2KFH A;  3ZWH A;  2HF5 A;  1FW4 A;  2M29 A;  3PAL A;  2H61 A;  1L7Z A;  1OZO A;  3GK1 A;  1M8B A;  2G2B A;  3SG3 A;  3VGO A;  3CR2 A;  1KK8 B;  1CNP A;  3E3R A;  3CWG A;  1JF2 A;  1LR8 A;  3BUN B;  3GK4 X;  1C7V A;  4NDD A;  1PVA A;  1WRL A;  1GQM A;  2BE4 A;  1SR6 C;  2F2O A;  1L2O C;  2LUC A;  2ZN9 A;  2JZI A;  3CTN A;  4XJK B;  1JC2 A;  1CLL A;  5FYX A;  1U5I A;  2BCB A;  2CXJ A;  3A8R A;  4GPL B;  2ZRT A;  1J7P A;  1UHN A;  2LAP A;  4ORA B;  5B8I B;  1DJW A;  2KBM A;  3QRX A;  5HKY A;  2PSR A;  1IQ3 A;  1XO5 A;  1V1F A;  2LVJ A;  3JVT B;  1QTX A;  1M46 A;  5DKQ A;  4AQI A;  1IWQ A;  1RTP 1;  1RRO A;  2B0U C;  3KHE A;  1PSB A;  1G8I A;  2WND A;  1LR9 A;  1LIN A;  2PAL A;  4MN0 A;  1G4Y R;  1TBQ R;  1OVO A;  1JFJ A;  1DJZ A;  2L4I A;  2Q91 A;  1S26 D;  1J7Q A;  1M45 A;  2JNX A;  1YTZ C;  2M1U A;  3SG7 A;  1UVG A;  2ARP F;  1CT0 I;  2K7O A;  2JTZ A;  3KF9 A;  2KAV A;  4MZJ A;  5IBW A;  2GV5 A;  1SGY I;  3AAJ A;  4QJ3 B;  4I5J A;  1CKK A;  3EK8 A;  1CDP A;  4M2P A;  1EG4 A;  2JXL A;  4QJ4 B;  5KTY A;  1IW4 A;  1KK7 Z;  1OZS A;  2KFF A;  5D7F A;  1XA5 A;  1E8A A;  1OMU A;  1NYA A;  1Y6W A;  2TN4 A;  3I5H C;  1HDL A;  1YUU A;  1M39 A;  2EHB A;  1B8C A;  1B7T Z;  2AMI A;  3PAT A;  1EL4 A;  2SGF I;  3LL8 B;  3M0W A;  3PFV A;  4YRU A;  1SCM B;  1JWD A;  1Y1C A;  1BUS A;  4WRI A;  1QJT A;  2JT8 A;  1DJY A;  4N1F A;  1TBR R;  3ZNI A;  3I5F B;  1DT7 B;  1XK4 A;  1DJX A;  4HRE E;  4GI3 C;  2Y4Q A;  2MRD A;  1J7O A;  1RWY A;  2BUS A;  1J1D A;  4I5L B;  2KAX A;  3FWC A;  4A4C A;  5D69 A;  3EK7 A;  1XFX O;  2LC5 A;  4N5X A;  1YUR A;  1CFF A;  1BU3 A;  3AAK A;  4PCW A;  5TNC A;  3ICB A;  2KCX A;  1K96 A;  2P6A C;  2Q4U A;  1TIZ A; 
#chains in the Genus database with same CATH topology
 2ZN8 A;  3SG6 A;  2N17 A;  3HH2 C;  2GTE A;  5J8F A;  2ZND A;  2KI4 C;  3O4Y A;  4M2O A;  2WVJ A;  1BR1 B;  2OS8 C;  5HYD A;  3D77 A;  4TNC A;  1BLQ A;  1BOD A;  2WCK A;  5DAE A;  5E3R A;  4WP4 A;  1FF1 A;  3FSY A;  3D74 A;  4BY4 A;  4QJ5 B;  1TBO A;  4I5N B;  2WCB A;  1YX7 A;  5JOL A;  1UHH A;  4PE7 A;  1Y1U A;  3DY9 A;  3S0B A;  3KEV A;  5I2Q A;  3WNX B;  1TNP A;  2PYQ A;  2OVO A;  4GAO A;  2BKH B;  2JYY A;  1SR6 B;  1SGP I;  2L98 A;  1TRF A;  1H0Z A;  1BMO A;  2F33 A;  1CMG A;  1XA6 A;  1H4B A;  3B86 A;  4OVN F;  4CID A;  2L51 A;  1SL7 A;  2LVV A;  1W9Z A;  3PN7 C;  4DUQ A;  1QIW A;  3VB1 A;  4PT1 A;  3DF0 A;  1DTL A;  4GUK A;  1AJ5 A;  5D3O A;  3IQQ A;  2L2E A;  3A4U B;  2UVO A;  1SBJ A;  2JUL A;  4A24 A;  1BF5 A;  2KI6 D;  1OOI X;  1AN1 I;  3TUY C;  2QEO A;  1UHK A;  2LMU A;  4A4B A;  4L9M A;  1WDC C;  1XFU O;  3D10 A;  3BFH A;  1A03 A;  2BEC A;  1BR4 B;  1F70 A;  1C7W A;  5CCM A;  1OQP A;  1TNW A;  1OOJ A;  2NU4 I;  2KI4 B;  2PAS A;  2MLE C;  3NHI A;  1XYD A;  1DS3 I;  2OS8 B;  1KWO C;  2F3Z A;  2M3W A;  2MA2 A;  1FYB A;  1YUS A;  1REC A;  1RK9 A;  3JTD C;  3FE8 A;  1CLM A;  2G9B A;  4GNK B;  3D73 A;  1BOC A;  2LM5 A;  2J87 A;  1TNX A;  4FKD A;  3WHU B;  1VDD A;  1DC1 A;  1N65 A;  1XFY O;  1QX2 A;  3O4X A;  2QAC A;  1IKU A;  4PHK A;  2VRG A;  1H8B A;  4GGN A;  1S5G Z;  1ULN A;  2AUC A;  5FI7 A;  2NU3 I;  1YVL A;  4NDB A;  3PN7 B;  2JTT A;  3NSO A;  3TJQ A;  2QQE A;  1FBV A;  2K0J A;  2M7L A;  3SS4 A;  5HKZ A;  1JSA A;  2JRF A;  1FY7 A;  1MUX A;  1K9K A;  1OMD A;  1QS7 A;  2ZFD A;  1B9A A;  1MXE A;  1SK6 D;  1UVF A;  1IGV A;  5EX3 A;  3CDN A;  1NX0 A;  3SIA A;  3TUY B;  2GVI A;  1SPY A;  1YRT B;  2F2P A;  2N71 A;  1WDC B;  2M8U A;  3VRN A;  5K89 A;  4UXJ A;  2QEV A;  1S36 A;  1OSA A;  1NXU A;  2LUY A;  2CWF A;  1TN4 A;  2QQD A;  3PLF B;  2YUU A;  3CZ0 A;  3LCP C;  1S3P A;  3BQ3 A;  1KWO B;  2WCJ A;  5J3X A;  4M2Q A;  2D8N A;  5CCL A;  2SGE I;  3EK4 A;  3I5F C;  3JTD B;  1X02 A;  1CTR A;  3RU0 A;  3TOB A;  1CGI I;  1KSM A;  1WRK A;  2ORW A;  4IL1 A;  5DKR A;  1QV0 A;  5PAL A;  1CM1 A;  4SGB I;  2GKR I;  1TCF A;  1CFP A;  1K7V A;  1Q80 A;  3FS7 A;  1K9P A;  2HQ8 A;  2JZM A;  1MJ9 A;  1WLZ A;  3CZT X;  1SW8 A;  1AJ4 A;  4ETO A;  1PAL A;  2K8M B;  2BL0 B;  3OX6 A;  1AK8 A;  1YX8 A;  1XFZ O;  1K8U A;  4JKT A;  3FE9 A;  1KBE A;  2RGI A;  4I5K A;  5KU1 A;  1CFD A;  2KFH A;  2M29 A;  2H61 A;  1OZO A;  4NDD A;  4YI8 A;  1GQM A;  3E2I A;  2ZN9 A;  1L2O C;  4XJK B;  3QAH A;  1JC2 A;  1U5I A;  2CXJ A;  4GPL B;  1J7P A;  2ZRT A;  3QRX A;  1XO5 A;  1V1F A;  4DNC A;  1IWQ A;  2B0U C;  1PSB A;  1DQE A;  1JFJ A;  1J7Q A;  1YTZ C;  2ARP F;  1UVG A;  1CT0 I;  2GIV A;  5IBW A;  2GV5 A;  4AML A;  1CKK A;  2QEH A;  1R79 A;  4QJ4 B;  5KTY A;  1OZS A;  1XA5 A;  1E8A A;  2AMI A;  3CZ1 A;  2SGF I;  3LL8 B;  1JWD A;  1Y1C A;  1BUS A;  2JT8 A;  4N1F A;  3DZT A;  3I5F B;  4GI3 C;  2Y4Q A;  2PQL A;  2BUS A;  2KAX A;  4A4C A;  3EK7 A;  3KY9 A;  1XFX O;  1YUR A;  1CFF A;  3IVT A;  5TNC A;  3ICB A;  1DEL A;  1TIZ A;  1S6J A;  2JU0 A;  5ER5 A;  2LAN A;  1J55 A;  5AEQ A;  3EG5 B;  1A29 A;  2B1U A;  1KMA A;  2KOT A;  1CB1 A;  1F55 A;  1SL9 A;  2KYC A;  4PHN A;  1UHI A;  2FOT A;  3CGA A;  2SCP A;  3DXL A;  1SGR I;  1U5K A;  4MBE A;  1KCY A;  2N52 A;  1QAS A;  4NQG A;  3OP0 A;  3BUM B;  1KQM C;  3EVV A;  4DCK A;  1NSH A;  2X3T A;  1MR8 A;  3R5D A;  3VRQ A;  2KAY A;  3S0F A;  3OB1 B;  5CPV A;  3K1E A;  3KO0 A;  1CDM A;  1ZMZ A;  1L2O B;  2QDI A;  2GKT I;  1KQV A;  1YR5 A;  3S0E A;  1ZAC A;  3OXL A;  2P71 A;  1SGE I;  3I5I C;  1CDL A;  4JPZ B;  3O2P A;  2GKV A;  1Q9B A;  1NUB A;  2E30 A;  3BUO B;  2OPO A;  4CPV A;  1D1O A;  1CT2 I;  2K7C A;  3GK2 A;  2KLD A;  2WCY A;  1Y1B A;  2FJU B;  2HET A;  4PE0 A;  2NCP A;  3S0A A;  1M31 A;  1KBF A;  2DOQ A;  4OR9 B;  1HJA I;  1XBT A;  3CR5 X;  2N1A B;  2K2A A;  3FE6 A;  3WHT B;  2X52 A;  1V1I A;  1NP8 A;  4MZK A;  4YGD B;  4USL A;  1U5I B;  2KI6 C;  4OV2 A;  1ULK A;  5BPJ A;  2VRW B;  3UO9 A;  1IY6 A;  3NSL A;  2M97 A;  1S1E A;  4JQ0 D;  2LUX A;  1EH2 A;  1CSO I;  4C0L A;  2JT3 A;  1NCZ A;  2LLT A;  1GGW A;  3OX5 A;  4MLW A;  2CBL A;  3TO9 A;  1T14 A;  2ENN A;  2EC6 C;  2LNK A;  2KSP A;  1OYV I;  1KQM B;  3BJI A;  5I2O A;  2PVB A;  3PM8 A;  5AER A;  1OMV A;  2QPT A;  2LEO A;  1CM4 A;  1YVH A;  9WGA A;  4CFR A;  4FQT A;  4HRG A;  3SEK C;  1KFU L;  4HSZ A;  4MRX A;  3NXA A;  4KYN A;  3SS3 A;  1OMT A;  1F71 A;  3CXL A;  1B8L A;  2BE6 A;  2RC4 A;  3I5I B;  4GBA A;  1KK7 Y;  4MVF A;  4GGF C;  2PRU A;  2JNF A;  4INX A;  2K7D A;  3PJI A;  3R1P A;  1B7T Y;  1V1H A;  1SMG A;  1SSE B;  1EXR A;  3SGB I;  3EVR A;  3JVT C;  1MHO A;  2HQW A;  2JC2 A;  4CLN A;  2LCP A;  1RFH A;  2MJW B;  4OKH A;  1PK0 D;  2MBX A;  4XYN A;  2BNX A;  2KMO A;  3UGI A;  3AKA A;  4UPG A;  2M5X A;  1CDN A;  1X4S A;  1C3Y A;  3DVJ A;  2Y1N A;  3CS1 A;  3TOA A;  2KNE A;  1SGQ I;  1YRU B;  2SGP I;  2PQ8 A;  2SGQ I;  1SCM C;  3SJS A;  4OCI A;  2O5G A;  1GJY A;  2OU2 A;  1UWO A;  2KDH A;  1TNQ A;  3R1V A;  5DIC A;  4ZCV A;  2DB6 A;  1OE9 B;  2MHH A;  1DF0 B;  4XJK A;  2WC5 A;  4YBH B;  2JPO A;  1K94 A;  2EC6 B;  4ICB A;  4WQ3 A;  2KMP A;  5ER4 X;  1IIO A;  3B6X A;  5KSZ A;  3R5C A;  1SGN I;  1BG1 A;  2O60 A;  2WCF A;  2V53 A;  2K61 A;  2EGD A;  3TS5 C;  3OXF A;  1ZUZ A;  3RM1 A;  1DMO A;  2MLF C;  4BY5 A;  5HKW A;  3L47 A;  5E3P A;  4MRY A;  4YGA A;  1DJG A;  2L4H A;  4C0K A;  1XK4 C;  3PDN A;  2HF5 A;  3GK1 A;  1M8B A;  3SG3 A;  1TUJ A;  3CWG A;  1C7V A;  1PVA A;  1CLL A;  5FYX A;  1UHN A;  2LAP A;  1X74 A;  1HEV A;  3D76 A;  2PSR A;  3JVT B;  4AQI A;  3KHE A;  1LR9 A;  2QPO A;  4MN0 A;  1TBQ R;  2Q91 A;  1S26 D;  2JTZ A;  5HQ8 A;  4QJ3 B;  4I5J A;  2KLE A;  3EK8 A;  4M2P A;  1EG4 A;  1OMU A;  2KFF A;  1Y6W A;  3S0D A;  4JD9 A;  1YUU A;  2H8V A;  3M0W A;  1SCM B;  1QJT A;  1Z2C B;  3ZNI A;  1J7O A;  3OBV A;  5FI2 A;  4I5L B;  3R72 A;  3AAK A;  2QQC A;  2Q4U A;  2KYF A;  1S6C A;  4ORB B;  1W4R A;  2ORV A;  4JCV E;  1DJI A;  3QME A;  2GGM A;  4WQ2 A;  3FIA A;  4MSP A;  2CJS C;  1C07 A;  2ENZ A;  2JT0 A;  3DVE A;  5I8N A;  2NU1 I;  2A20 A;  1IQ5 A;  1NX1 A;  3I5G C;  2UZ3 A;  3DVM A;  1TUR A;  2BBN A;  2L5X B;  2WC6 A;  1YU6 C;  2DKV A;  2Y1M A;  4PAL A;  1K95 A;  2LHI A;  2M1K B;  1BT6 A;  3NSK A;  3TS5 B;  2NZ0 A;  1RFJ A;  3DVK A;  1PTQ A;  3R5B A;  3WXA A;  1F54 A;  3SG5 A;  2M49 B;  2ZRS A;  4NDC A;  1MWN A;  4JWQ A;  1JFK A;  1NX2 A;  1UP5 A;  3DYE A;  3TDZ A;  2FNF X;  3UEY A;  3VRR A;  3VE5 A;  1C3Z A;  4MZL A;  3RLZ A;  3D0Y A;  1V1G A;  5JJG A;  5HL1 A;  1IG5 A;  2COL B;  1Z4H A;  1NCY A;  2BCA A;  1N2D A;  4D1E A;  3HCM A;  4Q04 A;  1QXP A;  2P70 A;  3PM2 A;  1ALV A;  5DKN A;  1QX5 B;  1M63 B;  1S20 A;  1QVI Y;  4FQO A;  1K93 D;  3TDI A;  1LXF C;  1SKT A;  2JWW A;  1TOP A;  2M9G A;  4PHM A;  3V2L A;  4AOM A;  3IQO A;  2ISD A;  4MPI A;  2E6W A;  5G08 A;  1PSR A;  1BJF A;  3FWB A;  5HLV A;  1K7T A;  1B8R A;  2CTN A;  4YGE B;  2LVK A;  1TUZ A;  2QQ0 A;  3EKJ A;  2NU2 I;  2BKI B;  1CT4 I;  1P9G A;  1CGJ I;  1SNL A;  1ODB A;  3QWP A;  5F6T A;  1WY9 A;  3KPX A;  1TBN A;  1DGU A;  2GGZ A;  3OB2 B;  4CFQ A;  5I94 A;  2KQY A;  1IY5 A;  2FCD A;  2ZKM X;  5CSF A;  1UHA A;  1K90 D;  2JW6 A;  1OMR A;  1OOG A;  2HPS A;  2RIJ A;  1M8C A;  3FC3 A;  1QLK A;  1AP4 A;  1WGC A;  4FTG A;  2V1C C;  1NPQ A;  3BFB A;  3R5A A;  1QV1 A;  1CFC A;  1NWD A;  3UGL A;  3UOE A;  1QX7 A;  1J1E A;  1Y0V H;  3O78 A;  1PRW A;  4U8D A;  1KSO A;  1JBA A;  1PPF I;  1W7I B;  2M0R A;  3Q8I A;  1MQ1 A;  3TO7 A;  1CLB A;  1CE3 A;  2P6B B;  1SRA A;  2LVI A;  1KK8 C;  1DF0 A;  3SGQ I;  3BUX B;  4E68 A;  1FI5 A;  1B4C A;  1XX6 A;  3O6B A;  1A75 A;  1WLM A;  3LLE A;  2LMT A;  3OVO A;  1FI6 A;  2ODD A;  2KGB C;  5CSJ A;  3AKB A;  2KPH A;  1NX3 A;  2JPT A;  4HRH A;  3K21 A;  2KMR A;  4YGB B;  2ROW A;  1FAR A;  2KMQ A;  1TGS I;  4PE1 A;  2L50 A;  5I2L A;  2JXD A;  3B4V C;  1IJ6 A;  2WCE A;  4ORC B;  2YQP A;  3BOW A;  1SY9 A;  1Z2I A;  3D0Y B;  4HGU A;  2LLU A;  4GGF A;  5HLO A;  2I7A A;  1WRZ A;  1MXL C;  3B87 A;  3CLN A;  1ZOT B;  4INW A;  2E5R A;  1TTX A;  1PVB A;  1YUT A;  2L2C A;  4DS7 A;  3NHT A;  1F4Q A;  3TZ1 A;  1TCO B;  2J9R A;  3EKH A;  1Y1A A;  2M7N A;  1GM0 A;  2BCX A;  2I94 A;  2LMV A;  1KFX S;  1LA3 A;  1OOF A;  4GFT A;  1A4P A;  1CMF A;  1QAT A;  3F45 A;  1IH0 A;  3UNW A;  1UHJ A;  5CSI A;  4P5O E;  1B1G A;  1NCX A;  1Z7K B;  1IRJ A;  3DD4 A;  1RJV A;  1PJU A;  3D75 A;  1J7R A;  2IS9 A;  4OZD A;  3ZWH A;  4E1P A;  1FW4 A;  3PAL A;  3UFF A;  2G2B A;  3VGO A;  1ORG A;  3CR2 A;  3TO6 A;  1KK8 B;  1LR8 A;  3CTN A;  2BCB A;  2L5Y A;  3A8R A;  4ORA B;  1WTJ A;  5B8I B;  2KBM A;  5HKY A;  2LVJ A;  1QTX A;  1M46 A;  2WND A;  1LIN A;  1G4Y R;  1OVO A;  1DJZ A;  2WCL A;  2M1U A;  3SG7 A;  3KF9 A;  2KAV A;  1SGY I;  1CDP A;  2JXL A;  1KK7 Z;  5D7F A;  3I5H C;  1B7T Z;  3PAT A;  1EL4 A;  3PFV A;  4YRU A;  1XK4 A;  1Y8F A;  2MRD A;  1J1D A;  2ELI A;  3FWC A;  2LC5 A;  4N5X A;  4F7F A;  1JF2 A;  4UXI A;  2H2K A;  2FJY A;  4ZCU A;  2I18 A;  2L8E A;  1A75 B;  2KGR A;  4OVO A;  1MF8 B;  1S5G Y;  3VRO A;  4DRW A;  2PMY A;  3UGD A;  1KFX L;  2AAO A;  2YGU A;  1XFW O;  3B7A A;  2LP2 A;  1TWO A;  2K7B A;  1LVC D;  2NCO A;  4PHJ A;  3BOW B;  5GQQ C;  1R2U A;  1QWV A;  1K9U A;  3NGV A;  2LE9 B;  2SGD I;  2JQ6 A;  4C0J A;  2BL0 C;  1JUO A;  3VRP A;  3FSX A;  3L4A A;  4YGC B;  2L0P A;  1WGT A;  1OW4 A;  1SGD I;  1UUS A;  1G33 A;  5AXI A;  1W7J B;  5FI6 A;  1ZFS A;  1MJA A;  1XFV O;  3GOF A;  3BYA A;  3OHM B;  1A2X A;  1SCV A;  3I5H B;  3IF7 A;  1HQV A;  2MAZ A;  2XRC A;  3R1O A;  1HT9 A;  3L4L A;  5EL2 A;  1SL8 A;  2LB7 A;  5HI7 A;  1NIW A;  2LHL A;  2WOR A;  5FUW A;  5JHW C;  3CYZ A;  4R1E A;  2LLS A;  4E1R A;  2NLN A;  1DGV A;  3BXK A;  3SG2 A;  1PTR A;  1PUL A;  4B6D A;  1TIH A;  2QEB A;  3DF0 B;  1MT1 A;  2DIP A;  1FPW A;  5CSN A;  1DVI A;  4IJ7 A;  1DS2 I;  3PSR A;  1FAQ A;  3MSE B;  2SAS A;  4PDZ A;  2BAP A;  1DJH A;  1TUS A;  3CAB A;  5E3Q A;  2KFG A;  2NXQ A;  3LK1 A;  2I2R E;  1ALW A;  3BUW B;  3S0G A;  2KQ6 A;  1XFR A;  1K2H A;  2F3Y A;  2CCM A;  3QTL D;  1N13 A;  1QLS A;  1AVS A;  3EVU A;  1F8H A;  2CNP A;  1GGZ A;  4F0Z B;  2K2F A;  3RZS A;  5AAN A;  1CHO I;  2CT9 A;  3SS5 A;  2WC8 A;  2OTG C;  2Y0M A;  1LS8 A;  2KHN A;  3B88 A;  3HX4 A;  7WGA A;  3GOX A;  2F8P A;  4DIR A;  1R6P A;  1P9Z A;  3NSI A;  3UEJ A;  3D00 A;  5FUX A;  2JXC A;  3SG4 A;  2LV7 A;  1TOT A;  3BJH A;  1LA0 A;  2BBM A;  2CWG A;  1EG3 A;  4AQJ A;  4PE4 A;  1N0Y A;  3VDU A;  4YI9 A;  3LK0 A;  1DEK A;  5AFP A;  1UUC A;  2V1C A;  2JOJ A;  3E59 A;  3OXG A;  5J8C A;  3MEK A;  1AUI B;  4P2Y B;  1EJ3 A;  1QIV A;  1PCE A;  2Y5I A;  5FUY A;  2OZU A;  1LKJ A;  1UUR A;  3VDP A;  2L7X A;  1WKX A;  4MEW A;  2CWH A;  2K9H A;  2KBI A;  1JF0 A;  2H61 C;  3CR4 X;  3I5G B;  1SYM A;  1QVI Z;  1R0R I;  1S6I A;  1VRK A;  3SIB A;  2FCE A;  3H4S E;  3OGN A;  2WCH A;  2R2I A;  1XVJ A;  2ERB A;  2K60 A;  5EX0 A;  2NU0 I;  2F3C I;  3C1V A;  1AHR A;  3D78 A;  2E73 A;  2A4J A;  1F4O A;  1IJ5 A;  2LP3 A;  1B47 A;  2B8T A;  3CZ2 A;  1YTP A;  2ERW A;  2ZNE A;  1LR7 A;  2OD1 A;  4N1G A;  2OTG B;  1Y1X A;  2WOS A;  1KFU S;  3N7H A;  1L7Z A;  1ULM A;  1CNP A;  3E3R A;  3BUN B;  3GK4 X;  3OL0 A;  1P28 A;  1WRL A;  1HPT A;  2BE4 A;  2LUC A;  1SR6 C;  2F2O A;  2JZI A;  1OOH A;  3BFA A;  1W3S A;  1DJW A;  2WGC A;  1IQ3 A;  5DKQ A;  1RTP 1;  1RRO A;  1K7U A;  1G8I A;  2PAL A;  2L4I A;  1M45 A;  2JNX A;  2K7O A;  4MZJ A;  1MJB A;  3AAJ A;  4UXH A;  1IW4 A;  1NYA A;  2TN4 A;  1HDL A;  1M39 A;  2EHB A;  1B8C A;  4WRI A;  1DJY A;  2W0T A;  1TBR R;  1DT7 B;  2WCM A;  2JA1 A;  1DJX A;  4HRE E;  1RWY A;  5D69 A;  5FUV A;  1BU3 A;  4PCW A;  2P6A C;  2KCX A;  1K96 A;  3TDU A; 
#chains in the Genus database with same CATH homology
 2ZN8 A;  2H2K A;  1S6J A;  3SG6 A;  4ZCU A;  2I18 A;  4UXI A;  2KYF A;  1S6C A;  4ORB B;  1W4R A;  2N17 A;  2ORV A;  3HH2 C;  2L8E A;  2JU0 A;  4JCV E;  2ZND A;  2KI4 C;  3O4Y A;  4M2O A;  2WVJ A;  1A75 B;  1BR1 B;  1DJI A;  5ER5 A;  2KGR A;  2GGM A;  2LAN A;  1MF8 B;  4WQ2 A;  4OVO A;  3FIA A;  1J55 A;  1S5G Y;  2OS8 C;  3VRO A;  4MSP A;  4DRW A;  5HYD A;  4TNC A;  1C07 A;  2CJS C;  2PMY A;  5AEQ A;  2ENZ A;  3UGD A;  1KFX L;  2JT0 A;  2AAO A;  1BLQ A;  1A29 A;  1BOD A;  5DAE A;  3DVE A;  2B1U A;  5I8N A;  1KMA A;  2NU1 I;  2KOT A;  1CB1 A;  1FF1 A;  2A20 A;  1F55 A;  1IQ5 A;  1NX1 A;  3I5G C;  2UZ3 A;  3DVM A;  1TUR A;  1SL9 A;  2BBN A;  2KYC A;  4BY4 A;  1XFW O;  2L5X B;  4PHN A;  1YU6 C;  1UHI A;  2Y1M A;  2LP2 A;  2FOT A;  4QJ5 B;  4PAL A;  1TBO A;  1K95 A;  2LHI A;  3CGA A;  2SCP A;  2M1K B;  1BT6 A;  1SGR I;  1U5K A;  3NSK A;  3TS5 B;  4I5N B;  2WCB A;  4MBE A;  1KCY A;  2K7B A;  1YX7 A;  5JOL A;  2NZ0 A;  1RFJ A;  2N52 A;  1UHH A;  1LVC D;  2NCO A;  4PE7 A;  4PHJ A;  1QAS A;  4NQG A;  1Y1U A;  3DVK A;  3OP0 A;  3BUM B;  1PTQ A;  1KQM C;  3BOW B;  3EVV A;  3KEV A;  4DCK A;  5GQQ C;  1NSH A;  1R2U A;  3WXA A;  5I2Q A;  1MR8 A;  1F54 A;  3WNX B;  1K9U A;  1TNP A;  3TDU A;  3SG5 A;  3VRQ A;  2KAY A;  2M49 B;  2ZRS A;  4NDC A;  2LE9 B;  2SGD I;  1MWN A;  2OVO A;  2JQ6 A;  1JFK A;  4JWQ A;  1NX2 A;  4GAO A;  3OB1 B;  1UP5 A;  5CPV A;  3KO0 A;  2BKH B;  3TDZ A;  2FNF X;  3UEY A;  1CDM A;  4C0J A;  2JYY A;  1ZMZ A;  1SR6 B;  1L2O B;  2BL0 C;  1SGP I;  1JUO A;  2L98 A;  3VRR A;  1TRF A;  3VE5 A;  1H0Z A;  4MZL A;  1BMO A;  2F33 A;  1CMG A;  1XA6 A;  3VRP A;  1H4B A;  4CID A;  4OVN F;  2L51 A;  1SL7 A;  2LVV A;  4YGC B;  2L0P A;  3RLZ A;  3D0Y A;  3PN7 C;  4DUQ A;  1V1G A;  5JJG A;  1QIW A;  2GKT I;  1KQV A;  1YR5 A;  1ZAC A;  1SGD I;  3OXL A;  1UUS A;  3DF0 A;  1IG5 A;  1SGE I;  1DTL A;  3I5I C;  4GUK A;  1AJ5 A;  2COL B;  1G33 A;  1CDL A;  5AXI A;  1W7J B;  3IQQ A;  2L2E A;  1NCY A;  3A4U B;  3O2P A;  4JPZ B;  2BCA A;  1ZFS A;  1N2D A;  4D1E A;  2GKV A;  1XFV O;  3GOF A;  1SBJ A;  1NUB A;  2E30 A;  2JUL A;  3HCM A;  4A24 A;  3BUO B;  2OPO A;  1BF5 A;  3BYA A;  4CPV A;  1D1O A;  4Q04 A;  1QXP A;  3OHM B;  1CT2 I;  1A2X A;  2KI6 D;  1SCV A;  3I5H B;  3IF7 A;  2K7C A;  3TUY C;  1AN1 I;  1HQV A;  2MAZ A;  1UHK A;  3GK2 A;  1ALV A;  5DKN A;  1QX5 B;  1Y1B A;  2WCY A;  2FJU B;  2LMU A;  2HET A;  2XRC A;  1M63 B;  1QVI Y;  1HT9 A;  4PE0 A;  4YI8 A;  2NCP A;  4FQO A;  4A4B A;  1K93 D;  3TDI A;  1LXF C;  1SKT A;  2JWW A;  1TOP A;  4L9M A;  1SL8 A;  1M31 A;  2M9G A;  4PHM A;  1KBF A;  1WDC C;  1XFU O;  2DOQ A;  4OR9 B;  1HJA I;  5HI7 A;  4AOM A;  1XBT A;  3CR5 X;  3D10 A;  3IQO A;  2ISD A;  2N1A B;  2K2A A;  1NIW A;  2LHL A;  2WOR A;  5FUW A;  5JHW C;  1A03 A;  2E6W A;  2BEC A;  4R1E A;  2LLS A;  1BR4 B;  5G08 A;  3WHT B;  1C7W A;  1F70 A;  4E1R A;  5CCM A;  2NLN A;  1DGV A;  1OQP A;  1V1I A;  1NP8 A;  1TNW A;  4MZK A;  3BXK A;  3SG2 A;  1PTR A;  1PSR A;  1BJF A;  1OOJ A;  1PUL A;  3FWB A;  4YGD B;  2NU4 I;  5HLV A;  2KI4 B;  2PAS A;  4USL A;  2MLE C;  1U5I B;  4B6D A;  2KI6 C;  4OV2 A;  1B8R A;  2CTN A;  1XYD A;  4YGE B;  1DS3 I;  2OS8 B;  1KWO C;  2LVK A;  5BPJ A;  2F3Z A;  1TIH A;  2M3W A;  2QQ0 A;  2VRW B;  3EKJ A;  3DF0 B;  2MA2 A;  1FYB A;  2NU2 I;  1YUS A;  1MT1 A;  1IY6 A;  2DIP A;  1REC A;  1RK9 A;  3JTD C;  3NSL A;  1FPW A;  5CSN A;  2M97 A;  1S1E A;  4JQ0 D;  1DVI A;  2BKI B;  2LUX A;  1EH2 A;  1CGJ I;  1CSO I;  1CT4 I;  4C0L A;  1CLM A;  1SNL A;  2G9B A;  2JT3 A;  1ODB A;  1NCZ A;  4GNK B;  1WY9 A;  5F6T A;  1DS2 I;  3PSR A;  3QWP A;  1FAQ A;  2LLT A;  3MSE B;  1GGW A;  3OX5 A;  2SAS A;  4MLW A;  4PDZ A;  1BOC A;  2LM5 A;  2CBL A;  3KPX A;  1TBN A;  1DGU A;  1DJH A;  2GGZ A;  1TUS A;  3OB2 B;  2KFG A;  4CFQ A;  2NXQ A;  3LK1 A;  2I2R E;  1ALW A;  3BUW B;  2J87 A;  1TNX A;  2KQY A;  2KQ6 A;  2ENN A;  2EC6 C;  4FKD A;  1IY5 A;  2LNK A;  2FCD A;  2ZKM X;  5CSF A;  3WHU B;  2KSP A;  1K2H A;  1VDD A;  2F3Y A;  1OYV I;  1KQM B;  1N65 A;  3BJI A;  2QQC A;  1K90 D;  2CCM A;  5I2O A;  2PVB A;  1N13 A;  2JW6 A;  1QLS A;  3QTL D;  1XFY O;  1AVS A;  3PM8 A;  1OMR A;  5AER A;  1OMV A;  2QPT A;  2LEO A;  2HPS A;  3EVU A;  1QX2 A;  1CM4 A;  1M8C A;  3FC3 A;  1QLK A;  1YVH A;  2QAC A;  1AP4 A;  1F8H A;  2CNP A;  1IKU A;  4CFR A;  4FTG A;  4PHK A;  1GGZ A;  4F0Z B;  2V1C C;  2VRG A;  2K2F A;  4HRG A;  1H8B A;  3SEK C;  1KFU L;  1S5G Z;  1NPQ A;  4GGN A;  4HSZ A;  1QV1 A;  2AUC A;  1CFC A;  4MRX A;  1NWD A;  3UGL A;  3NXA A;  1QX7 A;  1J1E A;  1OMT A;  5AAN A;  1Y0V H;  1F71 A;  1CHO I;  3O78 A;  2NU3 I;  1PRW A;  1HPT A;  4U8D A;  1KSO A;  1JBA A;  1YVL A;  3CXL A;  2CT9 A;  1B8L A;  3PN7 B;  2JTT A;  4NDB A;  1PPF I;  2BE6 A;  2WC8 A;  1W7I B;  2M0R A;  1MQ1 A;  3NSO A;  2OTG C;  3TJQ A;  3I5I B;  4GBA A;  2KHN A;  3HX4 A;  2QQE A;  3GOX A;  1FBV A;  2F8P A;  1KK7 Y;  4MVF A;  2K0J A;  4DIR A;  2M7L A;  4GGF C;  2PRU A;  2JNF A;  2K7D A;  5HKZ A;  1JSA A;  3E2I A;  1R6P A;  1B7T Y;  1CLB A;  2JRF A;  3NSI A;  1CE3 A;  2P6B B;  1MUX A;  1K9K A;  1V1H A;  1OMD A;  1QS7 A;  3UEJ A;  2ZFD A;  1SRA A;  1B9A A;  2LVI A;  1KK8 C;  3D00 A;  1MXE A;  5FUX A;  1DF0 A;  1SK6 D;  2JXC A;  1IGV A;  1UVF A;  1SMG A;  5EX3 A;  3SGQ I;  3SG4 A;  1NX0 A;  3SIA A;  3BUX B;  4E68 A;  2LV7 A;  1FI5 A;  1EXR A;  1TOT A;  1B4C A;  1XX6 A;  3O6B A;  1A75 A;  1LA0 A;  2BBM A;  3SGB I;  1WLM A;  3TUY B;  3LLE A;  2GVI A;  1SPY A;  2LMT A;  1EG3 A;  4AQJ A;  1YRT B;  3EVR A;  4PE4 A;  2F2P A;  3OVO A;  3JVT C;  1MHO A;  1N0Y A;  3VDU A;  2HQW A;  1FI6 A;  2JC2 A;  4CLN A;  2LCP A;  1RFH A;  4YI9 A;  2N71 A;  3LK0 A;  2KGB C;  2ODD A;  1WDC B;  5CSJ A;  5AFP A;  2M8U A;  2MJW B;  3AKB A;  4OKH A;  3VRN A;  5K89 A;  1UUC A;  4UXJ A;  2V1C A;  1PK0 D;  1NX3 A;  2JPT A;  4HRH A;  1S36 A;  2JOJ A;  2MBX A;  1OSA A;  3K21 A;  4YGB B;  4XYN A;  2KMR A;  2ROW A;  2KMO A;  3UGI A;  3AKA A;  4UPG A;  2M5X A;  2LUY A;  1FAR A;  2KMQ A;  3E59 A;  1TN4 A;  1CDN A;  1TGS I;  2QQD A;  4PE1 A;  3OXG A;  2L50 A;  1X4S A;  3PLF B;  5I2L A;  1AUI B;  2JXD A;  4P2Y B;  3MEK A;  3DVJ A;  1EJ3 A;  2Y1N A;  3CS1 A;  3B4V C;  1IJ6 A;  2YUU A;  1QIV A;  2KNE A;  3LCP C;  1S3P A;  3BQ3 A;  1SGQ I;  2WCE A;  4ORC B;  2YQP A;  1PCE A;  1KWO B;  1YRU B;  2Y5I A;  2SGP I;  3BOW A;  2SGQ I;  5FUY A;  1LKJ A;  1SCM C;  1SY9 A;  1UUR A;  3SJS A;  3VDP A;  2L7X A;  4OCI A;  5J3X A;  3D0Y B;  4M2Q A;  4HGU A;  2D8N A;  2LLU A;  2O5G A;  1GJY A;  5CCL A;  2SGE I;  3EK4 A;  3I5F C;  3JTD B;  1UWO A;  1X02 A;  2KDH A;  4GGF A;  4MEW A;  5HLO A;  2K9H A;  1TNQ A;  2KBI A;  1CTR A;  1JF0 A;  2H61 C;  1WRZ A;  2I7A A;  1MXL C;  3CR4 X;  4ZCV A;  2DB6 A;  3RU0 A;  3I5G B;  1OE9 B;  1SYM A;  3CLN A;  1QVI Z;  1ZOT B;  2E5R A;  1CGI I;  1TTX A;  1KSM A;  1PVB A;  1WRK A;  1YUT A;  1R0R I;  2MHH A;  1DF0 B;  4DS7 A;  1F4Q A;  4XJK A;  3TZ1 A;  1S6I A;  2ORW A;  4IL1 A;  1VRK A;  3SIB A;  5DKR A;  2FCE A;  1QV0 A;  4YBH B;  1K94 A;  2EC6 B;  5PAL A;  1TCO B;  2J9R A;  3EKH A;  1Y1A A;  2M7N A;  1CM1 A;  3H4S E;  2BCX A;  4ICB A;  4WQ3 A;  2I94 A;  2LMV A;  4SGB I;  1KFX S;  1LA3 A;  2GKR I;  2R2I A;  1TCF A;  1XVJ A;  1CFP A;  2KMP A;  1Q80 A;  3FS7 A;  4GFT A;  5ER4 X;  1K9P A;  2HQ8 A;  2JZM A;  5EX0 A;  1A4P A;  3OXF A;  1WLZ A;  5KSZ A;  2NU0 I;  3CZT X;  1SGN I;  1SW8 A;  3C1V A;  2F3C I;  1AHR A;  1BG1 A;  1CMF A;  1QAT A;  2E73 A;  1AJ4 A;  3F45 A;  2A4J A;  4ETO A;  1IH0 A;  1F4O A;  2O60 A;  2V53 A;  1PAL A;  2K8M B;  2WCF A;  1IJ5 A;  2K61 A;  1UHJ A;  5CSI A;  2EGD A;  4P5O E;  2BL0 B;  2LP3 A;  1B47 A;  2B8T A;  3OX6 A;  1YTP A;  1AK8 A;  2ERW A;  1B1G A;  3TS5 C;  2ZNE A;  1NCX A;  1ZUZ A;  3RM1 A;  1DMO A;  1LR7 A;  1Z7K B;  2MLF C;  2OD1 A;  1IRJ A;  4BY5 A;  3DD4 A;  4N1G A;  1YX8 A;  5HKW A;  1RJV A;  1XFZ O;  2OTG B;  1K8U A;  1PJU A;  1KBE A;  1Y1X A;  2RGI A;  4MRY A;  4YGA A;  4I5K A;  1J7R A;  1DJG A;  2WOS A;  5KU1 A;  1CFD A;  1KFU S;  2L4H A;  2IS9 A;  4C0K A;  1XK4 C;  3PDN A;  2KFH A;  3ZWH A;  2HF5 A;  1FW4 A;  2M29 A;  3PAL A;  4E1P A;  2H61 A;  1L7Z A;  1OZO A;  3GK1 A;  1M8B A;  2G2B A;  3UFF A;  3SG3 A;  3VGO A;  3CR2 A;  1KK8 B;  1CNP A;  3E3R A;  3CWG A;  1JF2 A;  1LR8 A;  3BUN B;  3GK4 X;  1C7V A;  3OL0 A;  4NDD A;  1PVA A;  1WRL A;  1GQM A;  2BE4 A;  1SR6 C;  2F2O A;  1L2O C;  2LUC A;  2ZN9 A;  2JZI A;  3CTN A;  4XJK B;  1JC2 A;  1CLL A;  5FYX A;  1U5I A;  2BCB A;  2CXJ A;  3A8R A;  4GPL B;  2ZRT A;  1J7P A;  1UHN A;  2LAP A;  4ORA B;  1W3S A;  1X74 A;  5B8I B;  1DJW A;  2KBM A;  3QRX A;  5HKY A;  2PSR A;  1IQ3 A;  1XO5 A;  1V1F A;  2LVJ A;  3JVT B;  1QTX A;  1M46 A;  5DKQ A;  4AQI A;  1IWQ A;  1RTP 1;  1RRO A;  2B0U C;  3KHE A;  1PSB A;  1G8I A;  2WND A;  1LR9 A;  1LIN A;  2QPO A;  2PAL A;  4MN0 A;  1G4Y R;  1TBQ R;  1OVO A;  1JFJ A;  1DJZ A;  2L4I A;  2Q91 A;  1S26 D;  1J7Q A;  1M45 A;  2JNX A;  1YTZ C;  2M1U A;  3SG7 A;  1UVG A;  2ARP F;  1CT0 I;  2K7O A;  2JTZ A;  3KF9 A;  5HQ8 A;  2KAV A;  4MZJ A;  5IBW A;  2GV5 A;  1SGY I;  3AAJ A;  4QJ3 B;  4I5J A;  1CKK A;  3EK8 A;  4UXH A;  1CDP A;  1R79 A;  4M2P A;  1EG4 A;  2JXL A;  4QJ4 B;  5KTY A;  1IW4 A;  1KK7 Z;  1OZS A;  2KFF A;  5D7F A;  1XA5 A;  1E8A A;  1OMU A;  1NYA A;  1Y6W A;  2TN4 A;  3I5H C;  1HDL A;  1YUU A;  1M39 A;  2EHB A;  1B8C A;  1B7T Z;  2AMI A;  3PAT A;  1EL4 A;  2SGF I;  3LL8 B;  3M0W A;  3PFV A;  4YRU A;  1SCM B;  1JWD A;  1Y1C A;  1BUS A;  4WRI A;  1QJT A;  2JT8 A;  1DJY A;  4N1F A;  2W0T A;  1TBR R;  3ZNI A;  3I5F B;  1DT7 B;  1XK4 A;  2JA1 A;  1DJX A;  4HRE E;  1Y8F A;  4GI3 C;  2Y4Q A;  2MRD A;  1J7O A;  1RWY A;  2BUS A;  1J1D A;  2ELI A;  4I5L B;  2KAX A;  3FWC A;  4A4C A;  5D69 A;  3EK7 A;  3KY9 A;  1XFX O;  2LC5 A;  4N5X A;  1YUR A;  1CFF A;  5FUV A;  1BU3 A;  3AAK A;  4PCW A;  5TNC A;  3ICB A;  2KCX A;  1K96 A;  2P6A C;  2Q4U A;  1TIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...