1N13A

The crystal structure of pyruvoyl-dependent arginine decarboxylase from methanococcus jannashii
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
PLHAYFKLPNTVSLVAGSSEGETPLNAFDGALLNAGIGNVNLIRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyruvoyl-dependent arginine decarboxylase beta chain
publication title Pyruvoyl-Dependent Arginine Decarboxylase from Methanococcus jannaschii: Crystal Structures of the Self-Cleaved and S53A Proenzyme Forms
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Lyase
total genus 6
structure length 46
sequence length 46
chains with identical sequence C, E, G, I, K
ec nomenclature ec 4.1.1.19: Arginine decarboxylase.
pdb deposition date 2002-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1n13A00
2NU3I 1LR7A 2WCYA 2JZMA 1CT0I 2M5XA 1CSOI 1M8CA 1CHOI 2GKRI 1SGRI 2V53A 1DS3I 1YU6C 2XRCA 1LR8A 1BUSA 1FYBA 2QQCA 4SGBI 1KMAA 1CGJI 1TGSI 1TUSA 1NUBA 1HJAI 2NU4I 1OMTA 1SGEI 2N71A 1UVFA 5JHWC 2KMOA 1TIHA 1CT2I 1SGPI 1IY6A 3QTLD 2ERWA 2ARPF 5DAEA 1CT4I 2SGDI 4OVOA 2KMPA 2LEOA 2KMRA 1OMUA 2SGEI 1OYVI 1YTPA 1N13A 1PPFI 2BUSA 3SEKC 1CGII 2NU2I 2KMQA 1TBRR 1UVGA 2NU1I 1DS2I 3SGBI 2F3CI 1R0RI 1HPTA 1UUCA 1Z7KB 1PCEA 3B4VC 1TBQR 2B0UC 3TJQA 2SGPI 2GKVA 2N17A 2JYYA 3SGQI 1SGNI 2SGQI 2JXDA 1SGQI 3HH2C 3OVOA 2GKTI 2N52A 1H0ZA 2SGFI 1PJUA 1MT1A 1IY5A 2KCXA 1BMOA 4GI3C 2NU0I 1OVOA 1Y1BA 4HGUA 1HDLA 1LR9A 1SGDI 2QQDA 1IW4A 1Y1CA 1SGYI 1TURA 1CE3A 1AN1I 2OVOA 2P6AC 1M8BA
chains in the Genus database with same CATH superfamily
2L7XA 1X74A 2QQEA 2NU3I 1LR7A 4UXHA 5EX0A 2WCYA 1X4SA 2JZMA 1CT0I 2M5XA 3UFFA 1Z2IA 1FY7A 1CSOI 1M8CA 2PQ8A 1W4RA 1CHOI 2GIVA 2JW6A 4MPIA 3GOXA 2GKRI 2FNFX 4DNCA 1SGRI 2ORWA 2V53A 1DS3I 1YU6C 3OL0A 2XRCA 1LR8A 2N1AB 1TBNA 2CWGA 2B8TA 2L8EA 4FKDA 1BUSA 3QAHA 1FYBA 1S20A 2QQCA 3QWPA 4SGBI 2DKVA 5E3RA 1KMAA 2J9RA 1CGJI 1FARA 1TGSI 1NUBA 1TUSA 4B6DA 1K7TA 2CWHA 1HJAI 2CWFA 1OMTA 2NU4I 1SGEI 3OXLA 2N71A 1UVFA 5JHWC 3D00A 3FSYA 1W3SA 1TIHA 2KMOA 1CT2I 2QQ0A 5HQ8A 1KBFA 5E3QA 2ENZA 1SGPI 1ULMA 3QTLD 1IY6A 2V1CA 1WGCA 4WP4A 2JA1A 5EX3A 3VE5A 2ERWA 2ARPF 4JCVE 5DAEA 3UEYA 1CT4I 1V1HA 3UEJA 1HEVA 1TOTA 3VDUA 1U5KA 2SGDI 5J8FA 1WGTA 4OVOA 5J8CA 2ELIA 2KMPA 2V1CC 2Y0MA 2YUUA 1Y8FA 2LEOA 1NXUA 2X52A 2KMRA 1OMUA 1ULKA 2SGEI 3RU0A 1OYVI 1ULNA 3TO9A 2OU2A 4UXJA 1WKXA 1YTPA 2RC4A 1N13A 2W0TA 2ORVA 5FUVA 2QPOA 1PPFI 2BUSA 1WTJA 1CGII 2NU2I 3SEKC 3UOEA 2KMQA 2LUYA 1TBRR 2DIPA 3R5CA 1UVGA 1KBEA 2NU1I 1DS2I 3SGBI 1PTQA 2CJSC 2F3CI 1XA6A 3TO6A 3UGIA 9WGAA 1R0RI 3TOBA 4AMLA 3CXLA 2WVJA 1P9ZA 2YQPA 1HPTA 1UUCA 1Z7KB 1PCEA 1PTRA 2E5RA 3B4VC 1TBQR 1XBTA 2B0UC 3KY9A 2SGPI 5FUYA 3TJQA 2GKVA 2N17A 4E1RA 3R5DA 1RFHA 2ENNA 2JYYA 2J87A 3SGQI 1SGNI 5FUWA 2LB7A 3FC3A 5FUXA 3TO7A 1K7VA 1MJ9A 5CCMA 2SGQI 2A20A 2JXDA 1SGQI 2ODDA 2OZUA 3HH2C 2OD1A 3OVOA 2GKTI 2E73A 3OXFA 3R5AA 4A24A 4E1PA 3UGLA 2N52A 3UGDA 2ROWA 1H0ZA 3VDPA 1V1IA 2SGFI 5HI7A 5E3PA 1PJUA 2RIJA 1Q9BA 4UXIA 3PDNA 1MT1A 1IY5A 2KCXA 1BMOA 1K7UA 4GI3C 2NU0I 1OVOA 2GVIA 1Y1BA 1R79A 3BJIA 3MEKA 2UZ3A 3OXGA 2UVOA 4HGUA 1HDLA 1LR9A 1SGDI 2WGCA 2QQDA 1P9GA 3E2IA 3E59A 1UHAA 1IW4A 1MJAA 3FSXA 3TOAA 1VDDA 1Y1CA 4L9MA 1SGYI 1TURA 1XX6A 5CCLA 7WGAA 1MJBA 1CE3A 1AN1I 2OVOA 1FAQA 1TBOA 2K9HA 2DB6A 2VRWB 3R5BA 2P6AC 1M8BA 2X3TA
chains in the Genus database with same CATH topology
2L7XA 1X74A 2QQEA 2NU3I 1LR7A 4UXHA 5EX0A 2WCYA 1X4SA 2JZMA 1CT0I 2M5XA 3UFFA 1CSOI 1M8CA 1W4RA 1CHOI 2JW6A 3GOXA 2GKRI 2FNFX 1SGRI 2ORWA 2V53A 1DS3I 1YU6C 3OL0A 2XRCA 1LR8A 2N1AB 1TBNA 2L8EA 2B8TA 4FKDA 1BUSA 1FYBA 2QQCA 4SGBI 3QWPA 1KMAA 2J9RA 1CGJI 1FARA 1TGSI 1NUBA 1TUSA 4B6DA 1HJAI 2NU4I 1OMTA 3OXLA 1SGEI 2N71A 1UVFA 5JHWC 3D00A 1W3SA 1TIHA 2KMOA 1CT2I 2QQ0A 5HQ8A 1KBFA 2ENZA 1SGPI 1IY6A 3QTLD 2V1CA 2JA1A 5EX3A 3VE5A 2ERWA 2ARPF 4JCVE 5DAEA 3UEYA 1CT4I 1V1HA 3UEJA 1TOTA 3VDUA 1U5KA 2SGDI 4OVOA 2ELIA 2KMPA 2V1CC 2YUUA 1Y8FA 2LEOA 2KMRA 1OMUA 2SGEI 3RU0A 1OYVI 4UXJA 1YTPA 1N13A 2W0TA 2ORVA 5FUVA 2QPOA 1PPFI 2BUSA 3SEKC 1CGII 2NU2I 2KMQA 2LUYA 1TBRR 2DIPA 1UVGA 1KBEA 2NU1I 1DS2I 3SGBI 1PTQA 2CJSC 2F3CI 1XA6A 3UGIA 1R0RI 3CXLA 2WVJA 2YQPA 1HPTA 1UUCA 1Z7KB 1PCEA 1PTRA 2E5RA 3B4VC 1TBQR 1XBTA 2B0UC 3KY9A 2SGPI 5FUYA 3TJQA 2GKVA 2N17A 4E1RA 1RFHA 2ENNA 2JYYA 2J87A 3SGQI 1SGNI 5FUWA 3FC3A 5FUXA 5CCMA 2SGQI 2A20A 2JXDA 1SGQI 2ODDA 3HH2C 3OVOA 2OD1A 3OXFA 2GKTI 2E73A 4A24A 4E1PA 3UGLA 2N52A 3UGDA 2ROWA 1H0ZA 3VDPA 1V1IA 2SGFI 5HI7A 1PJUA 4UXIA 3PDNA 1MT1A 1IY5A 2KCXA 1BMOA 4GI3C 2NU0I 1OVOA 2GVIA 1Y1BA 1R79A 3BJIA 3MEKA 2UZ3A 3OXGA 4HGUA 1HDLA 1LR9A 1SGDI 3E59A 2QQDA 3E2IA 1IW4A 1VDDA 1Y1CA 4L9MA 1SGYI 1TURA 1XX6A 5CCLA 1CE3A 1AN1I 2OVOA 1FAQA 1TBOA 2K9HA 2DB6A 2VRWB 2P6AC 1M8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NU3 I;  1LR7 A;  2WCY A;  2JZM A;  1CT0 I;  2M5X A;  1CSO I;  1M8C A;  1CHO I;  2GKR I;  1SGR I;  2V53 A;  1DS3 I;  1YU6 C;  2XRC A;  1LR8 A;  1BUS A;  1FYB A;  2QQC A;  4SGB I;  1KMA A;  1CGJ I;  1TGS I;  1TUS A;  1NUB A;  1HJA I;  2NU4 I;  1OMT A;  1SGE I;  2N71 A;  1UVF A;  5JHW C;  2KMO A;  1TIH A;  1CT2 I;  1SGP I;  1IY6 A;  3QTL D;  2ERW A;  2ARP F;  5DAE A;  1CT4 I;  2SGD I;  4OVO A;  2KMP A;  2LEO A;  2KMR A;  1OMU A;  2SGE I;  1OYV I;  1YTP A;  1N13 A;  1PPF I;  2BUS A;  3SEK C;  1CGI I;  2NU2 I;  2KMQ A;  1TBR R;  1UVG A;  2NU1 I;  1DS2 I;  3SGB I;  2F3C I;  1R0R I;  1HPT A;  1UUC A;  1Z7K B;  1PCE A;  3B4V C;  1TBQ R;  2B0U C;  3TJQ A;  2SGP I;  2GKV A;  2N17 A;  2JYY A;  3SGQ I;  1SGN I;  2SGQ I;  2JXD A;  1SGQ I;  3HH2 C;  3OVO A;  2GKT I;  2N52 A;  1H0Z A;  2SGF I;  1PJU A;  1MT1 A;  1IY5 A;  2KCX A;  1BMO A;  4GI3 C;  2NU0 I;  1OVO A;  1Y1B A;  4HGU A;  1HDL A;  1LR9 A;  1SGD I;  2QQD A;  1IW4 A;  1Y1C A;  1SGY I;  1TUR A;  1CE3 A;  1AN1 I;  2OVO A;  2P6A C;  1M8B A; 
#chains in the Genus database with same CATH topology
 2L7X A;  1X74 A;  2QQE A;  2NU3 I;  1LR7 A;  4UXH A;  5EX0 A;  2WCY A;  1X4S A;  2JZM A;  1CT0 I;  2M5X A;  3UFF A;  1Z2I A;  1FY7 A;  1CSO I;  1M8C A;  2PQ8 A;  1W4R A;  1CHO I;  2GIV A;  2JW6 A;  4MPI A;  3GOX A;  2GKR I;  2FNF X;  4DNC A;  1SGR I;  2ORW A;  2V53 A;  1DS3 I;  1YU6 C;  3OL0 A;  2XRC A;  1LR8 A;  2N1A B;  1TBN A;  2CWG A;  2B8T A;  2L8E A;  4FKD A;  1BUS A;  3QAH A;  1FYB A;  1S20 A;  2QQC A;  3QWP A;  4SGB I;  2DKV A;  5E3R A;  1KMA A;  2J9R A;  1CGJ I;  1FAR A;  1TGS I;  1NUB A;  1TUS A;  4B6D A;  1K7T A;  2CWH A;  1HJA I;  2CWF A;  1OMT A;  2NU4 I;  1SGE I;  3OXL A;  2N71 A;  1UVF A;  5JHW C;  3D00 A;  3FSY A;  1W3S A;  1TIH A;  2KMO A;  1CT2 I;  2QQ0 A;  5HQ8 A;  1KBF A;  5E3Q A;  2ENZ A;  1SGP I;  1ULM A;  3QTL D;  1IY6 A;  2V1C A;  1WGC A;  4WP4 A;  2JA1 A;  5EX3 A;  3VE5 A;  2ERW A;  2ARP F;  4JCV E;  5DAE A;  3UEY A;  1CT4 I;  1V1H A;  3UEJ A;  1HEV A;  1TOT A;  3VDU A;  1U5K A;  2SGD I;  5J8F A;  1WGT A;  4OVO A;  5J8C A;  2ELI A;  2KMP A;  2V1C C;  2Y0M A;  2YUU A;  1Y8F A;  2LEO A;  1NXU A;  2X52 A;  2KMR A;  1OMU A;  1ULK A;  2SGE I;  3RU0 A;  1OYV I;  1ULN A;  3TO9 A;  2OU2 A;  4UXJ A;  1WKX A;  1YTP A;  2RC4 A;  1N13 A;  2W0T A;  2ORV A;  5FUV A;  2QPO A;  1PPF I;  2BUS A;  1WTJ A;  1CGI I;  2NU2 I;  3SEK C;  3UOE A;  2KMQ A;  2LUY A;  1TBR R;  2DIP A;  3R5C A;  1UVG A;  1KBE A;  2NU1 I;  1DS2 I;  3SGB I;  1PTQ A;  2CJS C;  2F3C I;  1XA6 A;  3TO6 A;  3UGI A;  9WGA A;  1R0R I;  3TOB A;  4AML A;  3CXL A;  2WVJ A;  1P9Z A;  2YQP A;  1HPT A;  1UUC A;  1Z7K B;  1PCE A;  1PTR A;  2E5R A;  3B4V C;  1TBQ R;  1XBT A;  2B0U C;  3KY9 A;  2SGP I;  5FUY A;  3TJQ A;  2GKV A;  2N17 A;  4E1R A;  3R5D A;  1RFH A;  2ENN A;  2JYY A;  2J87 A;  3SGQ I;  1SGN I;  5FUW A;  2LB7 A;  3FC3 A;  5FUX A;  3TO7 A;  1K7V A;  1MJ9 A;  5CCM A;  2SGQ I;  2A20 A;  2JXD A;  1SGQ I;  2ODD A;  2OZU A;  3HH2 C;  2OD1 A;  3OVO A;  2GKT I;  2E73 A;  3OXF A;  3R5A A;  4A24 A;  4E1P A;  3UGL A;  2N52 A;  3UGD A;  2ROW A;  1H0Z A;  3VDP A;  1V1I A;  2SGF I;  5HI7 A;  5E3P A;  1PJU A;  2RIJ A;  1Q9B A;  4UXI A;  3PDN A;  1MT1 A;  1IY5 A;  2KCX A;  1BMO A;  1K7U A;  4GI3 C;  2NU0 I;  1OVO A;  2GVI A;  1Y1B A;  1R79 A;  3BJI A;  3MEK A;  2UZ3 A;  3OXG A;  2UVO A;  4HGU A;  1HDL A;  1LR9 A;  1SGD I;  2WGC A;  2QQD A;  1P9G A;  3E2I A;  3E59 A;  1UHA A;  1IW4 A;  1MJA A;  3FSX A;  3TOA A;  1VDD A;  1Y1C A;  4L9M A;  1SGY I;  1TUR A;  1XX6 A;  5CCL A;  7WGA A;  1MJB A;  1CE3 A;  1AN1 I;  2OVO A;  1FAQ A;  1TBO A;  2K9H A;  2DB6 A;  2VRW B;  3R5B A;  2P6A C;  1M8B A;  2X3T A; 
#chains in the Genus database with same CATH homology
 2L7X A;  1X74 A;  2QQE A;  2NU3 I;  1LR7 A;  4UXH A;  5EX0 A;  2WCY A;  1X4S A;  2JZM A;  1CT0 I;  2M5X A;  3UFF A;  1CSO I;  1M8C A;  1W4R A;  1CHO I;  2JW6 A;  3GOX A;  2GKR I;  2FNF X;  1SGR I;  2ORW A;  2V53 A;  1DS3 I;  1YU6 C;  3OL0 A;  2XRC A;  1LR8 A;  2N1A B;  1TBN A;  2L8E A;  2B8T A;  4FKD A;  1BUS A;  1FYB A;  2QQC A;  4SGB I;  3QWP A;  1KMA A;  2J9R A;  1CGJ I;  1FAR A;  1TGS I;  1NUB A;  1TUS A;  4B6D A;  1HJA I;  2NU4 I;  1OMT A;  3OXL A;  1SGE I;  2N71 A;  1UVF A;  5JHW C;  3D00 A;  1W3S A;  1TIH A;  2KMO A;  1CT2 I;  2QQ0 A;  5HQ8 A;  1KBF A;  2ENZ A;  1SGP I;  1IY6 A;  3QTL D;  2V1C A;  2JA1 A;  5EX3 A;  3VE5 A;  2ERW A;  2ARP F;  4JCV E;  5DAE A;  3UEY A;  1CT4 I;  1V1H A;  3UEJ A;  1TOT A;  3VDU A;  1U5K A;  2SGD I;  4OVO A;  2ELI A;  2KMP A;  2V1C C;  2YUU A;  1Y8F A;  2LEO A;  2KMR A;  1OMU A;  2SGE I;  3RU0 A;  1OYV I;  4UXJ A;  1YTP A;  1N13 A;  2W0T A;  2ORV A;  5FUV A;  2QPO A;  1PPF I;  2BUS A;  3SEK C;  1CGI I;  2NU2 I;  2KMQ A;  2LUY A;  1TBR R;  2DIP A;  1UVG A;  1KBE A;  2NU1 I;  1DS2 I;  3SGB I;  1PTQ A;  2CJS C;  2F3C I;  1XA6 A;  3UGI A;  1R0R I;  3CXL A;  2WVJ A;  2YQP A;  1HPT A;  1UUC A;  1Z7K B;  1PCE A;  1PTR A;  2E5R A;  3B4V C;  1TBQ R;  1XBT A;  2B0U C;  3KY9 A;  2SGP I;  5FUY A;  3TJQ A;  2GKV A;  2N17 A;  4E1R A;  1RFH A;  2ENN A;  2JYY A;  2J87 A;  3SGQ I;  1SGN I;  5FUW A;  3FC3 A;  5FUX A;  5CCM A;  2SGQ I;  2A20 A;  2JXD A;  1SGQ I;  2ODD A;  3HH2 C;  3OVO A;  2OD1 A;  3OXF A;  2GKT I;  2E73 A;  4A24 A;  4E1P A;  3UGL A;  2N52 A;  3UGD A;  2ROW A;  1H0Z A;  3VDP A;  1V1I A;  2SGF I;  5HI7 A;  1PJU A;  4UXI A;  3PDN A;  1MT1 A;  1IY5 A;  2KCX A;  1BMO A;  4GI3 C;  2NU0 I;  1OVO A;  2GVI A;  1Y1B A;  1R79 A;  3BJI A;  3MEK A;  2UZ3 A;  3OXG A;  4HGU A;  1HDL A;  1LR9 A;  1SGD I;  3E59 A;  2QQD A;  3E2I A;  1IW4 A;  1VDD A;  1Y1C A;  4L9M A;  1SGY I;  1TUR A;  1XX6 A;  5CCL A;  1CE3 A;  1AN1 I;  2OVO A;  1FAQ A;  1TBO A;  2K9H A;  2DB6 A;  2VRW B;  2P6A C;  1M8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...