1N13A

The crystal structure of pyruvoyl-dependent arginine decarboxylase from methanococcus jannashii
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
PLHAYFKLPNTVSLVAGSSEGETPLNAFDGALLNAGIGNVNLIRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Pyruvoyl-dependent arginine decarboxylase beta chain
publication title Pyruvoyl-Dependent Arginine Decarboxylase from Methanococcus jannaschii: Crystal Structures of the Self-Cleaved and S53A Proenzyme Forms
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 6
structure length 46
sequence length 46
chains with identical sequence C, E, G, I, K
ec nomenclature ec 4.1.1.19: Arginine decarboxylase.
pdb deposition date 2002-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1n13A00
1CE3A 5JHWC 1SGPI 1SGEI 3SGBI 2B0UC 4SGBI 3SGQI 1SGYI 4GI3C 1TURA 2GKRI 1CT4I 2NU0I 1OVOA 2N71A 1Y1CA 1CT0I 1LR8A 1OYVI 2JZMA 1AN1I 2XRCA 2JYYA 1TBQR 2KMQA 3B4VC 4HGUA 2SGDI 2NU4I 1TUSA 2ERWA 2NU3I 1N13A 1KMAA 1Z7KB 1CGII 1M8BA 3QTLD 1PPFI 2NU1I 1M8CA 2BUSA 2NU2I 1TGSI 2KMOA 1CT2I 1PJUA 3TJQA 1OMUA 3OVOA 2N52A 1HDLA 1UUCA 2SGFI 2SGEI 5DAEA 1R0RI 1YU6C 1IW4A 1PCEA 2WCYA 1LR9A 2QQCA 1BMOA 1Y1BA 2GKTI 2V53A 1LR7A 1SGNI 1FYBA 1TBRR 3HH2C 1SGQI 2GKVA 1CSOI 1DS3I 2OVOA 1HPTA 1NUBA 2LEOA 1UVGA 2SGPI 1TIHA 1OMTA 2P6AC 1H0ZA 2SGQI 1IY6A 4OVOA 2N17A 1IY5A 1CGJI 2QQDA 1MT1A 1BUSA 1SGDI 1CHOI 2ARPF 2KMRA 1DS2I 2F3CI 2JXDA 2M5XA 1HJAI 3SEKC 1UVFA 1SGRI 2KCXA 1YTPA 2KMPA
chains in the Genus database with same CATH superfamily
1CE3A 3TOBA 1SGPI 2FNFX 3MEKA 1SGEI 5JHWC 3SGBI 3GOXA 2B0UC 4SGBI 3RU0A 1NXUA 3SGQI 1SGYI 4GI3C 1TURA 2J87A 2GKRI 1CT4I 2NU0I 1OVOA 2N71A 1P9GA 1Y1CA 1CT0I 1MJAA 3UGLA 1XA6A 1LR8A 1FAQA 1OYVI 2JZMA 1AN1I 1ULNA 2XRCA 2JYYA 2ENNA 3OXLA 3TO6A 1TBQR 1S20A 2ODDA 3BJIA 2ROWA 2KMQA 3B4VC 5E3PA 4HGUA 4JCVE 2SGDI 2NU4I 2DB6A 1TUSA 2ERWA 2NU3I 1N13A 2OZUA 2UVOA 2W0TA 1Z7KB 4UXJA 1CGII 1M8BA 3QTLD 2GIVA 1ULKA 1PPFI 2L7XA 2NU1I 3E2IA 1M8CA 3R5AA 3FC3A 1K7VA 2BUSA 5FUWA 1K7TA 3R5CA 2NU2I 4WP4A 1TGSI 2CWGA 3PDNA 2KMOA 3UOEA 1WTJA 1CT2I 3UGIA 2VRWB 4E1RA 2N1AB 1XBTA 1PJUA 2J9RA 3UGDA 1TOTA 1VDDA 5E3QA 2UZ3A 3TJQA 3UEYA 5FUVA 5J8FA 2OU2A 3UFFA 1OMUA 2V1CA 3KY9A 1KBEA 3OVOA 5FUYA 2PQ8A 2N52A 3FSXA 2CJSC 1PTRA 1UUCA 3FSYA 1HDLA 3E59A 2E5RA 2DKVA 2ORVA 2QPOA 2SGFI 2SGEI 4L9MA 4AMLA 4FKDA 1MJBA 5DAEA 5HQ8A 1R0RI 2CWFA 1YU6C 1IW4A 1TBOA 1PCEA 2B8TA 3TOAA 1K7UA 2WCYA 1W4RA 1WGTA 1LR9A 1KMAA 3VDPA 5J8CA 2QQCA 1BMOA 2QQEA 1ULMA 3UEJA 1Y1BA 2GKTI 2V53A 2JA1A 3VE5A 1WGCA 1LR7A 2WVJA 4MPIA 2ENZA 4DNCA 2RC4A 1SGNI 2L8EA 2DIPA 2ELIA 2QQ0A 4UXHA 1FYBA 1WKXA 1V1IA 1TBRR 1KBFA 3HH2C 1SGQI 1TBNA 2JW6A 3TO7A 1FARA 2A20A 1UHAA 2GKVA 2LB7A 5HI7A 4B6DA 1CSOI 1DS3I 1PTQA 2OVOA 3VDUA 1HPTA 1NUBA 1Q9BA 2KMPA 2YUUA 2X52A 1P9ZA 2LEOA 1UVGA 2SGPI 2YQPA 5CCLA 1HEVA 1TIHA 5FUXA 2GVIA 1OMTA 3R5BA 2P6AC 2OD1A 1H0ZA 2SGQI 3TO9A 2RIJA 4E1PA 1IY6A 1X74A 4OVOA 3D00A 1U5KA 2N17A 1XX6A 1Z2IA 1IY5A 2LUYA 1CGJI 2WGCA 5EX3A 2ORWA 1MJ9A 2QQDA 1MT1A 1BUSA 3CXLA 4A24A 3OXFA 1SGDI 2K9HA 1CHOI 2ARPF 2KMRA 1V1HA 1RFHA 2Y0MA 2E73A 2V1CC 1DS2I 1R79A 2F3CI 3QAHA 3QWPA 5E3RA 9WGAA 1FY7A 3OXGA 2JXDA 2M5XA 1HJAI 3OL0A 3R5DA 4UXIA 1UVFA 1W3SA 3SEKC 5CCMA 7WGAA 1SGRI 2KCXA 1X4SA 1Y8FA 5EX0A 1YTPA 2X3TA 2CWHA
chains in the Genus database with same CATH topology
1CE3A 5JHWC 1SGPI 2FNFX 3MEKA 1SGEI 3SGBI 3GOXA 2B0UC 4SGBI 3RU0A 3SGQI 1SGYI 4GI3C 1TURA 2J87A 2GKRI 1CT4I 2NU0I 1OVOA 2N71A 1Y1CA 1CT0I 1FAQA 3UGLA 1XA6A 1LR8A 1OYVI 2JZMA 1AN1I 3OXLA 2XRCA 2JYYA 2ENNA 1TBQR 2ODDA 3BJIA 2ROWA 2KMQA 3B4VC 4HGUA 4JCVE 2SGDI 2NU4I 2DB6A 1TUSA 2ERWA 2NU3I 1N13A 2W0TA 4UXJA 1KMAA 1Z7KB 1CGII 1M8BA 3QTLD 1PPFI 2L7XA 2NU1I 3E2IA 1M8CA 3FC3A 2BUSA 5FUWA 2NU2I 1TGSI 3PDNA 2KMOA 3UGIA 1CT2I 2VRWB 4E1RA 2N1AB 1XBTA 1PJUA 2J9RA 3UGDA 1TOTA 1VDDA 2UZ3A 3TJQA 3UEYA 5FUVA 3UFFA 1OMUA 2V1CA 3KY9A 1KBEA 3OVOA 5FUYA 2N52A 2CJSC 1PTRA 1UUCA 1HDLA 3E59A 2E5RA 2ORVA 2QPOA 2SGFI 2SGEI 4L9MA 4FKDA 5DAEA 5HQ8A 1R0RI 1YU6C 1IW4A 1TBOA 2B8TA 1PCEA 2WCYA 1W4RA 1LR9A 3VDPA 2QQCA 1BMOA 2QQEA 3UEJA 1Y1BA 2GKTI 2V53A 2JA1A 3VE5A 1LR7A 2WVJA 2ENZA 1SGNI 2L8EA 2DIPA 2ELIA 2QQ0A 4UXHA 1FYBA 1V1IA 1TBRR 1KBFA 3HH2C 1SGQI 1TBNA 2JW6A 1FARA 2A20A 2GKVA 5HI7A 4B6DA 1CSOI 1DS3I 1PTQA 2OVOA 3VDUA 1HPTA 1NUBA 2YUUA 2LEOA 1UVGA 2SGPI 2YQPA 5CCLA 1TIHA 5FUXA 2GVIA 1OMTA 2P6AC 2OD1A 1H0ZA 2SGQI 4E1PA 1IY6A 1X74A 4OVOA 3D00A 1U5KA 2N17A 1XX6A 1IY5A 2LUYA 1CGJI 5EX3A 2ORWA 2QQDA 1MT1A 1BUSA 3CXLA 4A24A 3OXFA 1SGDI 2K9HA 1CHOI 2ARPF 2KMRA 1V1HA 1RFHA 2E73A 2V1CC 1DS2I 1R79A 2F3CI 3QWPA 3OXGA 2JXDA 2M5XA 1HJAI 3OL0A 4UXIA 3SEKC 1UVFA 1W3SA 5CCMA 1SGRI 2KCXA 1Y8FA 1X4SA 5EX0A 1YTPA 2KMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CE3 A;  5JHW C;  1SGP I;  1SGE I;  3SGB I;  2B0U C;  4SGB I;  3SGQ I;  1SGY I;  4GI3 C;  1TUR A;  2GKR I;  1CT4 I;  2NU0 I;  1OVO A;  2N71 A;  1Y1C A;  1CT0 I;  1LR8 A;  1OYV I;  2JZM A;  1AN1 I;  2XRC A;  2JYY A;  1TBQ R;  2KMQ A;  3B4V C;  4HGU A;  2SGD I;  2NU4 I;  1TUS A;  2ERW A;  2NU3 I;  1N13 A;  1KMA A;  1Z7K B;  1CGI I;  1M8B A;  3QTL D;  1PPF I;  2NU1 I;  1M8C A;  2BUS A;  2NU2 I;  1TGS I;  2KMO A;  1CT2 I;  1PJU A;  3TJQ A;  1OMU A;  3OVO A;  2N52 A;  1HDL A;  1UUC A;  2SGF I;  2SGE I;  5DAE A;  1R0R I;  1YU6 C;  1IW4 A;  1PCE A;  2WCY A;  1LR9 A;  2QQC A;  1BMO A;  1Y1B A;  2GKT I;  2V53 A;  1LR7 A;  1SGN I;  1FYB A;  1TBR R;  3HH2 C;  1SGQ I;  2GKV A;  1CSO I;  1DS3 I;  2OVO A;  1HPT A;  1NUB A;  2LEO A;  1UVG A;  2SGP I;  1TIH A;  1OMT A;  2P6A C;  1H0Z A;  2SGQ I;  1IY6 A;  4OVO A;  2N17 A;  1IY5 A;  1CGJ I;  2QQD A;  1MT1 A;  1BUS A;  1SGD I;  1CHO I;  2ARP F;  2KMR A;  1DS2 I;  2F3C I;  2JXD A;  2M5X A;  1HJA I;  3SEK C;  1UVF A;  1SGR I;  2KCX A;  1YTP A;  2KMP A; 
#chains in the Genus database with same CATH topology
 1CE3 A;  3TOB A;  1SGP I;  2FNF X;  3MEK A;  1SGE I;  5JHW C;  3SGB I;  3GOX A;  2B0U C;  4SGB I;  3RU0 A;  1NXU A;  3SGQ I;  1SGY I;  4GI3 C;  1TUR A;  2J87 A;  2GKR I;  1CT4 I;  2NU0 I;  1OVO A;  2N71 A;  1P9G A;  1Y1C A;  1CT0 I;  1MJA A;  3UGL A;  1XA6 A;  1LR8 A;  1FAQ A;  1OYV I;  2JZM A;  1AN1 I;  1ULN A;  2XRC A;  2JYY A;  2ENN A;  3OXL A;  3TO6 A;  1TBQ R;  1S20 A;  2ODD A;  3BJI A;  2ROW A;  2KMQ A;  3B4V C;  5E3P A;  4HGU A;  4JCV E;  2SGD I;  2NU4 I;  2DB6 A;  1TUS A;  2ERW A;  2NU3 I;  1N13 A;  2OZU A;  2UVO A;  2W0T A;  1Z7K B;  4UXJ A;  1CGI I;  1M8B A;  3QTL D;  2GIV A;  1ULK A;  1PPF I;  2L7X A;  2NU1 I;  3E2I A;  1M8C A;  3R5A A;  3FC3 A;  1K7V A;  2BUS A;  5FUW A;  1K7T A;  3R5C A;  2NU2 I;  4WP4 A;  1TGS I;  2CWG A;  3PDN A;  2KMO A;  3UOE A;  1WTJ A;  1CT2 I;  3UGI A;  2VRW B;  4E1R A;  2N1A B;  1XBT A;  1PJU A;  2J9R A;  3UGD A;  1TOT A;  1VDD A;  5E3Q A;  2UZ3 A;  3TJQ A;  3UEY A;  5FUV A;  5J8F A;  2OU2 A;  3UFF A;  1OMU A;  2V1C A;  3KY9 A;  1KBE A;  3OVO A;  5FUY A;  2PQ8 A;  2N52 A;  3FSX A;  2CJS C;  1PTR A;  1UUC A;  3FSY A;  1HDL A;  3E59 A;  2E5R A;  2DKV A;  2ORV A;  2QPO A;  2SGF I;  2SGE I;  4L9M A;  4AML A;  4FKD A;  1MJB A;  5DAE A;  5HQ8 A;  1R0R I;  2CWF A;  1YU6 C;  1IW4 A;  1TBO A;  1PCE A;  2B8T A;  3TOA A;  1K7U A;  2WCY A;  1W4R A;  1WGT A;  1LR9 A;  1KMA A;  3VDP A;  5J8C A;  2QQC A;  1BMO A;  2QQE A;  1ULM A;  3UEJ A;  1Y1B A;  2GKT I;  2V53 A;  2JA1 A;  3VE5 A;  1WGC A;  1LR7 A;  2WVJ A;  4MPI A;  2ENZ A;  4DNC A;  2RC4 A;  1SGN I;  2L8E A;  2DIP A;  2ELI A;  2QQ0 A;  4UXH A;  1FYB A;  1WKX A;  1V1I A;  1TBR R;  1KBF A;  3HH2 C;  1SGQ I;  1TBN A;  2JW6 A;  3TO7 A;  1FAR A;  2A20 A;  1UHA A;  2GKV A;  2LB7 A;  5HI7 A;  4B6D A;  1CSO I;  1DS3 I;  1PTQ A;  2OVO A;  3VDU A;  1HPT A;  1NUB A;  1Q9B A;  2KMP A;  2YUU A;  2X52 A;  1P9Z A;  2LEO A;  1UVG A;  2SGP I;  2YQP A;  5CCL A;  1HEV A;  1TIH A;  5FUX A;  2GVI A;  1OMT A;  3R5B A;  2P6A C;  2OD1 A;  1H0Z A;  2SGQ I;  3TO9 A;  2RIJ A;  4E1P A;  1IY6 A;  1X74 A;  4OVO A;  3D00 A;  1U5K A;  2N17 A;  1XX6 A;  1Z2I A;  1IY5 A;  2LUY A;  1CGJ I;  2WGC A;  5EX3 A;  2ORW A;  1MJ9 A;  2QQD A;  1MT1 A;  1BUS A;  3CXL A;  4A24 A;  3OXF A;  1SGD I;  2K9H A;  1CHO I;  2ARP F;  2KMR A;  1V1H A;  1RFH A;  2Y0M A;  2E73 A;  2V1C C;  1DS2 I;  1R79 A;  2F3C I;  3QAH A;  3QWP A;  5E3R A;  9WGA A;  1FY7 A;  3OXG A;  2JXD A;  2M5X A;  1HJA I;  3OL0 A;  3R5D A;  4UXI A;  1UVF A;  1W3S A;  3SEK C;  5CCM A;  7WGA A;  1SGR I;  2KCX A;  1X4S A;  1Y8F A;  5EX0 A;  1YTP A;  2X3T A;  2CWH A; 
#chains in the Genus database with same CATH homology
 1CE3 A;  5JHW C;  1SGP I;  2FNF X;  3MEK A;  1SGE I;  3SGB I;  3GOX A;  2B0U C;  4SGB I;  3RU0 A;  3SGQ I;  1SGY I;  4GI3 C;  1TUR A;  2J87 A;  2GKR I;  1CT4 I;  2NU0 I;  1OVO A;  2N71 A;  1Y1C A;  1CT0 I;  1FAQ A;  3UGL A;  1XA6 A;  1LR8 A;  1OYV I;  2JZM A;  1AN1 I;  3OXL A;  2XRC A;  2JYY A;  2ENN A;  1TBQ R;  2ODD A;  3BJI A;  2ROW A;  2KMQ A;  3B4V C;  4HGU A;  4JCV E;  2SGD I;  2NU4 I;  2DB6 A;  1TUS A;  2ERW A;  2NU3 I;  1N13 A;  2W0T A;  4UXJ A;  1KMA A;  1Z7K B;  1CGI I;  1M8B A;  3QTL D;  1PPF I;  2L7X A;  2NU1 I;  3E2I A;  1M8C A;  3FC3 A;  2BUS A;  5FUW A;  2NU2 I;  1TGS I;  3PDN A;  2KMO A;  3UGI A;  1CT2 I;  2VRW B;  4E1R A;  2N1A B;  1XBT A;  1PJU A;  2J9R A;  3UGD A;  1TOT A;  1VDD A;  2UZ3 A;  3TJQ A;  3UEY A;  5FUV A;  3UFF A;  1OMU A;  2V1C A;  3KY9 A;  1KBE A;  3OVO A;  5FUY A;  2N52 A;  2CJS C;  1PTR A;  1UUC A;  1HDL A;  3E59 A;  2E5R A;  2ORV A;  2QPO A;  2SGF I;  2SGE I;  4L9M A;  4FKD A;  5DAE A;  5HQ8 A;  1R0R I;  1YU6 C;  1IW4 A;  1TBO A;  2B8T A;  1PCE A;  2WCY A;  1W4R A;  1LR9 A;  3VDP A;  2QQC A;  1BMO A;  2QQE A;  3UEJ A;  1Y1B A;  2GKT I;  2V53 A;  2JA1 A;  3VE5 A;  1LR7 A;  2WVJ A;  2ENZ A;  1SGN I;  2L8E A;  2DIP A;  2ELI A;  2QQ0 A;  4UXH A;  1FYB A;  1V1I A;  1TBR R;  1KBF A;  3HH2 C;  1SGQ I;  1TBN A;  2JW6 A;  1FAR A;  2A20 A;  2GKV A;  5HI7 A;  4B6D A;  1CSO I;  1DS3 I;  1PTQ A;  2OVO A;  3VDU A;  1HPT A;  1NUB A;  2YUU A;  2LEO A;  1UVG A;  2SGP I;  2YQP A;  5CCL A;  1TIH A;  5FUX A;  2GVI A;  1OMT A;  2P6A C;  2OD1 A;  1H0Z A;  2SGQ I;  4E1P A;  1IY6 A;  1X74 A;  4OVO A;  3D00 A;  1U5K A;  2N17 A;  1XX6 A;  1IY5 A;  2LUY A;  1CGJ I;  5EX3 A;  2ORW A;  2QQD A;  1MT1 A;  1BUS A;  3CXL A;  4A24 A;  3OXF A;  1SGD I;  2K9H A;  1CHO I;  2ARP F;  2KMR A;  1V1H A;  1RFH A;  2E73 A;  2V1C C;  1DS2 I;  1R79 A;  2F3C I;  3QWP A;  3OXG A;  2JXD A;  2M5X A;  1HJA I;  3OL0 A;  4UXI A;  3SEK C;  1UVF A;  1W3S A;  5CCM A;  1SGR I;  2KCX A;  1Y8F A;  1X4S A;  5EX0 A;  1YTP A;  2KMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...