2ENZA

Solution structure of the second c1 domain from human protein kinase c theta
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
65
structure length
65
Chain Sequence
GSSGSSGKIDMPHRFKVYNYKSPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the second C1 domain from human protein kinase C theta
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Protein kinase C theta type
total genus 6
structure length 65
sequence length 65
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2enzA01
2ENNA 2UZ3A 2B8TA 1TBOA 2ENZA 5FUXA 3E2IA 2YUUA 1RFHA 1FAQA 1XX6A 2DB6A 2E73A 5FUWA 4L9MA 1PTRA 2ROWA 3BJIA 3UEYA 1KBFA 3CXLA 1Y8FA 2QQ0A 3KY9A 1TBNA 1KBEA 1R79A 2J9RA 2JA1A 1W4RA 1XBTA 4UXIA 5FUYA 3UGDA 3UFFA 2ORWA 1FARA 2J87A 2WVJA 4FKDA 2ELIA 4UXHA 4UXJA 2VRWB 4B6DA 2ORVA 3UGIA 2QQEA 5FUVA 2QPOA 1XA6A 2GVIA 2FNFX 1PTQA 3UGLA 3UEJA
chains in the Genus database with same CATH superfamily
5HQ8A 2UZ3A 3OL0A 3R5AA 2B8TA 1X4SA 2W0TA 2SGDI 2GKVA 3E2IA 2YUUA 7WGAA 2F3CI 2L7XA 1Q9BA 1PTRA 2JZMA 3PDNA 2N17A 2NU3I 1CE3A 5EX3A 2YQPA 2GKTI 1CSOI 3HH2C 5EX0A 2SGPI 3RU0A 1OYVI 4GI3C 1XBTA 4UXIA 4E1PA 1V1HA 3TJQA 2CWFA 3UGDA 2P6AC 2N52A 1MJBA 1V1IA 4DNCA 1PCEA 1FARA 1HDLA 2BUSA 1ULKA 1Y1CA 2WVJA 1LR8A 1K7UA 1MJ9A 1K7TA 2B0UC 2V53A 1R0RI 4B6DA 2DKVA 4SGBI 2NU4I 4E1RA 1SGNI 2QQEA 2M5XA 1Z2IA 3UEJA 1WKXA 1KMAA 3OXGA 2ENZA 1YU6C 2V1CA 5FUXA 1W3SA 1XX6A 2DB6A 2KMPA 5FUWA 3VDUA 3TO7A 1K7VA 2ROWA 3OXLA 3UEYA 2CJSC 1M8CA 2WCYA 2V1CC 4MPIA 2QQ0A 4OVOA 3E59A 1KBEA 2LB7A 1NUBA 3TO9A 2JA1A 1TGSI 2SGEI 1HEVA 2KCXA 2KMRA 3R5DA 1IW4A 1X74A 2KMQA 2ORWA 2RIJA 2J87A 5E3QA 5JHWC 4UXHA 1MT1A 1BMOA 1OMTA 1OVOA 3UOEA 1NXUA 3TOAA 2XRCA 5E3RA 2LEOA 1M8BA 2ERWA 5HI7A 3FSXA 1PJUA 2GKRI 2FNFX 3UGLA 1H0ZA 1AN1I 1TBOA 3QAHA 2SGFI 1RFHA 3VE5A 1FAQA 1MJAA 2QQDA 1KBFA 1SGRI 2Y0MA 2QQCA 2X52A 9WGAA 1UUCA 1Y8FA 2WGCA 1HJAI 3KY9A 3TOBA 5J8FA 2J9RA 1TUSA 1LR7A 2JW6A 1P9ZA 2RC4A 1TOTA 1ULNA 1S20A 5E3PA 2LUYA 4AMLA 3R5CA 1SGPI 5FUYA 5CCLA 1YTPA 3UFFA 1OMUA 2NU2I 3GOXA 1IY5A 1TURA 3D00A 2ODDA 2CWGA 1IY6A 1SGYI 2VRWB 1VDDA 2ORVA 3MEKA 1P9GA 1SGQI 1TBRR 3OVOA 1WTJA 2E5RA 2KMOA 3UGIA 5CCMA 2QPOA 3FC3A 1BUSA 1XA6A 2GVIA 5DAEA 3SGBI 3R5BA 3TO6A 1FYBA 1WGTA 1PTQA 2OZUA 2ENNA 2NU0I 1SGEI 1UVFA 2JYYA 3FSYA 1SGDI 1U5KA 2N1AB 3B4VC 1HPTA 1TBQR 1TIHA 2N71A 2E73A 2OVOA 1FY7A 2PQ8A 2UVOA 4L9MA 3BJIA 1CT2I 4A24A 2X3TA 2GIVA 3CXLA 2L8EA 1UVGA 1TBNA 2OD1A 2SGQI 1R79A 3SGQI 1CGJI 1W4RA 1CT4I 1CHOI 1N13A 1UHAA 2CWHA 5J8CA 3SEKC 2JXDA 2NU1I 4WP4A 1PPFI 1CT0I 1DS2I 1ULMA 3QTLD 1DS3I 2ELIA 2A20A 4FKDA 1LR9A 3VDPA 4UXJA 1Z7KB 1WGCA 3QWPA 2OU2A 2DIPA 2ARPF 5FUVA 1CGII 3OXFA 4JCVE 2K9HA 1Y1BA 4HGUA
chains in the Genus database with same CATH topology
5HQ8A 2UZ3A 3OL0A 2B8TA 1X4SA 2W0TA 2SGDI 2GKVA 3E2IA 2YUUA 2F3CI 2L7XA 3PDNA 1PTRA 2JZMA 2N17A 2NU3I 1CE3A 5EX3A 2YQPA 2GKTI 1CSOI 3HH2C 5EX0A 2SGPI 3RU0A 1OYVI 4GI3C 1XBTA 4UXIA 4E1PA 1V1HA 3TJQA 3UGDA 2P6AC 2N52A 1V1IA 1PCEA 1FARA 1HDLA 2BUSA 2WVJA 1Y1CA 1LR8A 2B0UC 2V53A 1R0RI 4B6DA 4SGBI 2NU4I 4E1RA 1SGNI 2QQEA 2M5XA 3UEJA 1KMAA 3OXGA 2ENZA 1YU6C 2V1CA 5FUXA 1W3SA 1XX6A 2DB6A 2KMPA 5FUWA 3VDUA 2ROWA 3OXLA 3UEYA 2CJSC 1M8CA 2WCYA 2V1CC 2QQ0A 4OVOA 3E59A 1KBEA 1NUBA 2JA1A 1TGSI 2SGEI 2KCXA 2KMRA 1IW4A 1X74A 2KMQA 2ORWA 2J87A 5JHWC 4UXHA 1MT1A 1BMOA 1OMTA 1OVOA 2XRCA 2LEOA 1M8BA 2ERWA 5HI7A 1PJUA 2GKRI 2FNFX 3UGLA 1H0ZA 1AN1I 1TBOA 2SGFI 1RFHA 3VE5A 1FAQA 2QQDA 1KBFA 1SGRI 2QQCA 1UUCA 1Y8FA 3KY9A 1HJAI 2J9RA 1TUSA 1LR7A 2JW6A 1TOTA 2LUYA 5CCLA 5FUYA 1SGPI 1YTPA 3UFFA 1OMUA 2NU2I 3GOXA 1IY5A 1TURA 3D00A 2ODDA 1IY6A 1SGYI 2VRWB 1VDDA 2ORVA 3MEKA 1SGQI 1TBRR 3OVOA 2E5RA 3FC3A 2KMOA 3UGIA 5CCMA 2QPOA 1BUSA 1XA6A 2GVIA 5DAEA 3SGBI 1FYBA 1PTQA 2ENNA 2NU0I 1SGEI 1UVFA 2JYYA 1SGDI 1U5KA 2N1AB 3B4VC 1HPTA 1TBQR 1TIHA 2N71A 2E73A 2OVOA 4L9MA 3BJIA 1CT2I 4A24A 3CXLA 2L8EA 1UVGA 1TBNA 2OD1A 2SGQI 1R79A 3SGQI 1CGJI 1CT4I 1CHOI 1N13A 1W4RA 3SEKC 2JXDA 2NU1I 1PPFI 1CT0I 1DS2I 3QTLD 4FKDA 1DS3I 2ELIA 2A20A 3VDPA 1LR9A 4UXJA 1Z7KB 3QWPA 2DIPA 2ARPF 5FUVA 1CGII 3OXFA 4JCVE 2K9HA 1Y1BA 4HGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ENN A;  2UZ3 A;  2B8T A;  1TBO A;  2ENZ A;  5FUX A;  3E2I A;  2YUU A;  1RFH A;  1FAQ A;  1XX6 A;  2DB6 A;  2E73 A;  5FUW A;  4L9M A;  1PTR A;  2ROW A;  3BJI A;  3UEY A;  1KBF A;  3CXL A;  1Y8F A;  2QQ0 A;  3KY9 A;  1TBN A;  1KBE A;  1R79 A;  2J9R A;  2JA1 A;  1W4R A;  1XBT A;  4UXI A;  5FUY A;  3UGD A;  3UFF A;  2ORW A;  1FAR A;  2J87 A;  2WVJ A;  4FKD A;  2ELI A;  4UXH A;  4UXJ A;  2VRW B;  4B6D A;  2ORV A;  3UGI A;  2QQE A;  5FUV A;  2QPO A;  1XA6 A;  2GVI A;  2FNF X;  1PTQ A;  3UGL A;  3UEJ A; 
#chains in the Genus database with same CATH topology
 5HQ8 A;  2UZ3 A;  3OL0 A;  3R5A A;  2B8T A;  1X4S A;  2W0T A;  2SGD I;  2GKV A;  3E2I A;  2YUU A;  7WGA A;  2F3C I;  2L7X A;  1Q9B A;  1PTR A;  2JZM A;  3PDN A;  2N17 A;  2NU3 I;  1CE3 A;  5EX3 A;  2YQP A;  2GKT I;  1CSO I;  3HH2 C;  5EX0 A;  2SGP I;  3RU0 A;  1OYV I;  4GI3 C;  1XBT A;  4UXI A;  4E1P A;  1V1H A;  3TJQ A;  2CWF A;  3UGD A;  2P6A C;  2N52 A;  1MJB A;  1V1I A;  4DNC A;  1PCE A;  1FAR A;  1HDL A;  2BUS A;  1ULK A;  1Y1C A;  2WVJ A;  1LR8 A;  1K7U A;  1MJ9 A;  1K7T A;  2B0U C;  2V53 A;  1R0R I;  4B6D A;  2DKV A;  4SGB I;  2NU4 I;  4E1R A;  1SGN I;  2QQE A;  2M5X A;  1Z2I A;  3UEJ A;  1WKX A;  1KMA A;  3OXG A;  2ENZ A;  1YU6 C;  2V1C A;  5FUX A;  1W3S A;  1XX6 A;  2DB6 A;  2KMP A;  5FUW A;  3VDU A;  3TO7 A;  1K7V A;  2ROW A;  3OXL A;  3UEY A;  2CJS C;  1M8C A;  2WCY A;  2V1C C;  4MPI A;  2QQ0 A;  4OVO A;  3E59 A;  1KBE A;  2LB7 A;  1NUB A;  3TO9 A;  2JA1 A;  1TGS I;  2SGE I;  1HEV A;  2KCX A;  2KMR A;  3R5D A;  1IW4 A;  1X74 A;  2KMQ A;  2ORW A;  2RIJ A;  2J87 A;  5E3Q A;  5JHW C;  4UXH A;  1MT1 A;  1BMO A;  1OMT A;  1OVO A;  3UOE A;  1NXU A;  3TOA A;  2XRC A;  5E3R A;  2LEO A;  1M8B A;  2ERW A;  5HI7 A;  3FSX A;  1PJU A;  2GKR I;  2FNF X;  3UGL A;  1H0Z A;  1AN1 I;  1TBO A;  3QAH A;  2SGF I;  1RFH A;  3VE5 A;  1FAQ A;  1MJA A;  2QQD A;  1KBF A;  1SGR I;  2Y0M A;  2QQC A;  2X52 A;  9WGA A;  1UUC A;  1Y8F A;  2WGC A;  1HJA I;  3KY9 A;  3TOB A;  5J8F A;  2J9R A;  1TUS A;  1LR7 A;  2JW6 A;  1P9Z A;  2RC4 A;  1TOT A;  1ULN A;  1S20 A;  5E3P A;  2LUY A;  4AML A;  3R5C A;  1SGP I;  5FUY A;  5CCL A;  1YTP A;  3UFF A;  1OMU A;  2NU2 I;  3GOX A;  1IY5 A;  1TUR A;  3D00 A;  2ODD A;  2CWG A;  1IY6 A;  1SGY I;  2VRW B;  1VDD A;  2ORV A;  3MEK A;  1P9G A;  1SGQ I;  1TBR R;  3OVO A;  1WTJ A;  2E5R A;  2KMO A;  3UGI A;  5CCM A;  2QPO A;  3FC3 A;  1BUS A;  1XA6 A;  2GVI A;  5DAE A;  3SGB I;  3R5B A;  3TO6 A;  1FYB A;  1WGT A;  1PTQ A;  2OZU A;  2ENN A;  2NU0 I;  1SGE I;  1UVF A;  2JYY A;  3FSY A;  1SGD I;  1U5K A;  2N1A B;  3B4V C;  1HPT A;  1TBQ R;  1TIH A;  2N71 A;  2E73 A;  2OVO A;  1FY7 A;  2PQ8 A;  2UVO A;  4L9M A;  3BJI A;  1CT2 I;  4A24 A;  2X3T A;  2GIV A;  3CXL A;  2L8E A;  1UVG A;  1TBN A;  2OD1 A;  2SGQ I;  1R79 A;  3SGQ I;  1CGJ I;  1W4R A;  1CT4 I;  1CHO I;  1N13 A;  1UHA A;  2CWH A;  5J8C A;  3SEK C;  2JXD A;  2NU1 I;  4WP4 A;  1PPF I;  1CT0 I;  1DS2 I;  1ULM A;  3QTL D;  1DS3 I;  2ELI A;  2A20 A;  4FKD A;  1LR9 A;  3VDP A;  4UXJ A;  1Z7K B;  1WGC A;  3QWP A;  2OU2 A;  2DIP A;  2ARP F;  5FUV A;  1CGI I;  3OXF A;  4JCV E;  2K9H A;  1Y1B A;  4HGU A; 
#chains in the Genus database with same CATH homology
 5HQ8 A;  2UZ3 A;  3OL0 A;  2B8T A;  1X4S A;  2W0T A;  2SGD I;  2GKV A;  3E2I A;  2YUU A;  2F3C I;  2L7X A;  3PDN A;  1PTR A;  2JZM A;  2N17 A;  2NU3 I;  1CE3 A;  5EX3 A;  2YQP A;  2GKT I;  1CSO I;  3HH2 C;  5EX0 A;  2SGP I;  3RU0 A;  1OYV I;  4GI3 C;  1XBT A;  4UXI A;  4E1P A;  1V1H A;  3TJQ A;  3UGD A;  2P6A C;  2N52 A;  1V1I A;  1PCE A;  1FAR A;  1HDL A;  2BUS A;  2WVJ A;  1Y1C A;  1LR8 A;  2B0U C;  2V53 A;  1R0R I;  4B6D A;  4SGB I;  2NU4 I;  4E1R A;  1SGN I;  2QQE A;  2M5X A;  3UEJ A;  1KMA A;  3OXG A;  2ENZ A;  1YU6 C;  2V1C A;  5FUX A;  1W3S A;  1XX6 A;  2DB6 A;  2KMP A;  5FUW A;  3VDU A;  2ROW A;  3OXL A;  3UEY A;  2CJS C;  1M8C A;  2WCY A;  2V1C C;  2QQ0 A;  4OVO A;  3E59 A;  1KBE A;  1NUB A;  2JA1 A;  1TGS I;  2SGE I;  2KCX A;  2KMR A;  1IW4 A;  1X74 A;  2KMQ A;  2ORW A;  2J87 A;  5JHW C;  4UXH A;  1MT1 A;  1BMO A;  1OMT A;  1OVO A;  2XRC A;  2LEO A;  1M8B A;  2ERW A;  5HI7 A;  1PJU A;  2GKR I;  2FNF X;  3UGL A;  1H0Z A;  1AN1 I;  1TBO A;  2SGF I;  1RFH A;  3VE5 A;  1FAQ A;  2QQD A;  1KBF A;  1SGR I;  2QQC A;  1UUC A;  1Y8F A;  3KY9 A;  1HJA I;  2J9R A;  1TUS A;  1LR7 A;  2JW6 A;  1TOT A;  2LUY A;  5CCL A;  5FUY A;  1SGP I;  1YTP A;  3UFF A;  1OMU A;  2NU2 I;  3GOX A;  1IY5 A;  1TUR A;  3D00 A;  2ODD A;  1IY6 A;  1SGY I;  2VRW B;  1VDD A;  2ORV A;  3MEK A;  1SGQ I;  1TBR R;  3OVO A;  2E5R A;  3FC3 A;  2KMO A;  3UGI A;  5CCM A;  2QPO A;  1BUS A;  1XA6 A;  2GVI A;  5DAE A;  3SGB I;  1FYB A;  1PTQ A;  2ENN A;  2NU0 I;  1SGE I;  1UVF A;  2JYY A;  1SGD I;  1U5K A;  2N1A B;  3B4V C;  1HPT A;  1TBQ R;  1TIH A;  2N71 A;  2E73 A;  2OVO A;  4L9M A;  3BJI A;  1CT2 I;  4A24 A;  3CXL A;  2L8E A;  1UVG A;  1TBN A;  2OD1 A;  2SGQ I;  1R79 A;  3SGQ I;  1CGJ I;  1CT4 I;  1CHO I;  1N13 A;  1W4R A;  3SEK C;  2JXD A;  2NU1 I;  1PPF I;  1CT0 I;  1DS2 I;  3QTL D;  4FKD A;  1DS3 I;  2ELI A;  2A20 A;  3VDP A;  1LR9 A;  4UXJ A;  1Z7K B;  3QWP A;  2DIP A;  2ARP F;  5FUV A;  1CGI I;  3OXF A;  4JCV E;  2K9H A;  1Y1B A;  4HGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...