2ENZA

Solution structure of the second c1 domain from human protein kinase c theta
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
65
structure length
65
Chain Sequence
GSSGSSGKIDMPHRFKVYNYKSPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Protein kinase C theta type
publication title Solution structure of the second C1 domain from human protein kinase C theta
rcsb
source organism Homo sapiens
total genus 6
structure length 65
sequence length 65
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2enzA01
4UXIA 4L9MA 2ORVA 2ORWA 2QQ0A 4UXJA 2QQEA 2UZ3A 5FUXA 1KBEA 1TBOA 5FUVA 1TBNA 1XBTA 2FNFX 1XA6A 2JA1A 1RFHA 2GVIA 1R79A 5FUWA 2E73A 2ENNA 3UEYA 2J9RA 4UXHA 4B6DA 1FAQA 2YUUA 2VRWB 3KY9A 3CXLA 2ROWA 1XX6A 2B8TA 3E2IA 4FKDA 3UGDA 2DB6A 3UEJA 1PTRA 2J87A 5FUYA 2QPOA 1KBFA 1Y8FA 1W4RA 3BJIA 1FARA 2ELIA 1PTQA 3UGIA 3UGLA 3UFFA 2WVJA 2ENZA
chains in the Genus database with same CATH superfamily
3PDNA 4MPIA 4AMLA 5J8CA 1OMUA 1NUBA 1P9ZA 1ULMA 5EX3A 1MJ9A 1H0ZA 1SGQI 2YQPA 2ORVA 2JXDA 2QQEA 5FUXA 2QQDA 1R0RI 1Y1CA 2SGPI 1SGEI 1XBTA 1RFHA 3RU0A 1UUCA 2CWFA 2E73A 1LR9A 3UEYA 2J9RA 1DS3I 1BMOA 1ULNA 2GIVA 3TJQA 4B6DA 1U5KA 3CXLA 5HQ8A 1CHOI 2N17A 2F3CI 4FKDA 3QTLD 2DB6A 3OXGA 2KCXA 1MJAA 1TIHA 3QAHA 1KBFA 3SGBI 4A24A 1M8CA 2JZMA 1IY6A 2SGDI 3UGIA 3FSXA 2M5XA 3GOXA 2ENZA 1HDLA 3FSYA 1CT2I 3OVOA 1FY7A 2ARPF 1BUSA 2UVOA 2LB7A 4L9MA 2KMOA 3OXFA 2V1CA 4UXJA 2UZ3A 1TBOA 5FUVA 2CJSC 1X74A 3TO6A 1WTJA 1TBNA 1W3SA 2NU2I 1FYBA 1NXUA 5CCLA 2Y0MA 1UHAA 1Y1BA 1CT0I 5E3PA 5FUWA 1SGNI 2ENNA 3OXLA 2DKVA 4UXHA 2SGQI 3VDPA 1VDDA 2E5RA 2QQCA 2DIPA 2ROWA 2B8TA 1CSOI 3SGQI 2WGCA 2OU2A 3UEJA 1PTRA 2A20A 2J87A 2W0TA 4HGUA 1Y8FA 2SGFI 3BJIA 1PPFI 1OYVI 2CWHA 1UVGA 2N52A 5JHWC 1S20A 2ELIA 1CGII 1YTPA 3UGLA 1SGYI 1SGPI 3UFFA 2CWGA 2KMQA 5J8FA 2ERWA 4UXIA 2L8EA 1HPTA 1ULKA 3VDUA 2SGEI 1UVFA 1PCEA 2L7XA 2LEOA 2ORWA 2QQ0A 2NU3I 2KMPA 2OD1A 7WGAA 1CE3A 4SGBI 2OVOA 2PQ8A 1TGSI 1LR7A 2FNFX 1XA6A 2WCYA 2XRCA 3E59A 5E3RA 1R79A 4E1PA 3OL0A 4OVOA 2V1CC 3TO7A 2GKRI 2NU4I 1TBQR 1K7TA 1WGTA 5CCMA 2YUUA 1FAQA 1K7VA 1HJAI 3KY9A 5E3QA 2NU1I 1K7UA 1XX6A 4GI3C 1IY5A 2LUYA 4E1RA 3E2IA 2N1AB 2KMRA 3R5AA 3R5DA 1TURA 1MJBA 1WKXA 1P9GA 2QPOA 2RC4A 3SEKC 2X3TA 1Z7KB 1FARA 3R5CA 5EX0A 1CGJI 1MT1A 1DS2I 1PTQA 1TUSA 1V1HA 1X4SA 5HI7A 1WGCA 2GKTI 1N13A 3D00A 2WVJA 3TOAA 3UOEA 2BUSA 1Q9BA 2NU0I 3VE5A 1KMAA 1M8BA 2N71A 2RIJA 1Z2IA 2K9HA 1KBEA 3B4VC 3QWPA 1OMTA 2GKVA 3HH2C 9WGAA 1HEVA 2X52A 1SGDI 3TO9A 2JA1A 3MEKA 2GVIA 1SGRI 1CT4I 1OVOA 2JYYA 2OZUA 1TOTA 2VRWB 4JCVE 1TBRR 3TOBA 3R5BA 1IW4A 3FC3A 3UGDA 5DAEA 2P6AC 2ODDA 2B0UC 5FUYA 4DNCA 1LR8A 1W4RA 1YU6C 2V53A 1AN1I 4WP4A 2JW6A 1PJUA 1V1IA
chains in the Genus database with same CATH topology
3PDNA 1OMUA 1NUBA 5EX3A 1H0ZA 1SGQI 2YQPA 2ORVA 2JXDA 2QQEA 5FUXA 2QQDA 1R0RI 1Y1CA 2SGPI 1SGEI 1XBTA 1RFHA 3RU0A 1UUCA 2E73A 3UEYA 1LR9A 2J9RA 1DS3I 1BMOA 3TJQA 4B6DA 1U5KA 3CXLA 5HQ8A 1CHOI 2N17A 2F3CI 4FKDA 3QTLD 2DB6A 3OXGA 2KCXA 1TIHA 1KBFA 3SGBI 4A24A 1M8CA 2JZMA 1IY6A 2SGDI 3UGIA 2M5XA 3GOXA 2ENZA 1HDLA 1CT2I 3OVOA 2ARPF 1BUSA 4L9MA 2KMOA 3OXFA 2V1CA 4UXJA 2UZ3A 1TBOA 5FUVA 2CJSC 1TBNA 1W3SA 2NU2I 1FYBA 5CCLA 1Y1BA 1CT0I 5FUWA 1SGNI 2ENNA 3OXLA 4UXHA 2SGQI 3VDPA 1VDDA 2E5RA 2QQCA 2DIPA 2ROWA 2B8TA 1CSOI 3SGQI 3UEJA 1PTRA 2A20A 2J87A 2W0TA 4HGUA 1Y8FA 2SGFI 3BJIA 1PPFI 1OYVI 1UVGA 2N52A 5JHWC 2ELIA 1CGII 1YTPA 3UGLA 1SGYI 1SGPI 3UFFA 2KMQA 2ERWA 4UXIA 2L8EA 1HPTA 3VDUA 2SGEI 1UVFA 1PCEA 2L7XA 2LEOA 2ORWA 2QQ0A 2NU3I 2KMPA 2OD1A 1CE3A 4SGBI 2OVOA 1TGSI 1LR7A 2FNFX 1XA6A 2WCYA 2XRCA 3E59A 1R79A 4E1PA 3OL0A 4OVOA 2V1CC 5CCMA 2GKRI 2NU4I 1TBQR 1FAQA 2YUUA 1V1IA 1HJAI 3KY9A 2NU1I 1XX6A 4GI3C 1IY5A 2LUYA 4E1RA 3E2IA 2N1AB 2KMRA 1TURA 2QPOA 3SEKC 1Z7KB 1FARA 5EX0A 5HI7A 1CGJI 1MT1A 1DS2I 1PTQA 1TUSA 1V1HA 1X4SA 2GKTI 3D00A 1N13A 2WVJA 2BUSA 2NU0I 3VE5A 1KMAA 1M8BA 2N71A 2K9HA 1KBEA 3B4VC 3QWPA 1OMTA 2GKVA 3HH2C 1SGDI 2JA1A 3MEKA 2GVIA 1SGRI 1CT4I 1OVOA 2JYYA 2VRWB 1TOTA 4JCVE 1TBRR 1IW4A 3FC3A 3UGDA 5DAEA 2P6AC 2ODDA 2B0UC 5FUYA 1LR8A 1W4RA 1YU6C 2V53A 1AN1I 2JW6A 1PJUA 1X74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UXI A;  4L9M A;  2ORV A;  2ORW A;  2QQ0 A;  4UXJ A;  2QQE A;  2UZ3 A;  5FUX A;  1KBE A;  1TBO A;  5FUV A;  1TBN A;  1XBT A;  2FNF X;  1XA6 A;  2JA1 A;  1RFH A;  2GVI A;  1R79 A;  5FUW A;  2E73 A;  2ENN A;  3UEY A;  2J9R A;  4UXH A;  4B6D A;  1FAQ A;  2YUU A;  2VRW B;  3KY9 A;  3CXL A;  2ROW A;  1XX6 A;  2B8T A;  3E2I A;  4FKD A;  3UGD A;  2DB6 A;  3UEJ A;  1PTR A;  2J87 A;  5FUY A;  2QPO A;  1KBF A;  1Y8F A;  1W4R A;  3BJI A;  1FAR A;  2ELI A;  1PTQ A;  3UGI A;  3UGL A;  3UFF A;  2WVJ A;  2ENZ A; 
#chains in the Genus database with same CATH topology
 3PDN A;  4MPI A;  4AML A;  5J8C A;  1OMU A;  1NUB A;  1P9Z A;  1ULM A;  5EX3 A;  1MJ9 A;  1H0Z A;  1SGQ I;  2YQP A;  2ORV A;  2JXD A;  2QQE A;  5FUX A;  2QQD A;  1R0R I;  1Y1C A;  2SGP I;  1SGE I;  1XBT A;  1RFH A;  3RU0 A;  1UUC A;  2CWF A;  2E73 A;  1LR9 A;  3UEY A;  2J9R A;  1DS3 I;  1BMO A;  1ULN A;  2GIV A;  3TJQ A;  4B6D A;  1U5K A;  3CXL A;  5HQ8 A;  1CHO I;  2N17 A;  2F3C I;  4FKD A;  3QTL D;  2DB6 A;  3OXG A;  2KCX A;  1MJA A;  1TIH A;  3QAH A;  1KBF A;  3SGB I;  4A24 A;  1M8C A;  2JZM A;  1IY6 A;  2SGD I;  3UGI A;  3FSX A;  2M5X A;  3GOX A;  2ENZ A;  1HDL A;  3FSY A;  1CT2 I;  3OVO A;  1FY7 A;  2ARP F;  1BUS A;  2UVO A;  2LB7 A;  4L9M A;  2KMO A;  3OXF A;  2V1C A;  4UXJ A;  2UZ3 A;  1TBO A;  5FUV A;  2CJS C;  1X74 A;  3TO6 A;  1WTJ A;  1TBN A;  1W3S A;  2NU2 I;  1FYB A;  1NXU A;  5CCL A;  2Y0M A;  1UHA A;  1Y1B A;  1CT0 I;  5E3P A;  5FUW A;  1SGN I;  2ENN A;  3OXL A;  2DKV A;  4UXH A;  2SGQ I;  3VDP A;  1VDD A;  2E5R A;  2QQC A;  2DIP A;  2ROW A;  2B8T A;  1CSO I;  3SGQ I;  2WGC A;  2OU2 A;  3UEJ A;  1PTR A;  2A20 A;  2J87 A;  2W0T A;  4HGU A;  1Y8F A;  2SGF I;  3BJI A;  1PPF I;  1OYV I;  2CWH A;  1UVG A;  2N52 A;  5JHW C;  1S20 A;  2ELI A;  1CGI I;  1YTP A;  3UGL A;  1SGY I;  1SGP I;  3UFF A;  2CWG A;  2KMQ A;  5J8F A;  2ERW A;  4UXI A;  2L8E A;  1HPT A;  1ULK A;  3VDU A;  2SGE I;  1UVF A;  1PCE A;  2L7X A;  2LEO A;  2ORW A;  2QQ0 A;  2NU3 I;  2KMP A;  2OD1 A;  7WGA A;  1CE3 A;  4SGB I;  2OVO A;  2PQ8 A;  1TGS I;  1LR7 A;  2FNF X;  1XA6 A;  2WCY A;  2XRC A;  3E59 A;  5E3R A;  1R79 A;  4E1P A;  3OL0 A;  4OVO A;  2V1C C;  3TO7 A;  2GKR I;  2NU4 I;  1TBQ R;  1K7T A;  1WGT A;  5CCM A;  2YUU A;  1FAQ A;  1K7V A;  1HJA I;  3KY9 A;  5E3Q A;  2NU1 I;  1K7U A;  1XX6 A;  4GI3 C;  1IY5 A;  2LUY A;  4E1R A;  3E2I A;  2N1A B;  2KMR A;  3R5A A;  3R5D A;  1TUR A;  1MJB A;  1WKX A;  1P9G A;  2QPO A;  2RC4 A;  3SEK C;  2X3T A;  1Z7K B;  1FAR A;  3R5C A;  5EX0 A;  1CGJ I;  1MT1 A;  1DS2 I;  1PTQ A;  1TUS A;  1V1H A;  1X4S A;  5HI7 A;  1WGC A;  2GKT I;  1N13 A;  3D00 A;  2WVJ A;  3TOA A;  3UOE A;  2BUS A;  1Q9B A;  2NU0 I;  3VE5 A;  1KMA A;  1M8B A;  2N71 A;  2RIJ A;  1Z2I A;  2K9H A;  1KBE A;  3B4V C;  3QWP A;  1OMT A;  2GKV A;  3HH2 C;  9WGA A;  1HEV A;  2X52 A;  1SGD I;  3TO9 A;  2JA1 A;  3MEK A;  2GVI A;  1SGR I;  1CT4 I;  1OVO A;  2JYY A;  2OZU A;  1TOT A;  2VRW B;  4JCV E;  1TBR R;  3TOB A;  3R5B A;  1IW4 A;  3FC3 A;  3UGD A;  5DAE A;  2P6A C;  2ODD A;  2B0U C;  5FUY A;  4DNC A;  1LR8 A;  1W4R A;  1YU6 C;  2V53 A;  1AN1 I;  4WP4 A;  2JW6 A;  1PJU A;  1V1I A; 
#chains in the Genus database with same CATH homology
 3PDN A;  1OMU A;  1NUB A;  5EX3 A;  1H0Z A;  1SGQ I;  2YQP A;  2ORV A;  2JXD A;  2QQE A;  5FUX A;  2QQD A;  1R0R I;  1Y1C A;  2SGP I;  1SGE I;  1XBT A;  1RFH A;  3RU0 A;  1UUC A;  2E73 A;  3UEY A;  1LR9 A;  2J9R A;  1DS3 I;  1BMO A;  3TJQ A;  4B6D A;  1U5K A;  3CXL A;  5HQ8 A;  1CHO I;  2N17 A;  2F3C I;  4FKD A;  3QTL D;  2DB6 A;  3OXG A;  2KCX A;  1TIH A;  1KBF A;  3SGB I;  4A24 A;  1M8C A;  2JZM A;  1IY6 A;  2SGD I;  3UGI A;  2M5X A;  3GOX A;  2ENZ A;  1HDL A;  1CT2 I;  3OVO A;  2ARP F;  1BUS A;  4L9M A;  2KMO A;  3OXF A;  2V1C A;  4UXJ A;  2UZ3 A;  1TBO A;  5FUV A;  2CJS C;  1TBN A;  1W3S A;  2NU2 I;  1FYB A;  5CCL A;  1Y1B A;  1CT0 I;  5FUW A;  1SGN I;  2ENN A;  3OXL A;  4UXH A;  2SGQ I;  3VDP A;  1VDD A;  2E5R A;  2QQC A;  2DIP A;  2ROW A;  2B8T A;  1CSO I;  3SGQ I;  3UEJ A;  1PTR A;  2A20 A;  2J87 A;  2W0T A;  4HGU A;  1Y8F A;  2SGF I;  3BJI A;  1PPF I;  1OYV I;  1UVG A;  2N52 A;  5JHW C;  2ELI A;  1CGI I;  1YTP A;  3UGL A;  1SGY I;  1SGP I;  3UFF A;  2KMQ A;  2ERW A;  4UXI A;  2L8E A;  1HPT A;  3VDU A;  2SGE I;  1UVF A;  1PCE A;  2L7X A;  2LEO A;  2ORW A;  2QQ0 A;  2NU3 I;  2KMP A;  2OD1 A;  1CE3 A;  4SGB I;  2OVO A;  1TGS I;  1LR7 A;  2FNF X;  1XA6 A;  2WCY A;  2XRC A;  3E59 A;  1R79 A;  4E1P A;  3OL0 A;  4OVO A;  2V1C C;  5CCM A;  2GKR I;  2NU4 I;  1TBQ R;  1FAQ A;  2YUU A;  1V1I A;  1HJA I;  3KY9 A;  2NU1 I;  1XX6 A;  4GI3 C;  1IY5 A;  2LUY A;  4E1R A;  3E2I A;  2N1A B;  2KMR A;  1TUR A;  2QPO A;  3SEK C;  1Z7K B;  1FAR A;  5EX0 A;  5HI7 A;  1CGJ I;  1MT1 A;  1DS2 I;  1PTQ A;  1TUS A;  1V1H A;  1X4S A;  2GKT I;  3D00 A;  1N13 A;  2WVJ A;  2BUS A;  2NU0 I;  3VE5 A;  1KMA A;  1M8B A;  2N71 A;  2K9H A;  1KBE A;  3B4V C;  3QWP A;  1OMT A;  2GKV A;  3HH2 C;  1SGD I;  2JA1 A;  3MEK A;  2GVI A;  1SGR I;  1CT4 I;  1OVO A;  2JYY A;  2VRW B;  1TOT A;  4JCV E;  1TBR R;  1IW4 A;  3FC3 A;  3UGD A;  5DAE A;  2P6A C;  2ODD A;  2B0U C;  5FUY A;  1LR8 A;  1W4R A;  1YU6 C;  2V53 A;  1AN1 I;  2JW6 A;  1PJU A;  1X74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...