2ENZA

Solution structure of the second c1 domain from human protein kinase c theta
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
65
structure length
65
Chain Sequence
b'GSSGSSGKIDMPHRFKVYNYKSPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein kinase C theta type
publication title Solution structure of the second C1 domain from human protein kinase C theta
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 6
structure length 65
sequence length 65
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2enzA01
1RFHA 3KY9A 4UXHA 3UGDA 2ROWA 1W4RA 3UGIA 1FAQA 1PTRA 1TBOA 1XA6A 2ORVA 1TBNA 1KBEA 1Y8FA 2YUUA 4UXIA 2DB6A 2B8TA 2VRWB 3UEYA 2QQ0A 3BJIA 3E2IA 2ENZA 2QQEA 4FKDA 2ELIA 2E73A 2UZ3A 2ORWA 3UEJA 1XBTA 2J87A 3CXLA 1FARA 3UFFA 3UGLA 4B6DA 2JA1A 5FUXA 4UXJA 5FUYA 2GVIA 4L9MA 2QPOA 2FNFX 2WVJA 5FUWA 1KBFA 1XX6A 2J9RA 5FUVA 1PTQA 1R79A 2ENNA
chains in the Genus database with same CATH superfamily
2WCYA 3KY9A 2GKRI 4HGUA 1WGTA 3UGDA 3VE5A 3QWPA 2Y0MA 1FAQA 1TBOA 2P6AC 1Y8FA 2GKVA 2CWFA 1UVGA 4GI3C 4OVOA 2KMOA 2VRWB 1VDDA 5EX3A 4DNCA 2OZUA 2V53A 1LR7A 2ODDA 1CE3A 4E1PA 2N52A 2KMRA 2ELIA 1TBQR 2PQ8A 3UEJA 2J87A 1FYBA 1TIHA 1FY7A 1FARA 3R5CA 3FSXA 2CWHA 3FSYA 1K7VA 1SGRI 2DIPA 2JA1A 2GVIA 3OVOA 2SGFI 3UOEA 1Q9BA 1ULKA 2FNFX 3TO9A 5FUWA 1XX6A 1CT0I 2J9RA 2RIJA 1V1HA 1S20A 3OXLA 2ENNA 2OVOA 1AN1I 1RFHA 2KMPA 3VDPA 2ROWA 1W4RA 4AMLA 2CJSC 4WP4A 1NXUA 3UGIA 1ULNA 2ORVA 1TBNA 1IW4A 1UHAA 1HEVA 2YUUA 4UXIA 2GKTI 1LR9A 2B8TA 1SGPI 1TURA 1CT2I 1TGSI 3QTLD 1OMTA 5EX0A 5J8CA 1K7UA 2B0UC 1MT1A 1YTPA 4FKDA 2UZ3A 2ORWA 1HDLA 2DKVA 3R5BA 1WGCA 2NU1I 1ULMA 1CT4I 1OYVI 5E3RA 4B6DA 3B4VC 1NUBA 3MEKA 2W0TA 2K9HA 1W3SA 5FUVA 5FUYA 1KMAA 1R0RI 2KMQA 2SGPI 2OD1A 3E59A 4A24A 1MJAA 1P9ZA 1WTJA 1PTQA 1R79A 2M5XA 2N71A 1PCEA 3D00A 1TUSA 1SGQI 1SGYI 2JYYA 2KCXA 3RU0A 1Z7KB 1N13A 3FC3A 2DB6A 5CCLA 3TO7A 1OVOA 2NU4I 4JCVE 1Y1CA 4MPIA 2X52A 2NU0I 3UEYA 4E1RA 2BUSA 3E2IA 1X74A 2JXDA 2V1CA 2ENZA 3PDNA 2F3CI 3SEKC 1DS3I 2E73A 1M8BA 2LB7A 1XBTA 2SGQI 2SGDI 2X3TA 1LR8A 1OMUA 1PJUA 2ERWA 2N17A 2NU3I 4UXJA 1HPTA 2LUYA 2L8EA 2WVJA 1SGEI 2XRCA 5HQ8A 1Z2IA 3BJIA 5J8FA 2OU2A 1UVFA 1UUCA 2YQPA 3R5AA 4UXHA 5HI7A 3TOBA 3OL0A 7WGAA 1V1IA 1IY5A 1CGII 1CSOI 1PTRA 1PPFI 1XA6A 1HJAI 1KBEA 1Y1BA 5E3QA 5E3PA 3TO6A 3VDUA 1H0ZA 1MJBA 1K7TA 2JW6A 1CGJI 1CHOI 3QAHA 2GIVA 3SGBI 1MJ9A 1BUSA 2QQ0A 2CWGA 2QQEA 1DS2I 2SGEI 3SGQI 5DAEA 2JZMA 3OXFA 2WGCA 3OXGA 2LEOA 1M8CA 2E5RA 3TJQA 1U5KA 1WKXA 3GOXA 1IY6A 2N1AB 2V1CC 1TBRR 3CXLA 2RC4A 3UGLA 2L7XA 3UFFA 1BMOA 1TOTA 3HH2C 5FUXA 9WGAA 2NU2I 2A20A 1YU6C 4L9MA 2QPOA 3R5DA 4SGBI 1SGDI 1KBFA 2QQCA 2QQDA 1X4SA 3TOAA 5CCMA 2ARPF 1P9GA 1SGNI 2UVOA 5JHWC
chains in the Genus database with same CATH topology
2WCYA 3KY9A 2GKRI 4HGUA 3UGDA 3VE5A 3QWPA 1FAQA 1TBOA 2P6AC 1Y8FA 2GKVA 4GI3C 1UVGA 4OVOA 2KMOA 2VRWB 1VDDA 5EX3A 2V53A 1LR7A 2ODDA 1CE3A 4E1PA 2N52A 2KMRA 2ELIA 1TBQR 3UEJA 2J87A 1FYBA 1TIHA 1FARA 1SGRI 2DIPA 2JA1A 2GVIA 3OVOA 2SGFI 2FNFX 5FUWA 1XX6A 1CT0I 2J9RA 1V1HA 3OXLA 2ENNA 2OVOA 1AN1I 1RFHA 2KMPA 3VDPA 2ROWA 1W4RA 2CJSC 3UGIA 2ORVA 1TBNA 1IW4A 2YUUA 4UXIA 2GKTI 1LR9A 2B8TA 1SGPI 1TURA 1CT2I 1TGSI 3QTLD 1OMTA 5EX0A 2B0UC 1MT1A 1YTPA 4FKDA 2UZ3A 2ORWA 1HDLA 2NU1I 1CT4I 1OYVI 4B6DA 3B4VC 1NUBA 3MEKA 2W0TA 2K9HA 1W3SA 5FUVA 5FUYA 1KMAA 1R0RI 2KMQA 2SGPI 2OD1A 3E59A 4A24A 1PTQA 1R79A 2M5XA 2N71A 1PCEA 3D00A 1TUSA 1SGQI 1SGYI 2JYYA 2KCXA 3RU0A 1Z7KB 1N13A 3FC3A 2DB6A 5CCLA 1OVOA 2NU4I 4JCVE 1Y1CA 2NU0I 3UEYA 4E1RA 2BUSA 3E2IA 1X74A 2JXDA 2V1CA 2ENZA 3PDNA 2F3CI 3SEKC 2E73A 1M8BA 2SGQI 1XBTA 2SGDI 1LR8A 1OMUA 1PJUA 2ERWA 2N17A 2NU3I 4UXJA 1HPTA 2LUYA 2L8EA 2WVJA 1SGEI 2XRCA 5HQ8A 3BJIA 2YQPA 1UVFA 1UUCA 4UXHA 5HI7A 3OL0A 1V1IA 1IY5A 1CGII 1CSOI 1PTRA 1PPFI 1XA6A 1HJAI 1KBEA 1Y1BA 3VDUA 1H0ZA 2JW6A 1CGJI 1CHOI 3SGBI 1BUSA 2QQ0A 2QQEA 1DS2I 2SGEI 3SGQI 5DAEA 2JZMA 3OXFA 3OXGA 3GOXA 2LEOA 1M8CA 2E5RA 3TJQA 1U5KA 1IY6A 2N1AB 2V1CC 1TBRR 3CXLA 3UGLA 3UFFA 2L7XA 1BMOA 1TOTA 3HH2C 5FUXA 2NU2I 2A20A 1YU6C 4L9MA 2QPOA 4SGBI 1SGDI 1KBFA 2QQCA 2QQDA 1X4SA 5CCMA 2ARPF 1DS3I 1SGNI 5JHWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RFH A;  3KY9 A;  4UXH A;  3UGD A;  2ROW A;  1W4R A;  3UGI A;  1FAQ A;  1PTR A;  1TBO A;  1XA6 A;  2ORV A;  1TBN A;  1KBE A;  1Y8F A;  2YUU A;  4UXI A;  2DB6 A;  2B8T A;  2VRW B;  3UEY A;  2QQ0 A;  3BJI A;  3E2I A;  2ENZ A;  2QQE A;  4FKD A;  2ELI A;  2E73 A;  2UZ3 A;  2ORW A;  3UEJ A;  1XBT A;  2J87 A;  3CXL A;  1FAR A;  3UFF A;  3UGL A;  4B6D A;  2JA1 A;  5FUX A;  4UXJ A;  5FUY A;  2GVI A;  4L9M A;  2QPO A;  2FNF X;  2WVJ A;  5FUW A;  1KBF A;  1XX6 A;  2J9R A;  5FUV A;  1PTQ A;  1R79 A;  2ENN A; 
#chains in the Genus database with same CATH topology
 2WCY A;  3KY9 A;  2GKR I;  4HGU A;  1WGT A;  3UGD A;  3VE5 A;  3QWP A;  2Y0M A;  1FAQ A;  1TBO A;  2P6A C;  1Y8F A;  2GKV A;  2CWF A;  1UVG A;  4GI3 C;  4OVO A;  2KMO A;  2VRW B;  1VDD A;  5EX3 A;  4DNC A;  2OZU A;  2V53 A;  1LR7 A;  2ODD A;  1CE3 A;  4E1P A;  2N52 A;  2KMR A;  2ELI A;  1TBQ R;  2PQ8 A;  3UEJ A;  2J87 A;  1FYB A;  1TIH A;  1FY7 A;  1FAR A;  3R5C A;  3FSX A;  2CWH A;  3FSY A;  1K7V A;  1SGR I;  2DIP A;  2JA1 A;  2GVI A;  3OVO A;  2SGF I;  3UOE A;  1Q9B A;  1ULK A;  2FNF X;  3TO9 A;  5FUW A;  1XX6 A;  1CT0 I;  2J9R A;  2RIJ A;  1V1H A;  1S20 A;  3OXL A;  2ENN A;  2OVO A;  1AN1 I;  1RFH A;  2KMP A;  3VDP A;  2ROW A;  1W4R A;  4AML A;  2CJS C;  4WP4 A;  1NXU A;  3UGI A;  1ULN A;  2ORV A;  1TBN A;  1IW4 A;  1UHA A;  1HEV A;  2YUU A;  4UXI A;  2GKT I;  1LR9 A;  2B8T A;  1SGP I;  1TUR A;  1CT2 I;  1TGS I;  3QTL D;  1OMT A;  5EX0 A;  5J8C A;  1K7U A;  2B0U C;  1MT1 A;  1YTP A;  4FKD A;  2UZ3 A;  2ORW A;  1HDL A;  2DKV A;  3R5B A;  1WGC A;  2NU1 I;  1ULM A;  1CT4 I;  1OYV I;  5E3R A;  4B6D A;  3B4V C;  1NUB A;  3MEK A;  2W0T A;  2K9H A;  1W3S A;  5FUV A;  5FUY A;  1KMA A;  1R0R I;  2KMQ A;  2SGP I;  2OD1 A;  3E59 A;  4A24 A;  1MJA A;  1P9Z A;  1WTJ A;  1PTQ A;  1R79 A;  2M5X A;  2N71 A;  1PCE A;  3D00 A;  1TUS A;  1SGQ I;  1SGY I;  2JYY A;  2KCX A;  3RU0 A;  1Z7K B;  1N13 A;  3FC3 A;  2DB6 A;  5CCL A;  3TO7 A;  1OVO A;  2NU4 I;  4JCV E;  1Y1C A;  4MPI A;  2X52 A;  2NU0 I;  3UEY A;  4E1R A;  2BUS A;  3E2I A;  1X74 A;  2JXD A;  2V1C A;  2ENZ A;  3PDN A;  2F3C I;  3SEK C;  1DS3 I;  2E73 A;  1M8B A;  2LB7 A;  1XBT A;  2SGQ I;  2SGD I;  2X3T A;  1LR8 A;  1OMU A;  1PJU A;  2ERW A;  2N17 A;  2NU3 I;  4UXJ A;  1HPT A;  2LUY A;  2L8E A;  2WVJ A;  1SGE I;  2XRC A;  5HQ8 A;  1Z2I A;  3BJI A;  5J8F A;  2OU2 A;  1UVF A;  1UUC A;  2YQP A;  3R5A A;  4UXH A;  5HI7 A;  3TOB A;  3OL0 A;  7WGA A;  1V1I A;  1IY5 A;  1CGI I;  1CSO I;  1PTR A;  1PPF I;  1XA6 A;  1HJA I;  1KBE A;  1Y1B A;  5E3Q A;  5E3P A;  3TO6 A;  3VDU A;  1H0Z A;  1MJB A;  1K7T A;  2JW6 A;  1CGJ I;  1CHO I;  3QAH A;  2GIV A;  3SGB I;  1MJ9 A;  1BUS A;  2QQ0 A;  2CWG A;  2QQE A;  1DS2 I;  2SGE I;  3SGQ I;  5DAE A;  2JZM A;  3OXF A;  2WGC A;  3OXG A;  2LEO A;  1M8C A;  2E5R A;  3TJQ A;  1U5K A;  1WKX A;  3GOX A;  1IY6 A;  2N1A B;  2V1C C;  1TBR R;  3CXL A;  2RC4 A;  3UGL A;  2L7X A;  3UFF A;  1BMO A;  1TOT A;  3HH2 C;  5FUX A;  9WGA A;  2NU2 I;  2A20 A;  1YU6 C;  4L9M A;  2QPO A;  3R5D A;  4SGB I;  1SGD I;  1KBF A;  2QQC A;  2QQD A;  1X4S A;  3TOA A;  5CCM A;  2ARP F;  1P9G A;  1SGN I;  2UVO A;  5JHW C; 
#chains in the Genus database with same CATH homology
 2WCY A;  3KY9 A;  2GKR I;  4HGU A;  3UGD A;  3VE5 A;  3QWP A;  1FAQ A;  1TBO A;  2P6A C;  1Y8F A;  2GKV A;  4GI3 C;  1UVG A;  4OVO A;  2KMO A;  2VRW B;  1VDD A;  5EX3 A;  2V53 A;  1LR7 A;  2ODD A;  1CE3 A;  4E1P A;  2N52 A;  2KMR A;  2ELI A;  1TBQ R;  3UEJ A;  2J87 A;  1FYB A;  1TIH A;  1FAR A;  1SGR I;  2DIP A;  2JA1 A;  2GVI A;  3OVO A;  2SGF I;  2FNF X;  5FUW A;  1XX6 A;  1CT0 I;  2J9R A;  1V1H A;  3OXL A;  2ENN A;  2OVO A;  1AN1 I;  1RFH A;  2KMP A;  3VDP A;  2ROW A;  1W4R A;  2CJS C;  3UGI A;  2ORV A;  1TBN A;  1IW4 A;  2YUU A;  4UXI A;  2GKT I;  1LR9 A;  2B8T A;  1SGP I;  1TUR A;  1CT2 I;  1TGS I;  3QTL D;  1OMT A;  5EX0 A;  2B0U C;  1MT1 A;  1YTP A;  4FKD A;  2UZ3 A;  2ORW A;  1HDL A;  2NU1 I;  1CT4 I;  1OYV I;  4B6D A;  3B4V C;  1NUB A;  3MEK A;  2W0T A;  2K9H A;  1W3S A;  5FUV A;  5FUY A;  1KMA A;  1R0R I;  2KMQ A;  2SGP I;  2OD1 A;  3E59 A;  4A24 A;  1PTQ A;  1R79 A;  2M5X A;  2N71 A;  1PCE A;  3D00 A;  1TUS A;  1SGQ I;  1SGY I;  2JYY A;  2KCX A;  3RU0 A;  1Z7K B;  1N13 A;  3FC3 A;  2DB6 A;  5CCL A;  1OVO A;  2NU4 I;  4JCV E;  1Y1C A;  2NU0 I;  3UEY A;  4E1R A;  2BUS A;  3E2I A;  1X74 A;  2JXD A;  2V1C A;  2ENZ A;  3PDN A;  2F3C I;  3SEK C;  2E73 A;  1M8B A;  2SGQ I;  1XBT A;  2SGD I;  1LR8 A;  1OMU A;  1PJU A;  2ERW A;  2N17 A;  2NU3 I;  4UXJ A;  1HPT A;  2LUY A;  2L8E A;  2WVJ A;  1SGE I;  2XRC A;  5HQ8 A;  3BJI A;  2YQP A;  1UVF A;  1UUC A;  4UXH A;  5HI7 A;  3OL0 A;  1V1I A;  1IY5 A;  1CGI I;  1CSO I;  1PTR A;  1PPF I;  1XA6 A;  1HJA I;  1KBE A;  1Y1B A;  3VDU A;  1H0Z A;  2JW6 A;  1CGJ I;  1CHO I;  3SGB I;  1BUS A;  2QQ0 A;  2QQE A;  1DS2 I;  2SGE I;  3SGQ I;  5DAE A;  2JZM A;  3OXF A;  3OXG A;  3GOX A;  2LEO A;  1M8C A;  2E5R A;  3TJQ A;  1U5K A;  1IY6 A;  2N1A B;  2V1C C;  1TBR R;  3CXL A;  3UGL A;  3UFF A;  2L7X A;  1BMO A;  1TOT A;  3HH2 C;  5FUX A;  2NU2 I;  2A20 A;  1YU6 C;  4L9M A;  2QPO A;  4SGB I;  1SGD I;  1KBF A;  2QQC A;  2QQD A;  1X4S A;  5CCM A;  2ARP F;  1DS3 I;  1SGN I;  5JHW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...