2ENZA

Solution structure of the second c1 domain from human protein kinase c theta
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
65
structure length
65
Chain Sequence
GSSGSSGKIDMPHRFKVYNYKSPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein kinase C theta type
publication title Solution structure of the second C1 domain from human protein kinase C theta
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 6
structure length 65
sequence length 65
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2enzA01
3UGIA 1KBEA 1XX6A 4FKDA 5FUVA 4UXJA 4B6DA 2E73A 2J87A 1TBNA 1FARA 1RFHA 2ORVA 1R79A 2JA1A 1PTQA 5FUWA 1XA6A 1TBOA 1Y8FA 1XBTA 2ELIA 2FNFX 3KY9A 2QQ0A 2UZ3A 3BJIA 2VRWB 2YUUA 2B8TA 4UXHA 1W4RA 2GVIA 5FUXA 2WVJA 2ORWA 2DB6A 2ENNA 1KBFA 3UEJA 3UFFA 2ROWA 3CXLA 1PTRA 5FUYA 1FAQA 2J9RA 3E2IA 3UGDA 3UGLA 3UEYA 4L9MA 4UXIA 2QPOA 2ENZA 2QQEA
chains in the Genus database with same CATH superfamily
3UGIA 1KBEA 1IY6A 2GKTI 2NU3I 1TURA 3RU0A 1TOTA 1LR7A 1OMUA 5CCMA 2X52A 1DS3I 3OVOA 4GI3C 2V53A 1WTJA 1XA6A 2CJSC 1HJAI 2KMQA 1Y8FA 1XBTA 2GIVA 3VDUA 1FYBA 1HEVA 4SGBI 1PCEA 3HH2C 3GOXA 3R5BA 1UVFA 4OVOA 2VRWB 3D00A 4HGUA 2F3CI 2V1CA 2SGDI 3VDPA 1W4RA 2E5RA 1X4SA 3UOEA 1BUSA 2WVJA 5E3RA 2DB6A 1V1IA 5J8CA 5JHWC 1FY7A 2NU0I 3UEJA 1WGTA 1WKXA 2BUSA 3TOBA 3R5CA 2CWFA 4WP4A 2LUYA 2J9RA 1W3SA 3UGLA 2L8EA 4L9MA 3UEYA 2QQEA 1CE3A 1UHAA 3TO6A 1K7VA 2N1AB 7WGAA 1TUSA 4FKDA 2SGFI 5EX3A 1PJUA 2E73A 1TBRR 1CHOI 2OD1A 1TBQR 2CWHA 1RFHA 2NU2I 2OZUA 2WCYA 3SEKC 1H0ZA 2JA1A 1OMTA 3SGQI 2N52A 1PTQA 1V1HA 3QAHA 3B4VC 1MJAA 4E1RA 2FNFX 1MJ9A 4A24A 2UZ3A 3OL0A 1ULMA 3E59A 1LR9A 1YU6C 2GKVA 5HQ8A 2YUUA 2OU2A 2GKRI 5FUXA 2B0UC 1UUCA 3TJQA 2V1CC 1NUBA 1SGEI 1IW4A 2ENNA 2OVOA 2SGPI 3UFFA 1MJBA 1CT4I 1AN1I 2DIPA 1PTRA 1NXUA 2KMRA 3E2IA 2UVOA 4MPIA 2NU4I 5DAEA 1SGDI 3QWPA 3VE5A 2JZMA 1IY5A 2PQ8A 5FUVA 4B6DA 3FC3A 2N17A 2J87A 1TBNA 3OXFA 2ORVA 1CSOI 1R79A 2A20A 2N71A 2YQPA 5HI7A 2K9HA 5FUWA 1PPFI 1TIHA 1S20A 3KY9A 2Y0MA 1MT1A 1VDDA 3MEKA 1SGYI 2KMOA 2M5XA 2QQCA 2RIJA 4DNCA 1P9GA 2SGEI 2B8TA 1K7UA 1CGII 4UXHA 5E3PA 2ERWA 2ORWA 1SGPI 2KMPA 2ARPF 1KBFA 1SGNI 1BMOA 2SGQI 3OXLA 2L7XA 1HPTA 3CXLA 1K7TA 2LB7A 3SGBI 4AMLA 3UGDA 3PDNA 5FUYA 2QPOA 3QTLD 1M8CA 5E3QA 1XX6A 2KCXA 2ODDA 3FSXA 4UXJA 1SGRI 2X3TA 1ULNA 2RC4A 1ULKA 1FARA 1Z7KB 2JXDA 2XRCA 1Y1BA 3FSYA 1M8BA 1CGJI 5EX0A 3TO7A 1DS2I 1Q9BA 1TBOA 1U5KA 9WGAA 1CT2I 2ELIA 3TO9A 1N13A 1OVOA 2QQ0A 2QQDA 1HDLA 2NU1I 1R0RI 2P6AC 1KMAA 1UVGA 2DKVA 3BJIA 1X74A 3R5DA 2GVIA 5J8FA 2W0TA 1SGQI 3OXGA 1TGSI 2CWGA 2LEOA 5CCLA 1Z2IA 4E1PA 1CT0I 1LR8A 1OYVI 1P9ZA 1WGCA 1YTPA 2JW6A 2JYYA 2ROWA 2WGCA 1FAQA 4JCVE 4UXIA 1Y1CA 2ENZA 3R5AA 3TOAA
chains in the Genus database with same CATH topology
3UGIA 1KBEA 1IY6A 2GKTI 2NU3I 1TURA 3RU0A 1TOTA 1LR7A 1OMUA 5CCMA 1DS3I 3OVOA 4GI3C 2V53A 1XA6A 2CJSC 2KMQA 1HJAI 3VDUA 1Y8FA 1XBTA 1FYBA 4SGBI 1PCEA 3HH2C 3GOXA 1UVFA 4OVOA 2VRWB 3D00A 4HGUA 2F3CI 2V1CA 2SGDI 3VDPA 1W4RA 2E5RA 1X4SA 1BUSA 2WVJA 2DB6A 1V1IA 5JHWC 2NU0I 3UEJA 2BUSA 2LUYA 2J9RA 1W3SA 3UGLA 2L8EA 4L9MA 3UEYA 2QQEA 1CE3A 2N1AB 1TUSA 4FKDA 2SGFI 5EX3A 1PJUA 2E73A 1TBRR 1CHOI 2OD1A 1TBQR 3SEKC 1RFHA 2NU2I 2WCYA 1H0ZA 2JA1A 1OMTA 3SGQI 2N52A 1PTQA 1V1HA 3B4VC 4E1RA 2FNFX 4A24A 2UZ3A 3OL0A 3E59A 1LR9A 1YU6C 2GKVA 5HQ8A 2YUUA 2GKRI 5FUXA 2B0UC 1UUCA 3TJQA 2V1CC 1NUBA 1SGEI 1IW4A 2ENNA 2OVOA 2SGPI 3UFFA 1CT4I 1AN1I 2DIPA 1PTRA 2KMRA 3E2IA 5DAEA 2NU4I 1SGDI 3QWPA 3VE5A 2JZMA 1IY5A 5FUVA 4B6DA 3FC3A 2N17A 2J87A 1TBNA 3OXFA 2ORVA 1CSOI 1R79A 2A20A 2N71A 2YQPA 5HI7A 2K9HA 5FUWA 1PPFI 1TIHA 3KY9A 3MEKA 1MT1A 1VDDA 1SGYI 2KMOA 2M5XA 2QQCA 2SGEI 2B8TA 4UXHA 1CGII 2ERWA 2ORWA 1SGPI 2KMPA 2ARPF 1KBFA 1SGNI 1BMOA 2SGQI 3OXLA 2L7XA 1HPTA 3CXLA 3SGBI 3UGDA 3PDNA 5FUYA 2QPOA 3QTLD 1M8CA 1XX6A 2KCXA 2ODDA 4UXJA 1SGRI 1Z7KB 1FARA 2JXDA 2XRCA 1Y1BA 1M8BA 1CGJI 5EX0A 1DS2I 1U5KA 1TBOA 1CT2I 2ELIA 1N13A 1OVOA 2QQ0A 2QQDA 1HDLA 2NU1I 1R0RI 2P6AC 1KMAA 1UVGA 3BJIA 1X74A 2GVIA 2W0TA 1SGQI 3OXGA 1TGSI 2LEOA 5CCLA 4E1PA 1CT0I 1LR8A 1OYVI 1YTPA 2JW6A 2JYYA 2ROWA 1FAQA 4JCVE 4UXIA 1Y1CA 2ENZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UGI A;  1KBE A;  1XX6 A;  4FKD A;  5FUV A;  4UXJ A;  4B6D A;  2E73 A;  2J87 A;  1TBN A;  1FAR A;  1RFH A;  2ORV A;  1R79 A;  2JA1 A;  1PTQ A;  5FUW A;  1XA6 A;  1TBO A;  1Y8F A;  1XBT A;  2ELI A;  2FNF X;  3KY9 A;  2QQ0 A;  2UZ3 A;  3BJI A;  2VRW B;  2YUU A;  2B8T A;  4UXH A;  1W4R A;  2GVI A;  5FUX A;  2WVJ A;  2ORW A;  2DB6 A;  2ENN A;  1KBF A;  3UEJ A;  3UFF A;  2ROW A;  3CXL A;  1PTR A;  5FUY A;  1FAQ A;  2J9R A;  3E2I A;  3UGD A;  3UGL A;  3UEY A;  4L9M A;  4UXI A;  2QPO A;  2ENZ A;  2QQE A; 
#chains in the Genus database with same CATH topology
 3UGI A;  1KBE A;  1IY6 A;  2GKT I;  2NU3 I;  1TUR A;  3RU0 A;  1TOT A;  1LR7 A;  1OMU A;  5CCM A;  2X52 A;  1DS3 I;  3OVO A;  4GI3 C;  2V53 A;  1WTJ A;  1XA6 A;  2CJS C;  1HJA I;  2KMQ A;  1Y8F A;  1XBT A;  2GIV A;  3VDU A;  1FYB A;  1HEV A;  4SGB I;  1PCE A;  3HH2 C;  3GOX A;  3R5B A;  1UVF A;  4OVO A;  2VRW B;  3D00 A;  4HGU A;  2F3C I;  2V1C A;  2SGD I;  3VDP A;  1W4R A;  2E5R A;  1X4S A;  3UOE A;  1BUS A;  2WVJ A;  5E3R A;  2DB6 A;  1V1I A;  5J8C A;  5JHW C;  1FY7 A;  2NU0 I;  3UEJ A;  1WGT A;  1WKX A;  2BUS A;  3TOB A;  3R5C A;  2CWF A;  4WP4 A;  2LUY A;  2J9R A;  1W3S A;  3UGL A;  2L8E A;  4L9M A;  3UEY A;  2QQE A;  1CE3 A;  1UHA A;  3TO6 A;  1K7V A;  2N1A B;  7WGA A;  1TUS A;  4FKD A;  2SGF I;  5EX3 A;  1PJU A;  2E73 A;  1TBR R;  1CHO I;  2OD1 A;  1TBQ R;  2CWH A;  1RFH A;  2NU2 I;  2OZU A;  2WCY A;  3SEK C;  1H0Z A;  2JA1 A;  1OMT A;  3SGQ I;  2N52 A;  1PTQ A;  1V1H A;  3QAH A;  3B4V C;  1MJA A;  4E1R A;  2FNF X;  1MJ9 A;  4A24 A;  2UZ3 A;  3OL0 A;  1ULM A;  3E59 A;  1LR9 A;  1YU6 C;  2GKV A;  5HQ8 A;  2YUU A;  2OU2 A;  2GKR I;  5FUX A;  2B0U C;  1UUC A;  3TJQ A;  2V1C C;  1NUB A;  1SGE I;  1IW4 A;  2ENN A;  2OVO A;  2SGP I;  3UFF A;  1MJB A;  1CT4 I;  1AN1 I;  2DIP A;  1PTR A;  1NXU A;  2KMR A;  3E2I A;  2UVO A;  4MPI A;  2NU4 I;  5DAE A;  1SGD I;  3QWP A;  3VE5 A;  2JZM A;  1IY5 A;  2PQ8 A;  5FUV A;  4B6D A;  3FC3 A;  2N17 A;  2J87 A;  1TBN A;  3OXF A;  2ORV A;  1CSO I;  1R79 A;  2A20 A;  2N71 A;  2YQP A;  5HI7 A;  2K9H A;  5FUW A;  1PPF I;  1TIH A;  1S20 A;  3KY9 A;  2Y0M A;  1MT1 A;  1VDD A;  3MEK A;  1SGY I;  2KMO A;  2M5X A;  2QQC A;  2RIJ A;  4DNC A;  1P9G A;  2SGE I;  2B8T A;  1K7U A;  1CGI I;  4UXH A;  5E3P A;  2ERW A;  2ORW A;  1SGP I;  2KMP A;  2ARP F;  1KBF A;  1SGN I;  1BMO A;  2SGQ I;  3OXL A;  2L7X A;  1HPT A;  3CXL A;  1K7T A;  2LB7 A;  3SGB I;  4AML A;  3UGD A;  3PDN A;  5FUY A;  2QPO A;  3QTL D;  1M8C A;  5E3Q A;  1XX6 A;  2KCX A;  2ODD A;  3FSX A;  4UXJ A;  1SGR I;  2X3T A;  1ULN A;  2RC4 A;  1ULK A;  1FAR A;  1Z7K B;  2JXD A;  2XRC A;  1Y1B A;  3FSY A;  1M8B A;  1CGJ I;  5EX0 A;  3TO7 A;  1DS2 I;  1Q9B A;  1TBO A;  1U5K A;  9WGA A;  1CT2 I;  2ELI A;  3TO9 A;  1N13 A;  1OVO A;  2QQ0 A;  2QQD A;  1HDL A;  2NU1 I;  1R0R I;  2P6A C;  1KMA A;  1UVG A;  2DKV A;  3BJI A;  1X74 A;  3R5D A;  2GVI A;  5J8F A;  2W0T A;  1SGQ I;  3OXG A;  1TGS I;  2CWG A;  2LEO A;  5CCL A;  1Z2I A;  4E1P A;  1CT0 I;  1LR8 A;  1OYV I;  1P9Z A;  1WGC A;  1YTP A;  2JW6 A;  2JYY A;  2ROW A;  2WGC A;  1FAQ A;  4JCV E;  4UXI A;  1Y1C A;  2ENZ A;  3R5A A;  3TOA A; 
#chains in the Genus database with same CATH homology
 3UGI A;  1KBE A;  1IY6 A;  2GKT I;  2NU3 I;  1TUR A;  3RU0 A;  1TOT A;  1LR7 A;  1OMU A;  5CCM A;  1DS3 I;  3OVO A;  4GI3 C;  2V53 A;  1XA6 A;  2CJS C;  2KMQ A;  1HJA I;  3VDU A;  1Y8F A;  1XBT A;  1FYB A;  4SGB I;  1PCE A;  3HH2 C;  3GOX A;  1UVF A;  4OVO A;  2VRW B;  3D00 A;  4HGU A;  2F3C I;  2V1C A;  2SGD I;  3VDP A;  1W4R A;  2E5R A;  1X4S A;  1BUS A;  2WVJ A;  2DB6 A;  1V1I A;  5JHW C;  2NU0 I;  3UEJ A;  2BUS A;  2LUY A;  2J9R A;  1W3S A;  3UGL A;  2L8E A;  4L9M A;  3UEY A;  2QQE A;  1CE3 A;  2N1A B;  1TUS A;  4FKD A;  2SGF I;  5EX3 A;  1PJU A;  2E73 A;  1TBR R;  1CHO I;  2OD1 A;  1TBQ R;  3SEK C;  1RFH A;  2NU2 I;  2WCY A;  1H0Z A;  2JA1 A;  1OMT A;  3SGQ I;  2N52 A;  1PTQ A;  1V1H A;  3B4V C;  4E1R A;  2FNF X;  4A24 A;  2UZ3 A;  3OL0 A;  3E59 A;  1LR9 A;  1YU6 C;  2GKV A;  5HQ8 A;  2YUU A;  2GKR I;  5FUX A;  2B0U C;  1UUC A;  3TJQ A;  2V1C C;  1NUB A;  1SGE I;  1IW4 A;  2ENN A;  2OVO A;  2SGP I;  3UFF A;  1CT4 I;  1AN1 I;  2DIP A;  1PTR A;  2KMR A;  3E2I A;  5DAE A;  2NU4 I;  1SGD I;  3QWP A;  3VE5 A;  2JZM A;  1IY5 A;  5FUV A;  4B6D A;  3FC3 A;  2N17 A;  2J87 A;  1TBN A;  3OXF A;  2ORV A;  1CSO I;  1R79 A;  2A20 A;  2N71 A;  2YQP A;  5HI7 A;  2K9H A;  5FUW A;  1PPF I;  1TIH A;  3KY9 A;  3MEK A;  1MT1 A;  1VDD A;  1SGY I;  2KMO A;  2M5X A;  2QQC A;  2SGE I;  2B8T A;  4UXH A;  1CGI I;  2ERW A;  2ORW A;  1SGP I;  2KMP A;  2ARP F;  1KBF A;  1SGN I;  1BMO A;  2SGQ I;  3OXL A;  2L7X A;  1HPT A;  3CXL A;  3SGB I;  3UGD A;  3PDN A;  5FUY A;  2QPO A;  3QTL D;  1M8C A;  1XX6 A;  2KCX A;  2ODD A;  4UXJ A;  1SGR I;  1Z7K B;  1FAR A;  2JXD A;  2XRC A;  1Y1B A;  1M8B A;  1CGJ I;  5EX0 A;  1DS2 I;  1U5K A;  1TBO A;  1CT2 I;  2ELI A;  1N13 A;  1OVO A;  2QQ0 A;  2QQD A;  1HDL A;  2NU1 I;  1R0R I;  2P6A C;  1KMA A;  1UVG A;  3BJI A;  1X74 A;  2GVI A;  2W0T A;  1SGQ I;  3OXG A;  1TGS I;  2LEO A;  5CCL A;  4E1P A;  1CT0 I;  1LR8 A;  1OYV I;  1YTP A;  2JW6 A;  2JYY A;  2ROW A;  1FAQ A;  4JCV E;  4UXI A;  1Y1C A;  2ENZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...