2ELIA

Solution structure of the second phorbol esters/diacylglycerol binding domain of human protein kinase c alpha type
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
85
structure length
85
Chain Sequence
GSSGSSGGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase C alpha type
publication title Solution structure of the second Phorbol esters/diacylglycerol binding domain of human Protein kinase C alpha type
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 4
structure length 85
sequence length 85
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2007-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2eliA01
3UEYA 3UGIA 1XBTA 1KBFA 2J87A 1XA6A 5FUWA 2UZ3A 2QPOA 2JA1A 1PTRA 2ELIA 4UXHA 1FARA 2ENNA 2YUUA 1Y8FA 4UXIA 2ENZA 2ORWA 1PTQA 2E73A 5FUXA 5FUYA 1TBOA 1W4RA 1XX6A 2B8TA 2J9RA 3KY9A 4UXJA 5FUVA 3CXLA 4FKDA 3BJIA 3UFFA 2QQ0A 1TBNA 1RFHA 2FNFX 2DB6A 4B6DA 3UEJA 2VRWB 2QQEA 2WVJA 1KBEA 3E2IA 3UGDA 2ROWA 2ORVA 4L9MA 1R79A 1FAQA 3UGLA 2GVIA
chains in the Genus database with same CATH superfamily
1SGRI 3UEYA 4E1PA 1AN1I 1ULNA 1CT2I 1MJ9A 2KMRA 7WGAA 1M8BA 2LUYA 1KBFA 1YTPA 3R5BA 2M5XA 4UXHA 3OXGA 3E59A 2KCXA 2YUUA 1SGPI 2ENZA 2L8EA 2NU0I 5EX0A 1TBOA 1UVGA 3TOAA 2WGCA 2BUSA 1N13A 2E5RA 4HGUA 2PQ8A 1M8CA 5HI7A 1LR8A 2ORVA 4DNCA 2JXDA 3FSYA 5CCMA 1R0RI 1SGEI 2CWHA 3VE5A 1MJBA 1TBNA 2OU2A 2LEOA 4B6DA 2VRWB 3OXFA 1FYBA 1V1IA 2V1CA 2SGFI 4E1RA 3SEKC 1NUBA 4L9MA 1UUCA 2DIPA 2L7XA 2ROWA 3TO9A 3TOBA 2GVIA 1PPFI 2N17A 2ODDA 1SGYI 2RC4A 2JW6A 3B4VC 3UGIA 1CHOI 2J87A 1Z7KB 3BJIA 1IY6A 1TBQR 1UVFA 1VDDA 2ELIA 3D00A 1FARA 2ENNA 1OVOA 3UOEA 4UXIA 2N1AB 3TJQA 2B0UC 9WGAA 1HDLA 2CJSC 5FUYA 2N71A 1H0ZA 2B8TA 1W4RA 1XX6A 2K9HA 3KY9A 1ULKA 2NU3I 5FUVA 2X3TA 2OZUA 2NU1I 2JZMA 4FKDA 3RU0A 1CGJI 3TO7A 1WKXA 1TOTA 2SGEI 3UFFA 2QQDA 2F3CI 3PDNA 4OVOA 1WGTA 2OD1A 1K7TA 1X4SA 5E3PA 5JHWC 3UGDA 2QQCA 2SGPI 1R79A 2J9RA 3FSXA 2ARPF 4WP4A 5J8FA 3HH2C 4GI3C 1XBTA 2KMPA 2CWFA 2W0TA 2UVOA 3OL0A 2QPOA 2JA1A 2DKVA 1Y8FA 1CT4I 1DS2I 1IW4A 2ORWA 2XRCA 1PTQA 1BMOA 3OVOA 2NU4I 4UXJA 1X74A 1TIHA 3CXLA 3MEKA 1V1HA 2A20A 3R5AA 3FC3A 1PCEA 1WTJA 1OYVI 1YU6C 2KMQA 1Y1CA 2SGDI 2SGQI 2QQ0A 2Y0MA 3VDUA 3R5CA 1LR7A 1P9GA 2DB6A 2GIVA 1BUSA 1TURA 2N52A 3UEJA 2QQEA 1TUSA 3VDPA 1P9ZA 2WVJA 3SGBI 1DS3I 3R5DA 5E3QA 4MPIA 5CCLA 2GKRI 4JCVE 3UGLA 1FAQA 1CE3A 5HQ8A 1WGCA 1SGQI 2P6AC 2NU2I 1XA6A 1HJAI 5FUWA 2UZ3A 1PJUA 1Z2IA 2YQPA 1FY7A 1PTRA 1UHAA 5EX3A 1OMUA 1HPTA 1SGNI 1MT1A 2JYYA 1NXUA 2KMOA 4A24A 3GOXA 1K7VA 2E73A 3OXLA 4SGBI 1K7UA 5E3RA 5FUXA 2ERWA 1KMAA 1S20A 1SGDI 2V53A 2X52A 3QAHA 1Y1BA 2GKTI 1IY5A 1LR9A 3QWPA 2OVOA 1U5KA 1TGSI 2V1CC 1MJAA 1RFHA 1W3SA 2CWGA 2FNFX 2WCYA 5DAEA 1Q9BA 1TBRR 3TO6A 2LB7A 3QTLD 1CSOI 2RIJA 1CGII 1OMTA 5J8CA 1HEVA 4AMLA 1KBEA 3E2IA 1CT0I 1ULMA 2GKVA 3SGQI
chains in the Genus database with same CATH topology
1SGRI 3UEYA 4E1PA 1AN1I 1CT2I 2KMRA 1M8BA 2LUYA 1KBFA 1YTPA 2M5XA 4UXHA 3OXGA 3E59A 2KCXA 2YUUA 1SGPI 2ENZA 2L8EA 2NU0I 5EX0A 1TBOA 1UVGA 2BUSA 1N13A 2E5RA 4HGUA 1M8CA 5HI7A 1LR8A 2ORVA 2JXDA 5CCMA 1R0RI 1SGEI 3VE5A 1TBNA 2LEOA 4B6DA 2VRWB 3OXFA 1FYBA 1V1IA 2V1CA 2SGFI 4E1RA 3SEKC 1NUBA 4L9MA 1UUCA 2DIPA 2L7XA 2ROWA 2GVIA 1PPFI 2N17A 2ODDA 1SGYI 2JW6A 3B4VC 3UGIA 1CHOI 2J87A 1Z7KB 1IY6A 1TBQR 1UVFA 1VDDA 2ELIA 3D00A 1FARA 2ENNA 1OVOA 4UXIA 2N1AB 3TJQA 2B0UC 1HDLA 2CJSC 5FUYA 2N71A 1H0ZA 2B8TA 1W4RA 1XX6A 2K9HA 3KY9A 2NU3I 5FUVA 2NU1I 2JZMA 4FKDA 3RU0A 1CGJI 2SGEI 1TOTA 3UFFA 2QQDA 2F3CI 3PDNA 4OVOA 2OD1A 1X4SA 5JHWC 3UGDA 2QQCA 2SGPI 1R79A 2J9RA 2ARPF 3HH2C 4GI3C 1XBTA 2KMPA 2W0TA 3OL0A 2QPOA 2JA1A 1Y8FA 1CT4I 1DS2I 1IW4A 2ORWA 2XRCA 1PTQA 1BMOA 3OVOA 2NU4I 4UXJA 1X74A 1TIHA 3CXLA 3MEKA 1V1HA 2A20A 3FC3A 1PCEA 2SGDI 1OYVI 1YU6C 2KMQA 1CT0I 3BJIA 2SGQI 2QQ0A 3VDUA 1LR7A 2DB6A 1BUSA 1TURA 2N52A 3UEJA 2QQEA 1TUSA 3VDPA 2WVJA 3SGBI 1DS3I 5CCLA 2GKRI 4JCVE 3UGLA 1FAQA 1CE3A 5HQ8A 2P6AC 1SGQI 2NU2I 1XA6A 1HJAI 5FUWA 2UZ3A 1PJUA 2YQPA 1PTRA 5EX3A 1OMUA 1HPTA 1SGNI 1MT1A 2JYYA 2KMOA 4A24A 3GOXA 5FUXA 2E73A 3OXLA 4SGBI 2ERWA 1KMAA 1SGDI 2V53A 1Y1BA 2GKTI 1IY5A 1LR9A 3QWPA 2OVOA 1U5KA 1TGSI 2V1CC 2WCYA 1RFHA 1W3SA 2FNFX 5DAEA 1TBRR 3QTLD 1CSOI 1CGII 1OMTA 1KBEA 3E2IA 1Y1CA 2GKVA 3SGQI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UEY A;  3UGI A;  1XBT A;  1KBF A;  2J87 A;  1XA6 A;  5FUW A;  2UZ3 A;  2QPO A;  2JA1 A;  1PTR A;  2ELI A;  4UXH A;  1FAR A;  2ENN A;  2YUU A;  1Y8F A;  4UXI A;  2ENZ A;  2ORW A;  1PTQ A;  2E73 A;  5FUX A;  5FUY A;  1TBO A;  1W4R A;  1XX6 A;  2B8T A;  2J9R A;  3KY9 A;  4UXJ A;  5FUV A;  3CXL A;  4FKD A;  3BJI A;  3UFF A;  2QQ0 A;  1TBN A;  1RFH A;  2FNF X;  2DB6 A;  4B6D A;  3UEJ A;  2VRW B;  2QQE A;  2WVJ A;  1KBE A;  3E2I A;  3UGD A;  2ROW A;  2ORV A;  4L9M A;  1R79 A;  1FAQ A;  3UGL A;  2GVI A; 
#chains in the Genus database with same CATH topology
 1SGR I;  3UEY A;  4E1P A;  1AN1 I;  1ULN A;  1CT2 I;  1MJ9 A;  2KMR A;  7WGA A;  1M8B A;  2LUY A;  1KBF A;  1YTP A;  3R5B A;  2M5X A;  4UXH A;  3OXG A;  3E59 A;  2KCX A;  2YUU A;  1SGP I;  2ENZ A;  2L8E A;  2NU0 I;  5EX0 A;  1TBO A;  1UVG A;  3TOA A;  2WGC A;  2BUS A;  1N13 A;  2E5R A;  4HGU A;  2PQ8 A;  1M8C A;  5HI7 A;  1LR8 A;  2ORV A;  4DNC A;  2JXD A;  3FSY A;  5CCM A;  1R0R I;  1SGE I;  2CWH A;  3VE5 A;  1MJB A;  1TBN A;  2OU2 A;  2LEO A;  4B6D A;  2VRW B;  3OXF A;  1FYB A;  1V1I A;  2V1C A;  2SGF I;  4E1R A;  3SEK C;  1NUB A;  4L9M A;  1UUC A;  2DIP A;  2L7X A;  2ROW A;  3TO9 A;  3TOB A;  2GVI A;  1PPF I;  2N17 A;  2ODD A;  1SGY I;  2RC4 A;  2JW6 A;  3B4V C;  3UGI A;  1CHO I;  2J87 A;  1Z7K B;  3BJI A;  1IY6 A;  1TBQ R;  1UVF A;  1VDD A;  2ELI A;  3D00 A;  1FAR A;  2ENN A;  1OVO A;  3UOE A;  4UXI A;  2N1A B;  3TJQ A;  2B0U C;  9WGA A;  1HDL A;  2CJS C;  5FUY A;  2N71 A;  1H0Z A;  2B8T A;  1W4R A;  1XX6 A;  2K9H A;  3KY9 A;  1ULK A;  2NU3 I;  5FUV A;  2X3T A;  2OZU A;  2NU1 I;  2JZM A;  4FKD A;  3RU0 A;  1CGJ I;  3TO7 A;  1WKX A;  1TOT A;  2SGE I;  3UFF A;  2QQD A;  2F3C I;  3PDN A;  4OVO A;  1WGT A;  2OD1 A;  1K7T A;  1X4S A;  5E3P A;  5JHW C;  3UGD A;  2QQC A;  2SGP I;  1R79 A;  2J9R A;  3FSX A;  2ARP F;  4WP4 A;  5J8F A;  3HH2 C;  4GI3 C;  1XBT A;  2KMP A;  2CWF A;  2W0T A;  2UVO A;  3OL0 A;  2QPO A;  2JA1 A;  2DKV A;  1Y8F A;  1CT4 I;  1DS2 I;  1IW4 A;  2ORW A;  2XRC A;  1PTQ A;  1BMO A;  3OVO A;  2NU4 I;  4UXJ A;  1X74 A;  1TIH A;  3CXL A;  3MEK A;  1V1H A;  2A20 A;  3R5A A;  3FC3 A;  1PCE A;  1WTJ A;  1OYV I;  1YU6 C;  2KMQ A;  1Y1C A;  2SGD I;  2SGQ I;  2QQ0 A;  2Y0M A;  3VDU A;  3R5C A;  1LR7 A;  1P9G A;  2DB6 A;  2GIV A;  1BUS A;  1TUR A;  2N52 A;  3UEJ A;  2QQE A;  1TUS A;  3VDP A;  1P9Z A;  2WVJ A;  3SGB I;  1DS3 I;  3R5D A;  5E3Q A;  4MPI A;  5CCL A;  2GKR I;  4JCV E;  3UGL A;  1FAQ A;  1CE3 A;  5HQ8 A;  1WGC A;  1SGQ I;  2P6A C;  2NU2 I;  1XA6 A;  1HJA I;  5FUW A;  2UZ3 A;  1PJU A;  1Z2I A;  2YQP A;  1FY7 A;  1PTR A;  1UHA A;  5EX3 A;  1OMU A;  1HPT A;  1SGN I;  1MT1 A;  2JYY A;  1NXU A;  2KMO A;  4A24 A;  3GOX A;  1K7V A;  2E73 A;  3OXL A;  4SGB I;  1K7U A;  5E3R A;  5FUX A;  2ERW A;  1KMA A;  1S20 A;  1SGD I;  2V53 A;  2X52 A;  3QAH A;  1Y1B A;  2GKT I;  1IY5 A;  1LR9 A;  3QWP A;  2OVO A;  1U5K A;  1TGS I;  2V1C C;  1MJA A;  1RFH A;  1W3S A;  2CWG A;  2FNF X;  2WCY A;  5DAE A;  1Q9B A;  1TBR R;  3TO6 A;  2LB7 A;  3QTL D;  1CSO I;  2RIJ A;  1CGI I;  1OMT A;  5J8C A;  1HEV A;  4AML A;  1KBE A;  3E2I A;  1CT0 I;  1ULM A;  2GKV A;  3SGQ I; 
#chains in the Genus database with same CATH homology
 1SGR I;  3UEY A;  4E1P A;  1AN1 I;  1CT2 I;  2KMR A;  1M8B A;  2LUY A;  1KBF A;  1YTP A;  2M5X A;  4UXH A;  3OXG A;  3E59 A;  2KCX A;  2YUU A;  1SGP I;  2ENZ A;  2L8E A;  2NU0 I;  5EX0 A;  1TBO A;  1UVG A;  2BUS A;  1N13 A;  2E5R A;  4HGU A;  1M8C A;  5HI7 A;  1LR8 A;  2ORV A;  2JXD A;  5CCM A;  1R0R I;  1SGE I;  3VE5 A;  1TBN A;  2LEO A;  4B6D A;  2VRW B;  3OXF A;  1FYB A;  1V1I A;  2V1C A;  2SGF I;  4E1R A;  3SEK C;  1NUB A;  4L9M A;  1UUC A;  2DIP A;  2L7X A;  2ROW A;  2GVI A;  1PPF I;  2N17 A;  2ODD A;  1SGY I;  2JW6 A;  3B4V C;  3UGI A;  1CHO I;  2J87 A;  1Z7K B;  1IY6 A;  1TBQ R;  1UVF A;  1VDD A;  2ELI A;  3D00 A;  1FAR A;  2ENN A;  1OVO A;  4UXI A;  2N1A B;  3TJQ A;  2B0U C;  1HDL A;  2CJS C;  5FUY A;  2N71 A;  1H0Z A;  2B8T A;  1W4R A;  1XX6 A;  2K9H A;  3KY9 A;  2NU3 I;  5FUV A;  2NU1 I;  2JZM A;  4FKD A;  3RU0 A;  1CGJ I;  2SGE I;  1TOT A;  3UFF A;  2QQD A;  2F3C I;  3PDN A;  4OVO A;  2OD1 A;  1X4S A;  5JHW C;  3UGD A;  2QQC A;  2SGP I;  1R79 A;  2J9R A;  2ARP F;  3HH2 C;  4GI3 C;  1XBT A;  2KMP A;  2W0T A;  3OL0 A;  2QPO A;  2JA1 A;  1Y8F A;  1CT4 I;  1DS2 I;  1IW4 A;  2ORW A;  2XRC A;  1PTQ A;  1BMO A;  3OVO A;  2NU4 I;  4UXJ A;  1X74 A;  1TIH A;  3CXL A;  3MEK A;  1V1H A;  2A20 A;  3FC3 A;  1PCE A;  2SGD I;  1OYV I;  1YU6 C;  2KMQ A;  1CT0 I;  3BJI A;  2SGQ I;  2QQ0 A;  3VDU A;  1LR7 A;  2DB6 A;  1BUS A;  1TUR A;  2N52 A;  3UEJ A;  2QQE A;  1TUS A;  3VDP A;  2WVJ A;  3SGB I;  1DS3 I;  5CCL A;  2GKR I;  4JCV E;  3UGL A;  1FAQ A;  1CE3 A;  5HQ8 A;  2P6A C;  1SGQ I;  2NU2 I;  1XA6 A;  1HJA I;  5FUW A;  2UZ3 A;  1PJU A;  2YQP A;  1PTR A;  5EX3 A;  1OMU A;  1HPT A;  1SGN I;  1MT1 A;  2JYY A;  2KMO A;  4A24 A;  3GOX A;  5FUX A;  2E73 A;  3OXL A;  4SGB I;  2ERW A;  1KMA A;  1SGD I;  2V53 A;  1Y1B A;  2GKT I;  1IY5 A;  1LR9 A;  3QWP A;  2OVO A;  1U5K A;  1TGS I;  2V1C C;  2WCY A;  1RFH A;  1W3S A;  2FNF X;  5DAE A;  1TBR R;  3QTL D;  1CSO I;  1CGI I;  1OMT A;  1KBE A;  3E2I A;  1Y1C A;  2GKV A;  3SGQ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...