2ELIA

Solution structure of the second phorbol esters/diacylglycerol binding domain of human protein kinase c alpha type
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
85
structure length
85
Chain Sequence
GSSGSSGGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein kinase C alpha type
publication title Solution structure of the second Phorbol esters/diacylglycerol binding domain of human Protein kinase C alpha type
rcsb
source organism Homo sapiens
total genus 4
structure length 85
sequence length 85
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2007-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2eliA01
2DB6A 2VRWB 1W4RA 3UEYA 2FNFX 2ORVA 3E2IA 1TBOA 1R79A 3UGLA 3UGIA 2UZ3A 2ENZA 2WVJA 3UEJA 2J87A 2JA1A 2QPOA 1KBFA 2GVIA 1XX6A 2ROWA 2ENNA 4UXHA 3KY9A 2J9RA 2YUUA 1Y8FA 3UGDA 4B6DA 1FAQA 2ORWA 3CXLA 1FARA 4FKDA 1XBTA 1KBEA 4L9MA 2ELIA 3BJIA 5FUWA 2B8TA 4UXJA 1PTQA 1TBNA 3UFFA 1RFHA 5FUVA 5FUXA 2E73A 5FUYA 1PTRA 1XA6A 2QQ0A 2QQEA 4UXIA
chains in the Genus database with same CATH superfamily
1P9GA 2OU2A 5J8FA 2JYYA 1W4RA 3UEYA 2PQ8A 2E5RA 1TBOA 1R79A 1N13A 2KCXA 3D00A 3QWPA 2J87A 1SGEI 2OVOA 1NXUA 2QPOA 2SGFI 1IY5A 1KBFA 2L7XA 1X74A 1HJAI 2J9RA 3SGQI 1Z7KB 2CJSC 1H0ZA 1FARA 1SGNI 2L8EA 1WTJA 3RU0A 1CGJI 1CSOI 3MEKA 1SGPI 3BJIA 2X3TA 2GKVA 2YQPA 2CWFA 4WP4A 4A24A 2P6AC 4UXJA 1TBNA 2CWHA 2KMOA 2SGPI 5FUYA 1OVOA 2QQ0A 3HH2C 3TOBA 3UGLA 2QQEA 2OZUA 2KMQA 2VRWB 2N71A 5E3QA 2V53A 2KMRA 2ORVA 4E1RA 5EX0A 1IY6A 1K7UA 3FSXA 1VDDA 2CWGA 2F3CI 1AN1I 3OXGA 3SGBI 1K7VA 2B0UC 2K9HA 3QTLD 1M8CA 1WGCA 2QQDA 1Z2IA 3R5AA 3KY9A 2YUUA 1LR8A 4B6DA 1FAQA 1NUBA 3OXFA 2ODDA 2RC4A 1CGII 5DAEA 1KBEA 1MJAA 2ERWA 2NU4I 2Y0MA 1OMTA 3TJQA 1MJBA 4L9MA 2WCYA 3GOXA 7WGAA 1V1HA 3R5DA 1CT0I 4OVOA 3OXLA 1R0RI 2LB7A 2UVOA 5HI7A 1UUCA 1RFHA 1TUSA 2JZMA 2QQCA 5FUXA 5J8CA 1XA6A 1Y1CA 1CT4I 1FY7A 1MT1A 1P9ZA 1SGRI 4UXIA 1PPFI 1HPTA 1X4SA 1TIHA 3PDNA 1TBRR 1WKXA 2NU1I 2GKTI 1TGSI 2ARPF 2LUYA 3TO9A 2FNFX 1TURA 1YU6C 3E2IA 4JCVE 3UOEA 2SGQI 1HDLA 3UGIA 3FSYA 1DS2I 2X52A 2UZ3A 4GI3C 2WVJA 5EX3A 3UEJA 2JA1A 5CCLA 2GVIA 1ULKA 1SGDI 1V1IA 2JW6A 3TO6A 2N1AB 1YTPA 2ENNA 2W0TA 1K7TA 2N17A 5HQ8A 2OD1A 1PJUA 2RIJA 1MJ9A 1DS3I 2ORWA 1U5KA 2DKVA 2KMPA 2SGDI 1XBTA 2A20A 3CXLA 4FKDA 5E3PA 3R5CA 2NU3I 1CE3A 3TO7A 9WGAA 3FC3A 5FUWA 2BUSA 2B8TA 1FYBA 1IW4A 1ULMA 1PTQA 1M8BA 1S20A 4DNCA 1LR9A 5FUVA 1PCEA 1SGYI 1HEVA 1SGQI 4E1PA 1PTRA 2NU0I 5CCMA 1Y1BA 2DB6A 2LEOA 2GKRI 4MPIA 1Q9BA 2WGCA 3OVOA 1LR7A 2ENZA 2SGEI 3VE5A 3QAHA 5JHWC 1TBQR 1CHOI 1TOTA 4AMLA 4SGBI 1XX6A 5E3RA 2ROWA 2V1CC 4UXHA 2XRCA 3VDUA 2GIVA 1Y8FA 3UGDA 1OMUA 1CT2I 2V1CA 3TOAA 1WGTA 3SEKC 2DIPA 1BUSA 1UHAA 3VDPA 2ELIA 3B4VC 3OL0A 1UVFA 2JXDA 3UFFA 1BMOA 3E59A 1UVGA 4HGUA 2E73A 2N52A 1KMAA 3R5BA 2NU2I 2M5XA 1W3SA 1OYVI 1ULNA
chains in the Genus database with same CATH topology
2JYYA 1W4RA 3UEYA 2E5RA 1TBOA 1R79A 1N13A 2KCXA 3D00A 3QWPA 1W3SA 2J87A 1SGEI 2OVOA 2QPOA 2SGFI 1IY5A 1KBFA 2L7XA 1X74A 1HJAI 2J9RA 3SGQI 2CJSC 1H0ZA 1FARA 1SGNI 2L8EA 3RU0A 1CGJI 1CSOI 3MEKA 1SGPI 3BJIA 2YQPA 2GKVA 4A24A 2P6AC 4UXJA 1TBNA 2SGPI 2KMOA 5FUYA 1OVOA 2QQ0A 3HH2C 3UGLA 2QQEA 2KMQA 2VRWB 2N71A 2V53A 2KMRA 2ORVA 5EX0A 1IY6A 1VDDA 2F3CI 1AN1I 3OXGA 3SGBI 2B0UC 2K9HA 3QTLD 1M8CA 2QQDA 3KY9A 2YUUA 1LR8A 4B6DA 1FAQA 1NUBA 3OXFA 2ODDA 1CGII 5DAEA 1KBEA 2NU4I 2ERWA 3TJQA 3GOXA 1OMTA 4L9MA 2WCYA 1V1HA 1CT0I 4OVOA 3OXLA 1R0RI 5HI7A 1UUCA 1RFHA 1TUSA 2JZMA 2QQCA 5FUXA 1XA6A 1Y1CA 1CT4I 1MT1A 1SGRI 4UXIA 1X4SA 1PPFI 1HPTA 1TIHA 3PDNA 1TBRR 2NU1I 2GKTI 1TGSI 2ARPF 2LUYA 4E1PA 2FNFX 1TURA 1YU6C 3E2IA 4JCVE 1HDLA 2SGQI 3UGIA 4GI3C 1DS2I 5EX3A 2UZ3A 2WVJA 3UEJA 2JA1A 5CCLA 2GVIA 1V1IA 1SGDI 2JW6A 2N1AB 1YTPA 2ENNA 2W0TA 2N17A 5HQ8A 2OD1A 1PJUA 1DS3I 2ORWA 1U5KA 2KMPA 2SGDI 3CXLA 1XBTA 2A20A 4FKDA 4E1RA 2NU3I 1CE3A 3FC3A 5FUWA 2BUSA 2B8TA 1FYBA 1IW4A 1PTQA 1M8BA 1LR9A 5FUVA 1PCEA 1SGYI 1SGQI 1PTRA 2NU0I 5CCMA 1Y1BA 2DB6A 2LEOA 2GKRI 3OVOA 1LR7A 2ENZA 2SGEI 3VE5A 5JHWC 1TBQR 1CHOI 1TOTA 4SGBI 1XX6A 2ROWA 2V1CC 4UXHA 2XRCA 3VDUA 1Y8FA 3UGDA 1OMUA 1CT2I 2V1CA 3SEKC 2DIPA 1BUSA 3VDPA 2ELIA 3B4VC 3OL0A 1UVFA 2JXDA 3UFFA 1BMOA 3E59A 1UVGA 4HGUA 2E73A 2N52A 1KMAA 2NU2I 2M5XA 1Z7KB 1OYVI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DB6 A;  2VRW B;  1W4R A;  3UEY A;  2FNF X;  2ORV A;  3E2I A;  1TBO A;  1R79 A;  3UGL A;  3UGI A;  2UZ3 A;  2ENZ A;  2WVJ A;  3UEJ A;  2J87 A;  2JA1 A;  2QPO A;  1KBF A;  2GVI A;  1XX6 A;  2ROW A;  2ENN A;  4UXH A;  3KY9 A;  2J9R A;  2YUU A;  1Y8F A;  3UGD A;  4B6D A;  1FAQ A;  2ORW A;  3CXL A;  1FAR A;  4FKD A;  1XBT A;  1KBE A;  4L9M A;  2ELI A;  3BJI A;  5FUW A;  2B8T A;  4UXJ A;  1PTQ A;  1TBN A;  3UFF A;  1RFH A;  5FUV A;  5FUX A;  2E73 A;  5FUY A;  1PTR A;  1XA6 A;  2QQ0 A;  2QQE A;  4UXI A; 
#chains in the Genus database with same CATH topology
 1P9G A;  2OU2 A;  5J8F A;  2JYY A;  1W4R A;  3UEY A;  2PQ8 A;  2E5R A;  1TBO A;  1R79 A;  1N13 A;  2KCX A;  3D00 A;  3QWP A;  2J87 A;  1SGE I;  2OVO A;  1NXU A;  2QPO A;  2SGF I;  1IY5 A;  1KBF A;  2L7X A;  1X74 A;  1HJA I;  2J9R A;  3SGQ I;  1Z7K B;  2CJS C;  1H0Z A;  1FAR A;  1SGN I;  2L8E A;  1WTJ A;  3RU0 A;  1CGJ I;  1CSO I;  3MEK A;  1SGP I;  3BJI A;  2X3T A;  2GKV A;  2YQP A;  2CWF A;  4WP4 A;  4A24 A;  2P6A C;  4UXJ A;  1TBN A;  2CWH A;  2KMO A;  2SGP I;  5FUY A;  1OVO A;  2QQ0 A;  3HH2 C;  3TOB A;  3UGL A;  2QQE A;  2OZU A;  2KMQ A;  2VRW B;  2N71 A;  5E3Q A;  2V53 A;  2KMR A;  2ORV A;  4E1R A;  5EX0 A;  1IY6 A;  1K7U A;  3FSX A;  1VDD A;  2CWG A;  2F3C I;  1AN1 I;  3OXG A;  3SGB I;  1K7V A;  2B0U C;  2K9H A;  3QTL D;  1M8C A;  1WGC A;  2QQD A;  1Z2I A;  3R5A A;  3KY9 A;  2YUU A;  1LR8 A;  4B6D A;  1FAQ A;  1NUB A;  3OXF A;  2ODD A;  2RC4 A;  1CGI I;  5DAE A;  1KBE A;  1MJA A;  2ERW A;  2NU4 I;  2Y0M A;  1OMT A;  3TJQ A;  1MJB A;  4L9M A;  2WCY A;  3GOX A;  7WGA A;  1V1H A;  3R5D A;  1CT0 I;  4OVO A;  3OXL A;  1R0R I;  2LB7 A;  2UVO A;  5HI7 A;  1UUC A;  1RFH A;  1TUS A;  2JZM A;  2QQC A;  5FUX A;  5J8C A;  1XA6 A;  1Y1C A;  1CT4 I;  1FY7 A;  1MT1 A;  1P9Z A;  1SGR I;  4UXI A;  1PPF I;  1HPT A;  1X4S A;  1TIH A;  3PDN A;  1TBR R;  1WKX A;  2NU1 I;  2GKT I;  1TGS I;  2ARP F;  2LUY A;  3TO9 A;  2FNF X;  1TUR A;  1YU6 C;  3E2I A;  4JCV E;  3UOE A;  2SGQ I;  1HDL A;  3UGI A;  3FSY A;  1DS2 I;  2X52 A;  2UZ3 A;  4GI3 C;  2WVJ A;  5EX3 A;  3UEJ A;  2JA1 A;  5CCL A;  2GVI A;  1ULK A;  1SGD I;  1V1I A;  2JW6 A;  3TO6 A;  2N1A B;  1YTP A;  2ENN A;  2W0T A;  1K7T A;  2N17 A;  5HQ8 A;  2OD1 A;  1PJU A;  2RIJ A;  1MJ9 A;  1DS3 I;  2ORW A;  1U5K A;  2DKV A;  2KMP A;  2SGD I;  1XBT A;  2A20 A;  3CXL A;  4FKD A;  5E3P A;  3R5C A;  2NU3 I;  1CE3 A;  3TO7 A;  9WGA A;  3FC3 A;  5FUW A;  2BUS A;  2B8T A;  1FYB A;  1IW4 A;  1ULM A;  1PTQ A;  1M8B A;  1S20 A;  4DNC A;  1LR9 A;  5FUV A;  1PCE A;  1SGY I;  1HEV A;  1SGQ I;  4E1P A;  1PTR A;  2NU0 I;  5CCM A;  1Y1B A;  2DB6 A;  2LEO A;  2GKR I;  4MPI A;  1Q9B A;  2WGC A;  3OVO A;  1LR7 A;  2ENZ A;  2SGE I;  3VE5 A;  3QAH A;  5JHW C;  1TBQ R;  1CHO I;  1TOT A;  4AML A;  4SGB I;  1XX6 A;  5E3R A;  2ROW A;  2V1C C;  4UXH A;  2XRC A;  3VDU A;  2GIV A;  1Y8F A;  3UGD A;  1OMU A;  1CT2 I;  2V1C A;  3TOA A;  1WGT A;  3SEK C;  2DIP A;  1BUS A;  1UHA A;  3VDP A;  2ELI A;  3B4V C;  3OL0 A;  1UVF A;  2JXD A;  3UFF A;  1BMO A;  3E59 A;  1UVG A;  4HGU A;  2E73 A;  2N52 A;  1KMA A;  3R5B A;  2NU2 I;  2M5X A;  1W3S A;  1OYV I;  1ULN A; 
#chains in the Genus database with same CATH homology
 2JYY A;  1W4R A;  3UEY A;  2E5R A;  1TBO A;  1R79 A;  1N13 A;  2KCX A;  3D00 A;  3QWP A;  1W3S A;  2J87 A;  1SGE I;  2OVO A;  2QPO A;  2SGF I;  1IY5 A;  1KBF A;  2L7X A;  1X74 A;  1HJA I;  2J9R A;  3SGQ I;  2CJS C;  1H0Z A;  1FAR A;  1SGN I;  2L8E A;  3RU0 A;  1CGJ I;  1CSO I;  3MEK A;  1SGP I;  3BJI A;  2YQP A;  2GKV A;  4A24 A;  2P6A C;  4UXJ A;  1TBN A;  2SGP I;  2KMO A;  5FUY A;  1OVO A;  2QQ0 A;  3HH2 C;  3UGL A;  2QQE A;  2KMQ A;  2VRW B;  2N71 A;  2V53 A;  2KMR A;  2ORV A;  5EX0 A;  1IY6 A;  1VDD A;  2F3C I;  1AN1 I;  3OXG A;  3SGB I;  2B0U C;  2K9H A;  3QTL D;  1M8C A;  2QQD A;  3KY9 A;  2YUU A;  1LR8 A;  4B6D A;  1FAQ A;  1NUB A;  3OXF A;  2ODD A;  1CGI I;  5DAE A;  1KBE A;  2NU4 I;  2ERW A;  3TJQ A;  3GOX A;  1OMT A;  4L9M A;  2WCY A;  1V1H A;  1CT0 I;  4OVO A;  3OXL A;  1R0R I;  5HI7 A;  1UUC A;  1RFH A;  1TUS A;  2JZM A;  2QQC A;  5FUX A;  1XA6 A;  1Y1C A;  1CT4 I;  1MT1 A;  1SGR I;  4UXI A;  1X4S A;  1PPF I;  1HPT A;  1TIH A;  3PDN A;  1TBR R;  2NU1 I;  2GKT I;  1TGS I;  2ARP F;  2LUY A;  4E1P A;  2FNF X;  1TUR A;  1YU6 C;  3E2I A;  4JCV E;  1HDL A;  2SGQ I;  3UGI A;  4GI3 C;  1DS2 I;  5EX3 A;  2UZ3 A;  2WVJ A;  3UEJ A;  2JA1 A;  5CCL A;  2GVI A;  1V1I A;  1SGD I;  2JW6 A;  2N1A B;  1YTP A;  2ENN A;  2W0T A;  2N17 A;  5HQ8 A;  2OD1 A;  1PJU A;  1DS3 I;  2ORW A;  1U5K A;  2KMP A;  2SGD I;  3CXL A;  1XBT A;  2A20 A;  4FKD A;  4E1R A;  2NU3 I;  1CE3 A;  3FC3 A;  5FUW A;  2BUS A;  2B8T A;  1FYB A;  1IW4 A;  1PTQ A;  1M8B A;  1LR9 A;  5FUV A;  1PCE A;  1SGY I;  1SGQ I;  1PTR A;  2NU0 I;  5CCM A;  1Y1B A;  2DB6 A;  2LEO A;  2GKR I;  3OVO A;  1LR7 A;  2ENZ A;  2SGE I;  3VE5 A;  5JHW C;  1TBQ R;  1CHO I;  1TOT A;  4SGB I;  1XX6 A;  2ROW A;  2V1C C;  4UXH A;  2XRC A;  3VDU A;  1Y8F A;  3UGD A;  1OMU A;  1CT2 I;  2V1C A;  3SEK C;  2DIP A;  1BUS A;  3VDP A;  2ELI A;  3B4V C;  3OL0 A;  1UVF A;  2JXD A;  3UFF A;  1BMO A;  3E59 A;  1UVG A;  4HGU A;  2E73 A;  2N52 A;  1KMA A;  2NU2 I;  2M5X A;  1Z7K B;  1OYV I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...