1TBRR

Crystal structure of insect derived double domain kazal inhibitor rhodniin in complex with thrombin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
EGGEPCACPHALHRVCGSDGETYSNPCTLNCAKFNGKPELVKVHDGPCEPDEDEDVCQECDGDEYKPVCGSDDITYDNNCRLECASISSSPGVELKHEGPCRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THROMBIN
publication title Two heads are better than one: crystal structure of the insect derived double domain Kazal inhibitor rhodniin in complex with thrombin.
pubmed rcsb
source organism Rhodnius prolixus
molecule tags Complex (serine protease/inhibitor)
total genus 27
structure length 103
sequence length 103
chains with identical sequence S
ec nomenclature
pdb deposition date 1995-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
R PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1tbrR02
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1tbrR01
1TIHA 1KMAA 1NUBA 2N52A 2BUSA 2B0UC 2M5XA 2NU3I 3SGBI 1SGRI 2KMPA 2LEOA 5DAEA 1YU6C 1OMUA 5JHWC 2QQDA 2KCXA 1M8BA 1SGQI 2JZMA 1SGDI 1HDLA 1UVFA 2KMRA 2SGPI 2SGDI 1TBQR 2JXDA 2N17A 2F3CI 1BMOA 3B4VC 1CT4I 3QTLD 1DS3I 1LR7A 1CT0I 3HH2C 2WCYA 1IW4A 2KMOA 1TUSA 2OVOA 2GKTI 1BUSA 1CSOI 1AN1I 1TBRR 2GKVA 4GI3C 2NU4I 1IY5A 2ARPF 1SGNI 1PCEA 1FYBA 1OMTA 1H0ZA 1HJAI 1TGSI 1DS2I 4OVOA 2JYYA 2NU2I 1N13A 2SGQI 1CGJI 3TJQA 1M8CA 1SGYI 1SGEI 1PJUA 2ERWA 1OYVI 1HPTA 1CT2I 2QQCA 1Z7KB 1R0RI 2NU1I 3SEKC 1CE3A 3OVOA 2SGFI 1OVOA 1CGII 4HGUA 1Y1BA 3SGQI 1LR9A 1UVGA 1Y1CA 1TURA 1CHOI 2P6AC 2XRCA 1LR8A 1MT1A 1UUCA 1IY6A 2NU0I 4SGBI 1YTPA 2V53A 2KMQA 2SGEI 1SGPI 1PPFI 2GKRI 2N71A
chains in the Genus database with same CATH superfamily
1TIHA 3UOEA 1NUBA 1KMAA 1Y8FA 5J8FA 1PTQA 2L7XA 3QWPA 2N52A 1WKXA 2BUSA 2K9HA 3TOBA 2B0UC 2YQPA 2JA1A 2M5XA 2NU3I 3VDPA 2V1CA 3SGBI 3TO7A 2WVJA 2QPOA 1SGRI 2KMPA 2Y0MA 2LEOA 5DAEA 2ENNA 1YU6C 4JCVE 1MJAA 1OMUA 1R79A 3E59A 5JHWC 3OXFA 1MJBA 1FAQA 5HI7A 3D00A 1S20A 1W4RA 2QQDA 1MJ9A 3QAHA 2ORVA 1XBTA 5FUVA 2KCXA 1M8BA 1SGQI 2JZMA 2N1AB 1SGDI 4UXIA 1HDLA 1UVFA 2KMRA 1P9GA 2SGPI 2SGDI 1TBQR 1FY7A 2CWFA 2F3CI 1K7UA 2JXDA 2N17A 1BMOA 3CXLA 3B4VC 1P9ZA 2ENZA 1CT4I 3OXLA 3QTLD 1DS3I 1K7VA 1WGCA 1LR7A 1CT0I 4L9MA 3HH2C 1TBOA 2WCYA 1IW4A 2LB7A 3FSYA 3PDNA 2JW6A 2KMOA 4E1RA 1TUSA 2GVIA 2X3TA 3UEYA 2OVOA 3UGIA 2GKTI 1ULMA 1K7TA 1V1IA 2B8TA 2DB6A 1V1HA 3OL0A 3R5DA 5E3QA 1PTRA 1CSOI 5FUXA 3UGDA 1BUSA 1AN1I 2DIPA 1TBRR 2ORWA 2OZUA 2UVOA 3R5CA 4E1PA 5HQ8A 7WGAA 2CJSC 2GKVA 4GI3C 3OXGA 2E73A 2NU4I 5EX0A 1IY5A 2V1CC 3KY9A 2J9RA 2ARPF 3TO9A 5FUYA 3UFFA 9WGAA 3TO6A 5CCLA 1KBEA 1SGNI 3RU0A 2CWGA 1PCEA 2LUYA 1KBFA 5CCMA 1FYBA 1OMTA 1Q9BA 1H0ZA 1HJAI 1TGSI 2UZ3A 2X52A 1DS2I 4OVOA 1FARA 4A24A 2YUUA 1Z2IA 1TBNA 1NXUA 4B6DA 3R5AA 2RIJA 1UHAA 2J87A 2JYYA 5EX3A 1HEVA 2VRWB 2NU2I 1U5KA 2FNFX 1N13A 2SGQI 1CGJI 3TJQA 3UGLA 1M8CA 1SGYI 1SGEI 2A20A 2E5RA 1PJUA 1VDDA 1XA6A 2CWHA 1ULNA 1OYVI 2ERWA 3BJIA 3VE5A 1X74A 1HPTA 3VDUA 3FSXA 1CT2I 4AMLA 2GIVA 2QQCA 1X4SA 3UEJA 1RFHA 2ROWA 1Z7KB 1R0RI 2NU1I 3SEKC 3FC3A 1CE3A 3OVOA 1ULKA 4UXJA 2SGFI 1OVOA 1CGII 4HGUA 2W0TA 1Y1BA 3SGQI 1LR9A 1UVGA 3R5BA 2QQEA 3TOAA 2QQ0A 1Y1CA 1TURA 4WP4A 2RC4A 5FUWA 2DKVA 1CHOI 2P6AC 2XRCA 2ODDA 2OU2A 2ELIA 4FKDA 3E2IA 1LR8A 1MT1A 2OD1A 4MPIA 4UXHA 1UUCA 5E3PA 5E3RA 2PQ8A 5J8CA 1IY6A 2NU0I 4SGBI 1XX6A 1YTPA 1WTJA 2L8EA 1WGTA 2KMQA 2V53A 3MEKA 3GOXA 2WGCA 1TOTA 2SGEI 1W3SA 1SGPI 1PPFI 2GKRI 2N71A 4DNCA
chains in the Genus database with same CATH topology
1TIHA 1KMAA 1NUBA 1Y8FA 1PTQA 2L7XA 3QWPA 2N52A 2K9HA 2BUSA 2B0UC 2YQPA 2JA1A 2M5XA 2NU3I 3VDPA 2V1CA 3SGBI 2WVJA 2QPOA 1SGRI 2KMPA 2LEOA 5DAEA 2ENNA 1YU6C 4JCVE 1OMUA 1R79A 3E59A 5JHWC 3OXFA 1FAQA 5HI7A 3D00A 1W4RA 2QQDA 2ORVA 1XBTA 5FUVA 2KCXA 1M8BA 1SGQI 2JZMA 2N1AB 1SGDI 4UXIA 1HDLA 1UVFA 2KMRA 2SGPI 2SGDI 1TBQR 2JXDA 2N17A 2F3CI 3CXLA 1BMOA 3B4VC 2ENZA 1CT4I 3OXLA 3QTLD 1DS3I 1LR7A 1CT0I 4L9MA 3HH2C 1TBOA 2WCYA 1IW4A 3PDNA 2JW6A 2KMOA 4E1RA 1TUSA 2GVIA 3UEYA 3UGIA 2OVOA 2GKTI 1V1IA 2B8TA 2DB6A 1V1HA 3OL0A 1BUSA 1PTRA 1CSOI 5FUXA 3UGDA 1AN1I 2DIPA 1TBRR 2ORWA 4E1PA 5HQ8A 2CJSC 2GKVA 4GI3C 3OXGA 2E73A 2NU4I 5EX0A 1IY5A 2V1CC 3KY9A 2J9RA 2ARPF 3UFFA 5FUYA 5CCLA 1KBEA 1SGNI 3RU0A 1PCEA 2LUYA 1KBFA 5CCMA 1FYBA 1OMTA 1H0ZA 1HJAI 1TGSI 2UZ3A 1DS2I 4OVOA 1FARA 4A24A 2YUUA 1TBNA 4B6DA 5EX3A 2J87A 2JYYA 2VRWB 2NU2I 1U5KA 2FNFX 1N13A 2SGQI 1CGJI 3TJQA 3UGLA 1M8CA 1SGYI 1SGEI 2A20A 2E5RA 1PJUA 1VDDA 1XA6A 2ERWA 3BJIA 1OYVI 3VE5A 1X74A 1HPTA 3VDUA 1CT2I 2QQCA 1X4SA 3UEJA 1RFHA 2ROWA 1Z7KB 1R0RI 2NU1I 3SEKC 3FC3A 1CE3A 3OVOA 4UXJA 2SGFI 1OVOA 1CGII 4HGUA 2W0TA 1Y1BA 3SGQI 1LR9A 1UVGA 2QQEA 2QQ0A 1Y1CA 1TURA 5FUWA 1CHOI 2P6AC 2XRCA 2ODDA 2ELIA 4FKDA 3E2IA 1LR8A 1MT1A 2OD1A 4UXHA 1UUCA 1IY6A 2NU0I 4SGBI 1XX6A 1YTPA 2L8EA 2V53A 2KMQA 3MEKA 3GOXA 1TOTA 2SGEI 1W3SA 1SGPI 1PPFI 2GKRI 2N71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TIH A;  1KMA A;  1NUB A;  2N52 A;  2BUS A;  2B0U C;  2M5X A;  2NU3 I;  3SGB I;  1SGR I;  2KMP A;  2LEO A;  5DAE A;  1YU6 C;  1OMU A;  5JHW C;  2QQD A;  2KCX A;  1M8B A;  1SGQ I;  2JZM A;  1SGD I;  1HDL A;  1UVF A;  2KMR A;  2SGP I;  2SGD I;  1TBQ R;  2JXD A;  2N17 A;  2F3C I;  1BMO A;  3B4V C;  1CT4 I;  3QTL D;  1DS3 I;  1LR7 A;  1CT0 I;  3HH2 C;  2WCY A;  1IW4 A;  2KMO A;  1TUS A;  2OVO A;  2GKT I;  1BUS A;  1CSO I;  1AN1 I;  1TBR R;  2GKV A;  4GI3 C;  2NU4 I;  1IY5 A;  2ARP F;  1SGN I;  1PCE A;  1FYB A;  1OMT A;  1H0Z A;  1HJA I;  1TGS I;  1DS2 I;  4OVO A;  2JYY A;  2NU2 I;  1N13 A;  2SGQ I;  1CGJ I;  3TJQ A;  1M8C A;  1SGY I;  1SGE I;  1PJU A;  2ERW A;  1OYV I;  1HPT A;  1CT2 I;  2QQC A;  1Z7K B;  1R0R I;  2NU1 I;  3SEK C;  1CE3 A;  3OVO A;  2SGF I;  1OVO A;  1CGI I;  4HGU A;  1Y1B A;  3SGQ I;  1LR9 A;  1UVG A;  1Y1C A;  1TUR A;  1CHO I;  2P6A C;  2XRC A;  1LR8 A;  1MT1 A;  1UUC A;  1IY6 A;  2NU0 I;  4SGB I;  1YTP A;  2V53 A;  2KMQ A;  2SGE I;  1SGP I;  1PPF I;  2GKR I;  2N71 A; 
#chains in the Genus database with same CATH topology
 1TIH A;  3UOE A;  1NUB A;  1KMA A;  1Y8F A;  5J8F A;  1PTQ A;  2L7X A;  3QWP A;  2N52 A;  1WKX A;  2BUS A;  2K9H A;  3TOB A;  2B0U C;  2YQP A;  2JA1 A;  2M5X A;  2NU3 I;  3VDP A;  2V1C A;  3SGB I;  3TO7 A;  2WVJ A;  2QPO A;  1SGR I;  2KMP A;  2Y0M A;  2LEO A;  5DAE A;  2ENN A;  1YU6 C;  4JCV E;  1MJA A;  1OMU A;  1R79 A;  3E59 A;  5JHW C;  3OXF A;  1MJB A;  1FAQ A;  5HI7 A;  3D00 A;  1S20 A;  1W4R A;  2QQD A;  1MJ9 A;  3QAH A;  2ORV A;  1XBT A;  5FUV A;  2KCX A;  1M8B A;  1SGQ I;  2JZM A;  2N1A B;  1SGD I;  4UXI A;  1HDL A;  1UVF A;  2KMR A;  1P9G A;  2SGP I;  2SGD I;  1TBQ R;  1FY7 A;  2CWF A;  2F3C I;  1K7U A;  2JXD A;  2N17 A;  1BMO A;  3CXL A;  3B4V C;  1P9Z A;  2ENZ A;  1CT4 I;  3OXL A;  3QTL D;  1DS3 I;  1K7V A;  1WGC A;  1LR7 A;  1CT0 I;  4L9M A;  3HH2 C;  1TBO A;  2WCY A;  1IW4 A;  2LB7 A;  3FSY A;  3PDN A;  2JW6 A;  2KMO A;  4E1R A;  1TUS A;  2GVI A;  2X3T A;  3UEY A;  2OVO A;  3UGI A;  2GKT I;  1ULM A;  1K7T A;  1V1I A;  2B8T A;  2DB6 A;  1V1H A;  3OL0 A;  3R5D A;  5E3Q A;  1PTR A;  1CSO I;  5FUX A;  3UGD A;  1BUS A;  1AN1 I;  2DIP A;  1TBR R;  2ORW A;  2OZU A;  2UVO A;  3R5C A;  4E1P A;  5HQ8 A;  7WGA A;  2CJS C;  2GKV A;  4GI3 C;  3OXG A;  2E73 A;  2NU4 I;  5EX0 A;  1IY5 A;  2V1C C;  3KY9 A;  2J9R A;  2ARP F;  3TO9 A;  5FUY A;  3UFF A;  9WGA A;  3TO6 A;  5CCL A;  1KBE A;  1SGN I;  3RU0 A;  2CWG A;  1PCE A;  2LUY A;  1KBF A;  5CCM A;  1FYB A;  1OMT A;  1Q9B A;  1H0Z A;  1HJA I;  1TGS I;  2UZ3 A;  2X52 A;  1DS2 I;  4OVO A;  1FAR A;  4A24 A;  2YUU A;  1Z2I A;  1TBN A;  1NXU A;  4B6D A;  3R5A A;  2RIJ A;  1UHA A;  2J87 A;  2JYY A;  5EX3 A;  1HEV A;  2VRW B;  2NU2 I;  1U5K A;  2FNF X;  1N13 A;  2SGQ I;  1CGJ I;  3TJQ A;  3UGL A;  1M8C A;  1SGY I;  1SGE I;  2A20 A;  2E5R A;  1PJU A;  1VDD A;  1XA6 A;  2CWH A;  1ULN A;  1OYV I;  2ERW A;  3BJI A;  3VE5 A;  1X74 A;  1HPT A;  3VDU A;  3FSX A;  1CT2 I;  4AML A;  2GIV A;  2QQC A;  1X4S A;  3UEJ A;  1RFH A;  2ROW A;  1Z7K B;  1R0R I;  2NU1 I;  3SEK C;  3FC3 A;  1CE3 A;  3OVO A;  1ULK A;  4UXJ A;  2SGF I;  1OVO A;  1CGI I;  4HGU A;  2W0T A;  1Y1B A;  3SGQ I;  1LR9 A;  1UVG A;  3R5B A;  2QQE A;  3TOA A;  2QQ0 A;  1Y1C A;  1TUR A;  4WP4 A;  2RC4 A;  5FUW A;  2DKV A;  1CHO I;  2P6A C;  2XRC A;  2ODD A;  2OU2 A;  2ELI A;  4FKD A;  3E2I A;  1LR8 A;  1MT1 A;  2OD1 A;  4MPI A;  4UXH A;  1UUC A;  5E3P A;  5E3R A;  2PQ8 A;  5J8C A;  1IY6 A;  2NU0 I;  4SGB I;  1XX6 A;  1YTP A;  1WTJ A;  2L8E A;  1WGT A;  2KMQ A;  2V53 A;  3MEK A;  3GOX A;  2WGC A;  1TOT A;  2SGE I;  1W3S A;  1SGP I;  1PPF I;  2GKR I;  2N71 A;  4DNC A; 
#chains in the Genus database with same CATH homology
 1TIH A;  1KMA A;  1NUB A;  1Y8F A;  1PTQ A;  2L7X A;  3QWP A;  2N52 A;  2K9H A;  2BUS A;  2B0U C;  2YQP A;  2JA1 A;  2M5X A;  2NU3 I;  3VDP A;  2V1C A;  3SGB I;  2WVJ A;  2QPO A;  1SGR I;  2KMP A;  2LEO A;  5DAE A;  2ENN A;  1YU6 C;  4JCV E;  1OMU A;  1R79 A;  3E59 A;  5JHW C;  3OXF A;  1FAQ A;  5HI7 A;  3D00 A;  1W4R A;  2QQD A;  2ORV A;  1XBT A;  5FUV A;  2KCX A;  1M8B A;  1SGQ I;  2JZM A;  2N1A B;  1SGD I;  4UXI A;  1HDL A;  1UVF A;  2KMR A;  2SGP I;  2SGD I;  1TBQ R;  2JXD A;  2N17 A;  2F3C I;  3CXL A;  1BMO A;  3B4V C;  2ENZ A;  1CT4 I;  3OXL A;  3QTL D;  1DS3 I;  1LR7 A;  1CT0 I;  4L9M A;  3HH2 C;  1TBO A;  2WCY A;  1IW4 A;  3PDN A;  2JW6 A;  2KMO A;  4E1R A;  1TUS A;  2GVI A;  3UEY A;  3UGI A;  2OVO A;  2GKT I;  1V1I A;  2B8T A;  2DB6 A;  1V1H A;  3OL0 A;  1BUS A;  1PTR A;  1CSO I;  5FUX A;  3UGD A;  1AN1 I;  2DIP A;  1TBR R;  2ORW A;  4E1P A;  5HQ8 A;  2CJS C;  2GKV A;  4GI3 C;  3OXG A;  2E73 A;  2NU4 I;  5EX0 A;  1IY5 A;  2V1C C;  3KY9 A;  2J9R A;  2ARP F;  3UFF A;  5FUY A;  5CCL A;  1KBE A;  1SGN I;  3RU0 A;  1PCE A;  2LUY A;  1KBF A;  5CCM A;  1FYB A;  1OMT A;  1H0Z A;  1HJA I;  1TGS I;  2UZ3 A;  1DS2 I;  4OVO A;  1FAR A;  4A24 A;  2YUU A;  1TBN A;  4B6D A;  5EX3 A;  2J87 A;  2JYY A;  2VRW B;  2NU2 I;  1U5K A;  2FNF X;  1N13 A;  2SGQ I;  1CGJ I;  3TJQ A;  3UGL A;  1M8C A;  1SGY I;  1SGE I;  2A20 A;  2E5R A;  1PJU A;  1VDD A;  1XA6 A;  2ERW A;  3BJI A;  1OYV I;  3VE5 A;  1X74 A;  1HPT A;  3VDU A;  1CT2 I;  2QQC A;  1X4S A;  3UEJ A;  1RFH A;  2ROW A;  1Z7K B;  1R0R I;  2NU1 I;  3SEK C;  3FC3 A;  1CE3 A;  3OVO A;  4UXJ A;  2SGF I;  1OVO A;  1CGI I;  4HGU A;  2W0T A;  1Y1B A;  3SGQ I;  1LR9 A;  1UVG A;  2QQE A;  2QQ0 A;  1Y1C A;  1TUR A;  5FUW A;  1CHO I;  2P6A C;  2XRC A;  2ODD A;  2ELI A;  4FKD A;  3E2I A;  1LR8 A;  1MT1 A;  2OD1 A;  4UXH A;  1UUC A;  1IY6 A;  2NU0 I;  4SGB I;  1XX6 A;  1YTP A;  2L8E A;  2V53 A;  2KMQ A;  3MEK A;  3GOX A;  1TOT A;  2SGE I;  1W3S A;  1SGP I;  1PPF I;  2GKR I;  2N71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...