1TBRR

Crystal structure of insect derived double domain kazal inhibitor rhodniin in complex with thrombin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
EGGEPCACPHALHRVCGSDGETYSNPCTLNCAKFNGKPELVKVHDGPCEPDEDEDVCQECDGDEYKPVCGSDDITYDNNCRLECASISSSPGVELKHEGPCRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (serine protease/inhibitor)
molecule keywords THROMBIN
publication title Two heads are better than one: crystal structure of the insect derived double domain Kazal inhibitor rhodniin in complex with thrombin.
pubmed rcsb
source organism Rhodnius prolixus
total genus 27
structure length 103
sequence length 103
chains with identical sequence S
ec nomenclature
pdb deposition date 1995-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
R PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1tbrR02
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1tbrR01
1YTPA 2NU3I 2KMOA 2SGQI 2NU4I 1CHOI 1MT1A 4SGBI 2ERWA 1Y1BA 2SGFI 2V53A 1OMTA 1PJUA 1BUSA 1CT2I 2SGDI 1UVFA 1DS2I 1TBRR 3SGQI 2GKRI 1SGEI 1IW4A 1H0ZA 1TURA 2M5XA 1KMAA 1M8BA 2QQDA 1HPTA 1Z7KB 3SGBI 1LR8A 1PCEA 1TUSA 1UUCA 2BUSA 4OVOA 1DS3I 1SGQI 2GKVA 1LR7A 1OYVI 1HJAI 2N52A 4HGUA 1Y1CA 1SGDI 2F3CI 3HH2C 1OMUA 1UVGA 3OVOA 2KMRA 2P6AC 2OVOA 5DAEA 2KCXA 1R0RI 1AN1I 2GKTI 1IY6A 3TJQA 1IY5A 2ARPF 1SGRI 2SGEI 2QQCA 5JHWC 1SGYI 2NU0I 2KMPA 1FYBA 3B4VC 4GI3C 2JZMA 1CT0I 1TIHA 2N71A 2SGPI 1SGPI 2N17A 1TBQR 1PPFI 2JYYA 2WCYA 1YU6C 2B0UC 3SEKC 1OVOA 1M8CA 1LR9A 1SGNI 1NUBA 2NU2I 2JXDA 1CE3A 2XRCA 2KMQA 3QTLD 1HDLA 1BMOA 1N13A 1CSOI 2LEOA 1CGJI 1CGII 1CT4I 2NU1I 1TGSI
chains in the Genus database with same CATH superfamily
2OD1A 1YTPA 2NU3I 2JW6A 2Y0MA 2KMOA 2SGQI 3VDPA 1V1HA 5J8CA 5FUXA 2NU4I 1CHOI 3VE5A 1MT1A 1X74A 2ERWA 1WGCA 1Y8FA 2V1CC 4SGBI 1Y1BA 2CWHA 2SGFI 2WVJA 4UXJA 2V53A 3UGIA 4UXHA 1UHAA 1X4SA 2GVIA 3FSXA 3FSYA 3OXLA 3TOAA 2DIPA 1OMTA 2RIJA 1PJUA 1BUSA 3E59A 2L8EA 1CT2I 2SGDI 3QWPA 5J8FA 1UVFA 1W4RA 1DS2I 1K7TA 2OZUA 3E2IA 1TBRR 1K7VA 1XBTA 2GKRI 3SGQI 1SGEI 1FAQA 1S20A 3KY9A 1IW4A 2A20A 1TURA 2K9HA 4WP4A 5FUVA 1H0ZA 3UEJA 4UXIA 4E1RA 2M5XA 1PTQA 5EX3A 5HI7A 3PDNA 1Z2IA 1M8BA 2QQDA 1HPTA 2JA1A 1V1IA 4MPIA 1KMAA 3TO9A 1Z7KB 1HEVA 4JCVE 3SGBI 1LR8A 1PCEA 3CXLA 5FUYA 1MJBA 1TUSA 1UUCA 2CWGA 4FKDA 1MJ9A 2BUSA 4OVOA 1DS3I 1VDDA 2LB7A 1SGQI 2GKVA 3R5AA 1LR7A 3GOXA 2ODDA 1FARA 1OYVI 1ULNA 1HJAI 2YUUA 2QPOA 2N1AB 3OXFA 2N52A 2X3TA 4HGUA 1Y1CA 1SGDI 2F3CI 3HH2C 5E3RA 1OMUA 1UVGA 4AMLA 1Q9BA 2WGCA 3OVOA 2KMRA 2ELIA 2P6AC 2OVOA 5DAEA 3FC3A 1TOTA 2KCXA 2CWFA 2V1CA 1MJAA 1R0RI 4B6DA 1AN1I 1ULKA 3BJIA 2DB6A 4E1PA 2GKTI 1IY6A 3TJQA 2ORVA 1IY5A 2ARPF 1SGRI 3R5CA 2SGEI 2QQCA 4A24A 2RC4A 5JHWC 3VDUA 3UGDA 5E3PA 2YQPA 3QAHA 2QQ0A 5FUWA 1K7UA 2E5RA 1SGYI 2L7XA 5CCLA 1WTJA 2NU0I 2KMPA 1FYBA 3B4VC 2DKVA 4GI3C 4DNCA 1WGTA 1RFHA 1CT0I 2JZMA 1TIHA 2N71A 2SGPI 1P9GA 1SGPI 2N17A 2W0TA 3D00A 1TBQR 1PPFI 2JYYA 2WCYA 3UFFA 1YU6C 2ORWA 2GIVA 3TO6A 2B0UC 4L9MA 5EX0A 3SEKC 2J9RA 2OU2A 1OVOA 1M8CA 3UOEA 1LR9A 1SGNI 1U5KA 1NUBA 1XA6A 1PTRA 3R5DA 1W3SA 1WKXA 2E73A 2NU2I 3UGLA 2JXDA 3UEYA 7WGAA 1CE3A 1TBNA 1R79A 5HQ8A 2XRCA 2KMQA 2FNFX 2J87A 1XX6A 3QTLD 1ULMA 1FY7A 1HDLA 1NXUA 9WGAA 2QQEA 2VRWB 1BMOA 2ENZA 2PQ8A 5E3QA 1N13A 2CJSC 2ROWA 1CSOI 2UVOA 3TO7A 2ENNA 3MEKA 2LEOA 1CGJI 3OXGA 1CGII 3R5BA 1TBOA 1CT4I 3TOBA 3RU0A 5CCMA 2X52A 2UZ3A 3OL0A 1P9ZA 2B8TA 1KBFA 2NU1I 1KBEA 1TGSI 2LUYA
chains in the Genus database with same CATH topology
2OD1A 1YTPA 2NU3I 2JW6A 3VDPA 2KMOA 2SGQI 1V1HA 5FUXA 2NU4I 1CHOI 3VE5A 1MT1A 1X74A 2ERWA 1Y8FA 2V1CC 4SGBI 1Y1BA 2SGFI 4UXJA 2WVJA 3UGIA 2V53A 4UXHA 1X4SA 2GVIA 3OXLA 2DIPA 1OMTA 1PJUA 1BUSA 3E59A 2L8EA 1CT2I 2SGDI 3QWPA 1UVFA 1W4RA 1DS2I 3E2IA 1TBRR 1XBTA 3SGQI 2GKRI 1SGEI 1FAQA 3KY9A 1IW4A 2A20A 1TURA 2K9HA 1H0ZA 5FUVA 3UEJA 4UXIA 4E1RA 2M5XA 1PTQA 5EX3A 5HI7A 3PDNA 1KMAA 1M8BA 2QQDA 1HPTA 2JA1A 1V1IA 1Z7KB 4JCVE 3SGBI 1LR8A 1PCEA 3CXLA 5FUYA 1TUSA 1UUCA 4FKDA 2BUSA 4OVOA 1DS3I 1VDDA 1SGQI 2GKVA 3GOXA 1LR7A 2ODDA 1FARA 1OYVI 1HJAI 2YUUA 2QPOA 2N1AB 3OXFA 2N52A 4HGUA 1Y1CA 1SGDI 2F3CI 3HH2C 1OMUA 1UVGA 3OVOA 2KMRA 2ELIA 2P6AC 2OVOA 5DAEA 3FC3A 1TOTA 2KCXA 2V1CA 1R0RI 4B6DA 1AN1I 3BJIA 2DB6A 4E1PA 2GKTI 1IY6A 3TJQA 2ORVA 1IY5A 2ARPF 1SGRI 2SGEI 2QQCA 4A24A 5JHWC 3VDUA 3UGDA 2YQPA 2QQ0A 5FUWA 2E5RA 5CCLA 1SGYI 2L7XA 2NU0I 2KMPA 1FYBA 3B4VC 4GI3C 1RFHA 1CT0I 2JZMA 1TIHA 2N71A 2SGPI 1SGPI 2N17A 2W0TA 3D00A 1TBQR 1PPFI 2JYYA 2WCYA 3UFFA 1YU6C 2ORWA 2B0UC 4L9MA 5EX0A 3SEKC 2J9RA 1OVOA 1M8CA 1LR9A 1SGNI 1U5KA 1NUBA 1XA6A 1PTRA 1W3SA 2E73A 2NU2I 3UGLA 2JXDA 3UEYA 1CE3A 1TBNA 1R79A 5HQ8A 2XRCA 2KMQA 2FNFX 2J87A 1XX6A 3QTLD 1HDLA 2QQEA 2VRWB 1BMOA 2ENZA 1N13A 2CJSC 2ROWA 1CSOI 2ENNA 3MEKA 2LEOA 1CGJI 3OXGA 1CGII 5CCMA 1TBOA 1CT4I 3RU0A 2UZ3A 3OL0A 2B8TA 1KBFA 2NU1I 1KBEA 1TGSI 2LUYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YTP A;  2NU3 I;  2KMO A;  2SGQ I;  2NU4 I;  1CHO I;  1MT1 A;  4SGB I;  2ERW A;  1Y1B A;  2SGF I;  2V53 A;  1OMT A;  1PJU A;  1BUS A;  1CT2 I;  2SGD I;  1UVF A;  1DS2 I;  1TBR R;  3SGQ I;  2GKR I;  1SGE I;  1IW4 A;  1H0Z A;  1TUR A;  2M5X A;  1KMA A;  1M8B A;  2QQD A;  1HPT A;  1Z7K B;  3SGB I;  1LR8 A;  1PCE A;  1TUS A;  1UUC A;  2BUS A;  4OVO A;  1DS3 I;  1SGQ I;  2GKV A;  1LR7 A;  1OYV I;  1HJA I;  2N52 A;  4HGU A;  1Y1C A;  1SGD I;  2F3C I;  3HH2 C;  1OMU A;  1UVG A;  3OVO A;  2KMR A;  2P6A C;  2OVO A;  5DAE A;  2KCX A;  1R0R I;  1AN1 I;  2GKT I;  1IY6 A;  3TJQ A;  1IY5 A;  2ARP F;  1SGR I;  2SGE I;  2QQC A;  5JHW C;  1SGY I;  2NU0 I;  2KMP A;  1FYB A;  3B4V C;  4GI3 C;  2JZM A;  1CT0 I;  1TIH A;  2N71 A;  2SGP I;  1SGP I;  2N17 A;  1TBQ R;  1PPF I;  2JYY A;  2WCY A;  1YU6 C;  2B0U C;  3SEK C;  1OVO A;  1M8C A;  1LR9 A;  1SGN I;  1NUB A;  2NU2 I;  2JXD A;  1CE3 A;  2XRC A;  2KMQ A;  3QTL D;  1HDL A;  1BMO A;  1N13 A;  1CSO I;  2LEO A;  1CGJ I;  1CGI I;  1CT4 I;  2NU1 I;  1TGS I; 
#chains in the Genus database with same CATH topology
 2OD1 A;  1YTP A;  2NU3 I;  2JW6 A;  2Y0M A;  2KMO A;  2SGQ I;  3VDP A;  1V1H A;  5J8C A;  5FUX A;  2NU4 I;  1CHO I;  3VE5 A;  1MT1 A;  1X74 A;  2ERW A;  1WGC A;  1Y8F A;  2V1C C;  4SGB I;  1Y1B A;  2CWH A;  2SGF I;  2WVJ A;  4UXJ A;  2V53 A;  3UGI A;  4UXH A;  1UHA A;  1X4S A;  2GVI A;  3FSX A;  3FSY A;  3OXL A;  3TOA A;  2DIP A;  1OMT A;  2RIJ A;  1PJU A;  1BUS A;  3E59 A;  2L8E A;  1CT2 I;  2SGD I;  3QWP A;  5J8F A;  1UVF A;  1W4R A;  1DS2 I;  1K7T A;  2OZU A;  3E2I A;  1TBR R;  1K7V A;  1XBT A;  2GKR I;  3SGQ I;  1SGE I;  1FAQ A;  1S20 A;  3KY9 A;  1IW4 A;  2A20 A;  1TUR A;  2K9H A;  4WP4 A;  5FUV A;  1H0Z A;  3UEJ A;  4UXI A;  4E1R A;  2M5X A;  1PTQ A;  5EX3 A;  5HI7 A;  3PDN A;  1Z2I A;  1M8B A;  2QQD A;  1HPT A;  2JA1 A;  1V1I A;  4MPI A;  1KMA A;  3TO9 A;  1Z7K B;  1HEV A;  4JCV E;  3SGB I;  1LR8 A;  1PCE A;  3CXL A;  5FUY A;  1MJB A;  1TUS A;  1UUC A;  2CWG A;  4FKD A;  1MJ9 A;  2BUS A;  4OVO A;  1DS3 I;  1VDD A;  2LB7 A;  1SGQ I;  2GKV A;  3R5A A;  1LR7 A;  3GOX A;  2ODD A;  1FAR A;  1OYV I;  1ULN A;  1HJA I;  2YUU A;  2QPO A;  2N1A B;  3OXF A;  2N52 A;  2X3T A;  4HGU A;  1Y1C A;  1SGD I;  2F3C I;  3HH2 C;  5E3R A;  1OMU A;  1UVG A;  4AML A;  1Q9B A;  2WGC A;  3OVO A;  2KMR A;  2ELI A;  2P6A C;  2OVO A;  5DAE A;  3FC3 A;  1TOT A;  2KCX A;  2CWF A;  2V1C A;  1MJA A;  1R0R I;  4B6D A;  1AN1 I;  1ULK A;  3BJI A;  2DB6 A;  4E1P A;  2GKT I;  1IY6 A;  3TJQ A;  2ORV A;  1IY5 A;  2ARP F;  1SGR I;  3R5C A;  2SGE I;  2QQC A;  4A24 A;  2RC4 A;  5JHW C;  3VDU A;  3UGD A;  5E3P A;  2YQP A;  3QAH A;  2QQ0 A;  5FUW A;  1K7U A;  2E5R A;  1SGY I;  2L7X A;  5CCL A;  1WTJ A;  2NU0 I;  2KMP A;  1FYB A;  3B4V C;  2DKV A;  4GI3 C;  4DNC A;  1WGT A;  1RFH A;  1CT0 I;  2JZM A;  1TIH A;  2N71 A;  2SGP I;  1P9G A;  1SGP I;  2N17 A;  2W0T A;  3D00 A;  1TBQ R;  1PPF I;  2JYY A;  2WCY A;  3UFF A;  1YU6 C;  2ORW A;  2GIV A;  3TO6 A;  2B0U C;  4L9M A;  5EX0 A;  3SEK C;  2J9R A;  2OU2 A;  1OVO A;  1M8C A;  3UOE A;  1LR9 A;  1SGN I;  1U5K A;  1NUB A;  1XA6 A;  1PTR A;  3R5D A;  1W3S A;  1WKX A;  2E73 A;  2NU2 I;  3UGL A;  2JXD A;  3UEY A;  7WGA A;  1CE3 A;  1TBN A;  1R79 A;  5HQ8 A;  2XRC A;  2KMQ A;  2FNF X;  2J87 A;  1XX6 A;  3QTL D;  1ULM A;  1FY7 A;  1HDL A;  1NXU A;  9WGA A;  2QQE A;  2VRW B;  1BMO A;  2ENZ A;  2PQ8 A;  5E3Q A;  1N13 A;  2CJS C;  2ROW A;  1CSO I;  2UVO A;  3TO7 A;  2ENN A;  3MEK A;  2LEO A;  1CGJ I;  3OXG A;  1CGI I;  3R5B A;  1TBO A;  1CT4 I;  3TOB A;  3RU0 A;  5CCM A;  2X52 A;  2UZ3 A;  3OL0 A;  1P9Z A;  2B8T A;  1KBF A;  2NU1 I;  1KBE A;  1TGS I;  2LUY A; 
#chains in the Genus database with same CATH homology
 2OD1 A;  1YTP A;  2NU3 I;  2JW6 A;  3VDP A;  2KMO A;  2SGQ I;  1V1H A;  5FUX A;  2NU4 I;  1CHO I;  3VE5 A;  1MT1 A;  1X74 A;  2ERW A;  1Y8F A;  2V1C C;  4SGB I;  1Y1B A;  2SGF I;  4UXJ A;  2WVJ A;  3UGI A;  2V53 A;  4UXH A;  1X4S A;  2GVI A;  3OXL A;  2DIP A;  1OMT A;  1PJU A;  1BUS A;  3E59 A;  2L8E A;  1CT2 I;  2SGD I;  3QWP A;  1UVF A;  1W4R A;  1DS2 I;  3E2I A;  1TBR R;  1XBT A;  3SGQ I;  2GKR I;  1SGE I;  1FAQ A;  3KY9 A;  1IW4 A;  2A20 A;  1TUR A;  2K9H A;  1H0Z A;  5FUV A;  3UEJ A;  4UXI A;  4E1R A;  2M5X A;  1PTQ A;  5EX3 A;  5HI7 A;  3PDN A;  1KMA A;  1M8B A;  2QQD A;  1HPT A;  2JA1 A;  1V1I A;  1Z7K B;  4JCV E;  3SGB I;  1LR8 A;  1PCE A;  3CXL A;  5FUY A;  1TUS A;  1UUC A;  4FKD A;  2BUS A;  4OVO A;  1DS3 I;  1VDD A;  1SGQ I;  2GKV A;  3GOX A;  1LR7 A;  2ODD A;  1FAR A;  1OYV I;  1HJA I;  2YUU A;  2QPO A;  2N1A B;  3OXF A;  2N52 A;  4HGU A;  1Y1C A;  1SGD I;  2F3C I;  3HH2 C;  1OMU A;  1UVG A;  3OVO A;  2KMR A;  2ELI A;  2P6A C;  2OVO A;  5DAE A;  3FC3 A;  1TOT A;  2KCX A;  2V1C A;  1R0R I;  4B6D A;  1AN1 I;  3BJI A;  2DB6 A;  4E1P A;  2GKT I;  1IY6 A;  3TJQ A;  2ORV A;  1IY5 A;  2ARP F;  1SGR I;  2SGE I;  2QQC A;  4A24 A;  5JHW C;  3VDU A;  3UGD A;  2YQP A;  2QQ0 A;  5FUW A;  2E5R A;  5CCL A;  1SGY I;  2L7X A;  2NU0 I;  2KMP A;  1FYB A;  3B4V C;  4GI3 C;  1RFH A;  1CT0 I;  2JZM A;  1TIH A;  2N71 A;  2SGP I;  1SGP I;  2N17 A;  2W0T A;  3D00 A;  1TBQ R;  1PPF I;  2JYY A;  2WCY A;  3UFF A;  1YU6 C;  2ORW A;  2B0U C;  4L9M A;  5EX0 A;  3SEK C;  2J9R A;  1OVO A;  1M8C A;  1LR9 A;  1SGN I;  1U5K A;  1NUB A;  1XA6 A;  1PTR A;  1W3S A;  2E73 A;  2NU2 I;  3UGL A;  2JXD A;  3UEY A;  1CE3 A;  1TBN A;  1R79 A;  5HQ8 A;  2XRC A;  2KMQ A;  2FNF X;  2J87 A;  1XX6 A;  3QTL D;  1HDL A;  2QQE A;  2VRW B;  1BMO A;  2ENZ A;  1N13 A;  2CJS C;  2ROW A;  1CSO I;  2ENN A;  3MEK A;  2LEO A;  1CGJ I;  3OXG A;  1CGI I;  5CCM A;  1TBO A;  1CT4 I;  3RU0 A;  2UZ3 A;  3OL0 A;  2B8T A;  1KBF A;  2NU1 I;  1KBE A;  1TGS I;  2LUY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...