1TBRR

Crystal structure of insect derived double domain kazal inhibitor rhodniin in complex with thrombin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
b'EGGEPCACPHALHRVCGSDGETYSNPCTLNCAKFNGKPELVKVHDGPCEPDEDEDVCQECDGDEYKPVCGSDDITYDNNCRLECASISSSPGVELKHEGPCRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THROMBIN
publication title Two heads are better than one: crystal structure of the insect derived double domain Kazal inhibitor rhodniin in complex with thrombin.
pubmed rcsb
source organism Rhodnius prolixus
molecule tags Complex (serine protease/inhibitor)
total genus 27
structure length 103
sequence length 103
chains with identical sequence S
ec nomenclature
pdb deposition date 1995-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
R PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1tbrR02
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1tbrR01
1NUBA 1UVFA 2NU2I 1H0ZA 4SGBI 1CT2I 2B0UC 2GKVA 5DAEA 1FYBA 1AN1I 1DS3I 1TGSI 3SEKC 1CSOI 1CHOI 1KMAA 2V53A 2KMOA 2OVOA 1IW4A 1R0RI 1CT4I 1Y1CA 1SGRI 2JXDA 1CE3A 2KCXA 4OVOA 1SGPI 1CGII 3QTLD 1LR8A 1LR7A 1Y1BA 1TBQR 2NU4I 3B4VC 1BMOA 1HPTA 2BUSA 2JZMA 1YTPA 1PPFI 1UVGA 1SGYI 1LR9A 1HJAI 3SGQI 2M5XA 2LEOA 1M8CA 2SGQI 1OVOA 2SGPI 2SGDI 2NU0I 2JYYA 2XRCA 1TURA 2QQDA 1TUSA 1TBRR 2NU1I 4HGUA 1HDLA 1DS2I 2GKRI 1IY5A 1CT0I 1SGNI 2SGFI 2N17A 1YU6C 1TIHA 2N52A 3HH2C 4GI3C 2KMRA 1MT1A 1IY6A 2KMPA 1SGQI 2QQCA 5JHWC 1BUSA 1N13A 2ARPF 1PCEA 1SGDI 3OVOA 1M8BA 2NU3I 2N71A 2KMQA 2F3CI 1OYVI 1OMTA 3SGBI 3TJQA 2WCYA 2GKTI 2SGEI 2ERWA 1CGJI 1OMUA 1SGEI 1Z7KB 1UUCA 1PJUA 2P6AC
chains in the Genus database with same CATH superfamily
2E5RA 4UXIA 1NUBA 4L9MA 2CWFA 2V1CC 3TO9A 1UVFA 1V1IA 3VE5A 1R79A 2NU2I 1H0ZA 3KY9A 2ENZA 3D00A 4SGBI 1W4RA 1CT2I 2B0UC 2GKVA 3BJIA 1XBTA 1XX6A 5DAEA 2RIJA 3TO6A 1FYBA 1AN1I 1DS3I 1TGSI 5E3RA 1CSOI 2J9RA 3SEKC 1CHOI 3OXGA 5J8CA 2CWHA 1MJBA 1KMAA 1K7TA 2RC4A 2V53A 3QWPA 3R5CA 1HEVA 2KMOA 3R5BA 3VDUA 2OVOA 1IW4A 1WGCA 1R0RI 1CT4I 1Y1CA 1SGRI 2VRWB 2JXDA 3TOAA 2DB6A 2FNFX 4A24A 2DKVA 5FUYA 1Z2IA 3R5DA 1CE3A 5EX0A 2KCXA 2J87A 3OXFA 4OVOA 4FKDA 1SGPI 1CGII 3QTLD 3UFFA 1LR8A 2YQPA 1LR7A 1Y1BA 1TBQR 2CJSC 2NU4I 2WGCA 3B4VC 1S20A 1FAQA 2QQ0A 1BMOA 2A20A 1P9ZA 2DIPA 2OZUA 2PQ8A 1Q9BA 1HPTA 2BUSA 1FY7A 5E3PA 1KBEA 2JZMA 1YTPA 2OD1A 2ORWA 1PPFI 4MPIA 1PTQA 1UVGA 1SGYI 1HJAI 1LR9A 9WGAA 2GIVA 1X74A 3PDNA 5HI7A 3SGQI 2UVOA 4E1PA 1X4SA 2B8TA 2X52A 1K7VA 3UGIA 3FSXA 3OL0A 1ULNA 2M5XA 3QAHA 1RFHA 2ODDA 2LEOA 4WP4A 1WGTA 1M8CA 4AMLA 2L7XA 2SGQI 1OVOA 2SGPI 3UOEA 1MJAA 2SGDI 2NU0I 2GVIA 1TOTA 2JYYA 5J8FA 1K7UA 3GOXA 2XRCA 1U5KA 1XA6A 3UEJA 1TURA 1ULKA 2QQDA 1TUSA 2CWGA 5E3QA 4E1RA 5CCMA 1ULMA 1TBRR 1TBNA 5EX3A 2NU1I 3RU0A 1V1HA 4HGUA 5FUXA 2Y0MA 5FUVA 2ORVA 1DS2I 1HDLA 2GKRI 1IY5A 1CT0I 1SGNI 2QQEA 2L8EA 3MEKA 1VDDA 3UGDA 2E73A 3CXLA 2SGFI 2N17A 2X3TA 3E2IA 5CCLA 3VDPA 1YU6C 1TIHA 2ELIA 2N52A 1MJ9A 2N1AB 3HH2C 2KMRA 1MT1A 4GI3C 5FUWA 2OU2A 3FSYA 5HQ8A 1IY6A 2KMPA 1SGQI 1FARA 2ENNA 2QQCA 5JHWC 2LB7A 1BUSA 3OXLA 1TBOA 3FC3A 1N13A 2JA1A 2YUUA 3E59A 2ARPF 1PCEA 1SGDI 2W0TA 3UEYA 3OVOA 1WKXA 1NXUA 1M8BA 2NU3I 1WTJA 2N71A 4UXHA 4JCVE 2KMQA 4DNCA 7WGAA 2F3CI 1OYVI 3TOBA 1OMTA 1PTRA 1Y8FA 3SGBI 1W3SA 1P9GA 1UHAA 2QPOA 2WCYA 3TJQA 3TO7A 2V1CA 2GKTI 2SGEI 4UXJA 2ERWA 2LUYA 1CGJI 1OMUA 1SGEI 3UGLA 2WVJA 3R5AA 1Z7KB 2K9HA 2ROWA 1UUCA 1KBFA 2JW6A 1PJUA 2P6AC 4B6DA 2UZ3A
chains in the Genus database with same CATH topology
2E5RA 4UXIA 1NUBA 4L9MA 2V1CC 1UVFA 1V1IA 3VE5A 1R79A 2NU2I 1H0ZA 3KY9A 2ENZA 3D00A 4SGBI 1W4RA 1CT2I 2B0UC 2GKVA 3BJIA 1XBTA 1XX6A 5DAEA 1FYBA 1AN1I 1DS3I 1TGSI 3SEKC 1CSOI 2J9RA 1CHOI 3OXGA 1KMAA 2V53A 3QWPA 2KMOA 3VDUA 2OVOA 1IW4A 1R0RI 1CT4I 1Y1CA 1SGRI 2VRWB 2JXDA 4A24A 2DB6A 2FNFX 5FUYA 1CE3A 5EX0A 2KCXA 2J87A 3OXFA 4OVOA 4FKDA 1SGPI 1CGII 3QTLD 3UFFA 1LR8A 2YQPA 1LR7A 1Y1BA 1TBQR 2CJSC 2NU4I 3B4VC 1FAQA 2QQ0A 1BMOA 2A20A 2DIPA 1HPTA 2BUSA 1KBEA 2JZMA 1YTPA 2OD1A 2ORWA 1PPFI 1PTQA 1UVGA 1SGYI 1LR9A 1HJAI 5HI7A 1X74A 3PDNA 3SGQI 4E1PA 1X4SA 2B8TA 3UGIA 3OL0A 2M5XA 1RFHA 2ODDA 2LEOA 1M8CA 2L7XA 2SGQI 1OVOA 2SGPI 2SGDI 2NU0I 2GVIA 1TOTA 2JYYA 3GOXA 2XRCA 1U5KA 1XA6A 3UEJA 1TURA 2QQDA 1TUSA 4E1RA 5CCMA 1TBNA 1TBRR 5EX3A 3RU0A 2NU1I 1V1HA 4HGUA 5FUXA 5FUVA 1HDLA 2ORVA 1DS2I 2GKRI 1IY5A 1CT0I 1SGNI 2QQEA 2L8EA 3MEKA 1VDDA 3UGDA 2E73A 3CXLA 2SGFI 2N17A 3E2IA 5CCLA 3VDPA 1YU6C 1TIHA 2ELIA 2N52A 3HH2C 2N1AB 4GI3C 2KMRA 1MT1A 5FUWA 5HQ8A 1IY6A 2KMPA 1SGQI 1FARA 2ENNA 2QQCA 5JHWC 1BUSA 3OXLA 1TBOA 3FC3A 1N13A 2JA1A 2YUUA 3E59A 2ARPF 1PCEA 1SGDI 2W0TA 3UEYA 3OVOA 1M8BA 2NU3I 2N71A 4UXHA 4JCVE 2KMQA 2F3CI 1OYVI 1OMTA 1Y8FA 1PTRA 3SGBI 1W3SA 2QPOA 3TJQA 2WCYA 2V1CA 2GKTI 2SGEI 4UXJA 2ERWA 2LUYA 1CGJI 1OMUA 1SGEI 3UGLA 2WVJA 1Z7KB 2K9HA 2ROWA 1UUCA 1KBFA 2JW6A 1PJUA 2P6AC 4B6DA 2UZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NUB A;  1UVF A;  2NU2 I;  1H0Z A;  4SGB I;  1CT2 I;  2B0U C;  2GKV A;  5DAE A;  1FYB A;  1AN1 I;  1DS3 I;  1TGS I;  3SEK C;  1CSO I;  1CHO I;  1KMA A;  2V53 A;  2KMO A;  2OVO A;  1IW4 A;  1R0R I;  1CT4 I;  1Y1C A;  1SGR I;  2JXD A;  1CE3 A;  2KCX A;  4OVO A;  1SGP I;  1CGI I;  3QTL D;  1LR8 A;  1LR7 A;  1Y1B A;  1TBQ R;  2NU4 I;  3B4V C;  1BMO A;  1HPT A;  2BUS A;  2JZM A;  1YTP A;  1PPF I;  1UVG A;  1SGY I;  1LR9 A;  1HJA I;  3SGQ I;  2M5X A;  2LEO A;  1M8C A;  2SGQ I;  1OVO A;  2SGP I;  2SGD I;  2NU0 I;  2JYY A;  2XRC A;  1TUR A;  2QQD A;  1TUS A;  1TBR R;  2NU1 I;  4HGU A;  1HDL A;  1DS2 I;  2GKR I;  1IY5 A;  1CT0 I;  1SGN I;  2SGF I;  2N17 A;  1YU6 C;  1TIH A;  2N52 A;  3HH2 C;  4GI3 C;  2KMR A;  1MT1 A;  1IY6 A;  2KMP A;  1SGQ I;  2QQC A;  5JHW C;  1BUS A;  1N13 A;  2ARP F;  1PCE A;  1SGD I;  3OVO A;  1M8B A;  2NU3 I;  2N71 A;  2KMQ A;  2F3C I;  1OYV I;  1OMT A;  3SGB I;  3TJQ A;  2WCY A;  2GKT I;  2SGE I;  2ERW A;  1CGJ I;  1OMU A;  1SGE I;  1Z7K B;  1UUC A;  1PJU A;  2P6A C; 
#chains in the Genus database with same CATH topology
 2E5R A;  4UXI A;  1NUB A;  4L9M A;  2CWF A;  2V1C C;  3TO9 A;  1UVF A;  1V1I A;  3VE5 A;  1R79 A;  2NU2 I;  1H0Z A;  3KY9 A;  2ENZ A;  3D00 A;  4SGB I;  1W4R A;  1CT2 I;  2B0U C;  2GKV A;  3BJI A;  1XBT A;  1XX6 A;  5DAE A;  2RIJ A;  3TO6 A;  1FYB A;  1AN1 I;  1DS3 I;  1TGS I;  5E3R A;  1CSO I;  2J9R A;  3SEK C;  1CHO I;  3OXG A;  5J8C A;  2CWH A;  1MJB A;  1KMA A;  1K7T A;  2RC4 A;  2V53 A;  3QWP A;  3R5C A;  1HEV A;  2KMO A;  3R5B A;  3VDU A;  2OVO A;  1IW4 A;  1WGC A;  1R0R I;  1CT4 I;  1Y1C A;  1SGR I;  2VRW B;  2JXD A;  3TOA A;  2DB6 A;  2FNF X;  4A24 A;  2DKV A;  5FUY A;  1Z2I A;  3R5D A;  1CE3 A;  5EX0 A;  2KCX A;  2J87 A;  3OXF A;  4OVO A;  4FKD A;  1SGP I;  1CGI I;  3QTL D;  3UFF A;  1LR8 A;  2YQP A;  1LR7 A;  1Y1B A;  1TBQ R;  2CJS C;  2NU4 I;  2WGC A;  3B4V C;  1S20 A;  1FAQ A;  2QQ0 A;  1BMO A;  2A20 A;  1P9Z A;  2DIP A;  2OZU A;  2PQ8 A;  1Q9B A;  1HPT A;  2BUS A;  1FY7 A;  5E3P A;  1KBE A;  2JZM A;  1YTP A;  2OD1 A;  2ORW A;  1PPF I;  4MPI A;  1PTQ A;  1UVG A;  1SGY I;  1HJA I;  1LR9 A;  9WGA A;  2GIV A;  1X74 A;  3PDN A;  5HI7 A;  3SGQ I;  2UVO A;  4E1P A;  1X4S A;  2B8T A;  2X52 A;  1K7V A;  3UGI A;  3FSX A;  3OL0 A;  1ULN A;  2M5X A;  3QAH A;  1RFH A;  2ODD A;  2LEO A;  4WP4 A;  1WGT A;  1M8C A;  4AML A;  2L7X A;  2SGQ I;  1OVO A;  2SGP I;  3UOE A;  1MJA A;  2SGD I;  2NU0 I;  2GVI A;  1TOT A;  2JYY A;  5J8F A;  1K7U A;  3GOX A;  2XRC A;  1U5K A;  1XA6 A;  3UEJ A;  1TUR A;  1ULK A;  2QQD A;  1TUS A;  2CWG A;  5E3Q A;  4E1R A;  5CCM A;  1ULM A;  1TBR R;  1TBN A;  5EX3 A;  2NU1 I;  3RU0 A;  1V1H A;  4HGU A;  5FUX A;  2Y0M A;  5FUV A;  2ORV A;  1DS2 I;  1HDL A;  2GKR I;  1IY5 A;  1CT0 I;  1SGN I;  2QQE A;  2L8E A;  3MEK A;  1VDD A;  3UGD A;  2E73 A;  3CXL A;  2SGF I;  2N17 A;  2X3T A;  3E2I A;  5CCL A;  3VDP A;  1YU6 C;  1TIH A;  2ELI A;  2N52 A;  1MJ9 A;  2N1A B;  3HH2 C;  2KMR A;  1MT1 A;  4GI3 C;  5FUW A;  2OU2 A;  3FSY A;  5HQ8 A;  1IY6 A;  2KMP A;  1SGQ I;  1FAR A;  2ENN A;  2QQC A;  5JHW C;  2LB7 A;  1BUS A;  3OXL A;  1TBO A;  3FC3 A;  1N13 A;  2JA1 A;  2YUU A;  3E59 A;  2ARP F;  1PCE A;  1SGD I;  2W0T A;  3UEY A;  3OVO A;  1WKX A;  1NXU A;  1M8B A;  2NU3 I;  1WTJ A;  2N71 A;  4UXH A;  4JCV E;  2KMQ A;  4DNC A;  7WGA A;  2F3C I;  1OYV I;  3TOB A;  1OMT A;  1PTR A;  1Y8F A;  3SGB I;  1W3S A;  1P9G A;  1UHA A;  2QPO A;  2WCY A;  3TJQ A;  3TO7 A;  2V1C A;  2GKT I;  2SGE I;  4UXJ A;  2ERW A;  2LUY A;  1CGJ I;  1OMU A;  1SGE I;  3UGL A;  2WVJ A;  3R5A A;  1Z7K B;  2K9H A;  2ROW A;  1UUC A;  1KBF A;  2JW6 A;  1PJU A;  2P6A C;  4B6D A;  2UZ3 A; 
#chains in the Genus database with same CATH homology
 2E5R A;  4UXI A;  1NUB A;  4L9M A;  2V1C C;  1UVF A;  1V1I A;  3VE5 A;  1R79 A;  2NU2 I;  1H0Z A;  3KY9 A;  2ENZ A;  3D00 A;  4SGB I;  1W4R A;  1CT2 I;  2B0U C;  2GKV A;  3BJI A;  1XBT A;  1XX6 A;  5DAE A;  1FYB A;  1AN1 I;  1DS3 I;  1TGS I;  3SEK C;  1CSO I;  2J9R A;  1CHO I;  3OXG A;  1KMA A;  2V53 A;  3QWP A;  2KMO A;  3VDU A;  2OVO A;  1IW4 A;  1R0R I;  1CT4 I;  1Y1C A;  1SGR I;  2VRW B;  2JXD A;  4A24 A;  2DB6 A;  2FNF X;  5FUY A;  1CE3 A;  5EX0 A;  2KCX A;  2J87 A;  3OXF A;  4OVO A;  4FKD A;  1SGP I;  1CGI I;  3QTL D;  3UFF A;  1LR8 A;  2YQP A;  1LR7 A;  1Y1B A;  1TBQ R;  2CJS C;  2NU4 I;  3B4V C;  1FAQ A;  2QQ0 A;  1BMO A;  2A20 A;  2DIP A;  1HPT A;  2BUS A;  1KBE A;  2JZM A;  1YTP A;  2OD1 A;  2ORW A;  1PPF I;  1PTQ A;  1UVG A;  1SGY I;  1LR9 A;  1HJA I;  5HI7 A;  1X74 A;  3PDN A;  3SGQ I;  4E1P A;  1X4S A;  2B8T A;  3UGI A;  3OL0 A;  2M5X A;  1RFH A;  2ODD A;  2LEO A;  1M8C A;  2L7X A;  2SGQ I;  1OVO A;  2SGP I;  2SGD I;  2NU0 I;  2GVI A;  1TOT A;  2JYY A;  3GOX A;  2XRC A;  1U5K A;  1XA6 A;  3UEJ A;  1TUR A;  2QQD A;  1TUS A;  4E1R A;  5CCM A;  1TBN A;  1TBR R;  5EX3 A;  3RU0 A;  2NU1 I;  1V1H A;  4HGU A;  5FUX A;  5FUV A;  1HDL A;  2ORV A;  1DS2 I;  2GKR I;  1IY5 A;  1CT0 I;  1SGN I;  2QQE A;  2L8E A;  3MEK A;  1VDD A;  3UGD A;  2E73 A;  3CXL A;  2SGF I;  2N17 A;  3E2I A;  5CCL A;  3VDP A;  1YU6 C;  1TIH A;  2ELI A;  2N52 A;  3HH2 C;  2N1A B;  4GI3 C;  2KMR A;  1MT1 A;  5FUW A;  5HQ8 A;  1IY6 A;  2KMP A;  1SGQ I;  1FAR A;  2ENN A;  2QQC A;  5JHW C;  1BUS A;  3OXL A;  1TBO A;  3FC3 A;  1N13 A;  2JA1 A;  2YUU A;  3E59 A;  2ARP F;  1PCE A;  1SGD I;  2W0T A;  3UEY A;  3OVO A;  1M8B A;  2NU3 I;  2N71 A;  4UXH A;  4JCV E;  2KMQ A;  2F3C I;  1OYV I;  1OMT A;  1Y8F A;  1PTR A;  3SGB I;  1W3S A;  2QPO A;  3TJQ A;  2WCY A;  2V1C A;  2GKT I;  2SGE I;  4UXJ A;  2ERW A;  2LUY A;  1CGJ I;  1OMU A;  1SGE I;  3UGL A;  2WVJ A;  1Z7K B;  2K9H A;  2ROW A;  1UUC A;  1KBF A;  2JW6 A;  1PJU A;  2P6A C;  4B6D A;  2UZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...