2JYYA

Solution structure of c8a/c37a-t1 from nicotiana alata
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
53
structure length
53
Chain Sequence
DRICTNCAAGTKGCKYFSDDGTFVCEGESDPRNPKAAPRNCDPRIAYGICPLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Proteinase inhibitor
publication title Selective removal of individual disulfide bonds in the Nicotiana alata proteinase inhibitor T1 reveals different stabilisation of the reactive site loop
rcsb
source organism Nicotiana alata
total genus 11
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2007-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2jyyA00
1PPFI 1LR7A 2WCYA 2SGPI 1BUSA 1OMUA 1PJUA 2ARPF 2XRCA 2SGEI 1LR8A 4SGBI 1CT4I 1Y1CA 1SGRI 1CSOI 1SGYI 2JXDA 1TGSI 4HGUA 2LEOA 2V53A 2QQCA 1SGPI 2BUSA 3SGBI 2KCXA 1HDLA 1UUCA 5DAEA 3SGQI 1FYBA 3OVOA 2JYYA 2M5XA 2KMQA 1CGJI 1LR9A 1N13A 2SGFI 2KMRA 1DS2I 1IW4A 5JHWC 2P6AC 3SEKC 1CHOI 2NU2I 1BMOA 1AN1I 1CT0I 1SGDI 2N17A 1OVOA 4OVOA 1H0ZA 1UVFA 3QTLD 2N71A 2GKRI 1Y1BA 1OYVI 1SGNI 1TIHA 2GKVA 1CT2I 1IY6A 2NU3I 1TURA 1PCEA 1R0RI 1YU6C 2NU0I 4GI3C 2JZMA 1TBQR 1IY5A 2NU4I 1SGQI 1YTPA 1CE3A 1TBRR 2B0UC 2SGDI 2F3CI 1M8CA 2GKTI 2OVOA 1HPTA 1UVGA 2QQDA 2KMOA 1KMAA 1OMTA 3TJQA 2NU1I 1CGII 1NUBA 1MT1A 1Z7KB 2SGQI 3HH2C 1SGEI 1TUSA 2ERWA 1M8BA 1DS3I 1HJAI 3B4VC 2KMPA 2N52A
chains in the Genus database with same CATH superfamily
1PPFI 2CWFA 1LR7A 2J9RA 2WCYA 2OU2A 2SGPI 1MJ9A 1K7VA 1OMUA 1WKXA 1BUSA 3UFFA 1PJUA 4E1PA 2UZ3A 2ARPF 3TO6A 1Z2IA 2XRCA 2OZUA 3VDPA 2SGEI 1LR8A 2YQPA 4SGBI 1CT4I 1P9ZA 1Y1CA 1SGRI 2UVOA 1CSOI 5FUVA 1WGTA 3UGIA 1SGYI 1RFHA 2LUYA 2JXDA 1TGSI 5EX3A 1Y8FA 4HGUA 2LEOA 3VDUA 3VE5A 3R5BA 2V53A 2V1CC 5J8CA 3GOXA 1TOTA 2QQCA 1SGPI 4UXIA 3FSYA 1K7UA 3KY9A 1KBEA 2BUSA 1NXUA 2ENZA 1UHAA 2L7XA 2KCXA 3SGBI 2OD1A 2B8TA 1HDLA 3QAHA 1UUCA 5DAEA 3SGQI 4L9MA 1FY7A 5J8FA 5CCMA 1K7TA 1FYBA 3OVOA 1ULMA 2JYYA 2M5XA 2KMQA 1CGJI 1LR9A 1N13A 1VDDA 1W4RA 2J87A 3CXLA 1ULNA 3RU0A 3FC3A 2X3TA 2SGFI 4WP4A 3FSXA 2KMRA 3TOBA 2GIVA 5FUXA 1FARA 2CWHA 1DS2I 1X4SA 1IW4A 2E73A 5HI7A 5JHWC 2X52A 2P6AC 3SEKC 2WGCA 4UXJA 1V1HA 2ODDA 4B6DA 1CHOI 2NU2I 1BMOA 1AN1I 1CT0I 1ULKA 1SGDI 3TO7A 2RIJA 3R5CA 1FAQA 2N17A 4MPIA 2N1AB 4AMLA 2WVJA 1OVOA 4OVOA 3UEYA 1H0ZA 1UVFA 1WTJA 5HQ8A 3OXGA 3QTLD 2N71A 2E5RA 2GKRI 2LB7A 4JCVE 1Y1BA 1S20A 2V1CA 1OYVI 1V1IA 5EX0A 1SGNI 2GVIA 1TIHA 1HEVA 2GKVA 1CT2I 2A20A 3TOAA 3BJIA 1IY6A 2ELIA 2ORWA 2NU3I 2QQ0A 2KMPA 5FUYA 3UGDA 1TURA 2K9HA 3D00A 1KBFA 1PCEA 1U5KA 1R0RI 5E3PA 1Q9BA 1PTQA 1YU6C 2NU0I 3UOEA 2VRWB 2QQEA 2DIPA 1PTRA 1TBNA 2JZMA 1TBQR 4GI3C 1WGCA 3E59A 2NU4I 1IY5A 2QPOA 1SGQI 3OXLA 9WGAA 5E3RA 1W3SA 1YTPA 3UGLA 1TBOA 3TO9A 1MJAA 3E2IA 1TBRR 2B0UC 5FUWA 1CE3A 1R79A 2ENNA 1XBTA 2CWGA 4DNCA 2SGDI 2JW6A 2F3CI 1M8CA 2GKTI 2OVOA 1HPTA 1UVGA 2ROWA 2W0TA 2QQDA 3R5AA 4A24A 2KMOA 2Y0MA 1KMAA 1X74A 5E3QA 1OMTA 3R5DA 2NU1I 3MEKA 1CGII 3TJQA 3UEJA 2DB6A 2PQ8A 1NUBA 1MT1A 2YUUA 2L8EA 1Z7KB 2CJSC 3QWPA 2SGQI 1P9GA 3PDNA 1XA6A 2RC4A 4UXHA 7WGAA 5CCLA 3HH2C 1SGEI 1TUSA 1MJBA 2ERWA 2FNFX 4E1RA 2JA1A 3OXFA 2DKVA 1M8BA 4FKDA 1DS3I 1HJAI 2ORVA 3OL0A 3B4VC 1XX6A 2N52A
chains in the Genus database with same CATH topology
1PPFI 1LR7A 2J9RA 2WCYA 2SGPI 1BUSA 1OMUA 3UFFA 1PJUA 4E1PA 2UZ3A 2ARPF 2XRCA 3VDPA 2SGEI 1LR8A 2YQPA 4SGBI 1CT4I 1Y1CA 1SGRI 1CSOI 5FUVA 3UGIA 1SGYI 1RFHA 2LUYA 2JXDA 1TGSI 5EX3A 1Y8FA 4HGUA 2LEOA 3VDUA 3VE5A 3GOXA 2V53A 2V1CC 1TOTA 2QQCA 1SGPI 4UXIA 3KY9A 1KBEA 2BUSA 2ENZA 2L7XA 2KCXA 3SGBI 2OD1A 2B8TA 1HDLA 1UUCA 5DAEA 3SGQI 4L9MA 5CCMA 1FYBA 3OVOA 2JYYA 2M5XA 2KMQA 1CGJI 1LR9A 1N13A 1VDDA 1W4RA 2J87A 3CXLA 3RU0A 3FC3A 2SGFI 2KMRA 5FUXA 1FARA 1DS2I 1X4SA 1IW4A 2E73A 5HI7A 5JHWC 2P6AC 3SEKC 4UXJA 1V1HA 2ODDA 4B6DA 1CHOI 2NU2I 1BMOA 1AN1I 1CT0I 1SGDI 1FAQA 2N17A 2N1AB 2WVJA 1OVOA 4OVOA 3UEYA 1H0ZA 1UVFA 5HQ8A 3OXGA 3QTLD 2N71A 2E5RA 2GKRI 4JCVE 1Y1BA 2V1CA 1OYVI 1V1IA 5EX0A 1SGNI 2GVIA 1TIHA 2GKVA 1CT2I 2A20A 3BJIA 1IY6A 2ELIA 2ORWA 2NU3I 2QQ0A 2KMPA 5FUYA 3UGDA 1TURA 2K9HA 3D00A 1KBFA 1PCEA 1U5KA 1R0RI 1PTQA 1YU6C 2NU0I 2VRWB 2QQEA 2DIPA 1PTRA 1TBNA 2JZMA 1TBQR 4GI3C 3E59A 1IY5A 2NU4I 2QPOA 1SGQI 3OXLA 1W3SA 1YTPA 3UGLA 1TBOA 1CE3A 3E2IA 1TBRR 2B0UC 5FUWA 1R79A 2ENNA 1XBTA 2SGDI 2JW6A 2F3CI 1M8CA 2GKTI 2OVOA 1HPTA 1UVGA 2ROWA 2W0TA 2QQDA 4A24A 2KMOA 1KMAA 1X74A 1OMTA 3TJQA 2NU1I 3MEKA 1CGII 3UEJA 2DB6A 1NUBA 1MT1A 2YUUA 2L8EA 1Z7KB 2CJSC 3QWPA 2SGQI 3PDNA 1XA6A 4UXHA 5CCLA 3HH2C 1SGEI 1TUSA 4E1RA 2ERWA 2FNFX 2JA1A 3OXFA 1M8BA 4FKDA 1DS3I 1HJAI 2ORVA 3OL0A 3B4VC 1XX6A 2N52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PPF I;  1LR7 A;  2WCY A;  2SGP I;  1BUS A;  1OMU A;  1PJU A;  2ARP F;  2XRC A;  2SGE I;  1LR8 A;  4SGB I;  1CT4 I;  1Y1C A;  1SGR I;  1CSO I;  1SGY I;  2JXD A;  1TGS I;  4HGU A;  2LEO A;  2V53 A;  2QQC A;  1SGP I;  2BUS A;  3SGB I;  2KCX A;  1HDL A;  1UUC A;  5DAE A;  3SGQ I;  1FYB A;  3OVO A;  2JYY A;  2M5X A;  2KMQ A;  1CGJ I;  1LR9 A;  1N13 A;  2SGF I;  2KMR A;  1DS2 I;  1IW4 A;  5JHW C;  2P6A C;  3SEK C;  1CHO I;  2NU2 I;  1BMO A;  1AN1 I;  1CT0 I;  1SGD I;  2N17 A;  1OVO A;  4OVO A;  1H0Z A;  1UVF A;  3QTL D;  2N71 A;  2GKR I;  1Y1B A;  1OYV I;  1SGN I;  1TIH A;  2GKV A;  1CT2 I;  1IY6 A;  2NU3 I;  1TUR A;  1PCE A;  1R0R I;  1YU6 C;  2NU0 I;  4GI3 C;  2JZM A;  1TBQ R;  1IY5 A;  2NU4 I;  1SGQ I;  1YTP A;  1CE3 A;  1TBR R;  2B0U C;  2SGD I;  2F3C I;  1M8C A;  2GKT I;  2OVO A;  1HPT A;  1UVG A;  2QQD A;  2KMO A;  1KMA A;  1OMT A;  3TJQ A;  2NU1 I;  1CGI I;  1NUB A;  1MT1 A;  1Z7K B;  2SGQ I;  3HH2 C;  1SGE I;  1TUS A;  2ERW A;  1M8B A;  1DS3 I;  1HJA I;  3B4V C;  2KMP A;  2N52 A; 
#chains in the Genus database with same CATH topology
 1PPF I;  2CWF A;  1LR7 A;  2J9R A;  2WCY A;  2OU2 A;  2SGP I;  1MJ9 A;  1K7V A;  1OMU A;  1WKX A;  1BUS A;  3UFF A;  1PJU A;  4E1P A;  2UZ3 A;  2ARP F;  3TO6 A;  1Z2I A;  2XRC A;  2OZU A;  3VDP A;  2SGE I;  1LR8 A;  2YQP A;  4SGB I;  1CT4 I;  1P9Z A;  1Y1C A;  1SGR I;  2UVO A;  1CSO I;  5FUV A;  1WGT A;  3UGI A;  1SGY I;  1RFH A;  2LUY A;  2JXD A;  1TGS I;  5EX3 A;  1Y8F A;  4HGU A;  2LEO A;  3VDU A;  3VE5 A;  3R5B A;  2V53 A;  2V1C C;  5J8C A;  3GOX A;  1TOT A;  2QQC A;  1SGP I;  4UXI A;  3FSY A;  1K7U A;  3KY9 A;  1KBE A;  2BUS A;  1NXU A;  2ENZ A;  1UHA A;  2L7X A;  2KCX A;  3SGB I;  2OD1 A;  2B8T A;  1HDL A;  3QAH A;  1UUC A;  5DAE A;  3SGQ I;  4L9M A;  1FY7 A;  5J8F A;  5CCM A;  1K7T A;  1FYB A;  3OVO A;  1ULM A;  2JYY A;  2M5X A;  2KMQ A;  1CGJ I;  1LR9 A;  1N13 A;  1VDD A;  1W4R A;  2J87 A;  3CXL A;  1ULN A;  3RU0 A;  3FC3 A;  2X3T A;  2SGF I;  4WP4 A;  3FSX A;  2KMR A;  3TOB A;  2GIV A;  5FUX A;  1FAR A;  2CWH A;  1DS2 I;  1X4S A;  1IW4 A;  2E73 A;  5HI7 A;  5JHW C;  2X52 A;  2P6A C;  3SEK C;  2WGC A;  4UXJ A;  1V1H A;  2ODD A;  4B6D A;  1CHO I;  2NU2 I;  1BMO A;  1AN1 I;  1CT0 I;  1ULK A;  1SGD I;  3TO7 A;  2RIJ A;  3R5C A;  1FAQ A;  2N17 A;  4MPI A;  2N1A B;  4AML A;  2WVJ A;  1OVO A;  4OVO A;  3UEY A;  1H0Z A;  1UVF A;  1WTJ A;  5HQ8 A;  3OXG A;  3QTL D;  2N71 A;  2E5R A;  2GKR I;  2LB7 A;  4JCV E;  1Y1B A;  1S20 A;  2V1C A;  1OYV I;  1V1I A;  5EX0 A;  1SGN I;  2GVI A;  1TIH A;  1HEV A;  2GKV A;  1CT2 I;  2A20 A;  3TOA A;  3BJI A;  1IY6 A;  2ELI A;  2ORW A;  2NU3 I;  2QQ0 A;  2KMP A;  5FUY A;  3UGD A;  1TUR A;  2K9H A;  3D00 A;  1KBF A;  1PCE A;  1U5K A;  1R0R I;  5E3P A;  1Q9B A;  1PTQ A;  1YU6 C;  2NU0 I;  3UOE A;  2VRW B;  2QQE A;  2DIP A;  1PTR A;  1TBN A;  2JZM A;  1TBQ R;  4GI3 C;  1WGC A;  3E59 A;  2NU4 I;  1IY5 A;  2QPO A;  1SGQ I;  3OXL A;  9WGA A;  5E3R A;  1W3S A;  1YTP A;  3UGL A;  1TBO A;  3TO9 A;  1MJA A;  3E2I A;  1TBR R;  2B0U C;  5FUW A;  1CE3 A;  1R79 A;  2ENN A;  1XBT A;  2CWG A;  4DNC A;  2SGD I;  2JW6 A;  2F3C I;  1M8C A;  2GKT I;  2OVO A;  1HPT A;  1UVG A;  2ROW A;  2W0T A;  2QQD A;  3R5A A;  4A24 A;  2KMO A;  2Y0M A;  1KMA A;  1X74 A;  5E3Q A;  1OMT A;  3R5D A;  2NU1 I;  3MEK A;  1CGI I;  3TJQ A;  3UEJ A;  2DB6 A;  2PQ8 A;  1NUB A;  1MT1 A;  2YUU A;  2L8E A;  1Z7K B;  2CJS C;  3QWP A;  2SGQ I;  1P9G A;  3PDN A;  1XA6 A;  2RC4 A;  4UXH A;  7WGA A;  5CCL A;  3HH2 C;  1SGE I;  1TUS A;  1MJB A;  2ERW A;  2FNF X;  4E1R A;  2JA1 A;  3OXF A;  2DKV A;  1M8B A;  4FKD A;  1DS3 I;  1HJA I;  2ORV A;  3OL0 A;  3B4V C;  1XX6 A;  2N52 A; 
#chains in the Genus database with same CATH homology
 1PPF I;  1LR7 A;  2J9R A;  2WCY A;  2SGP I;  1BUS A;  1OMU A;  3UFF A;  1PJU A;  4E1P A;  2UZ3 A;  2ARP F;  2XRC A;  3VDP A;  2SGE I;  1LR8 A;  2YQP A;  4SGB I;  1CT4 I;  1Y1C A;  1SGR I;  1CSO I;  5FUV A;  3UGI A;  1SGY I;  1RFH A;  2LUY A;  2JXD A;  1TGS I;  5EX3 A;  1Y8F A;  4HGU A;  2LEO A;  3VDU A;  3VE5 A;  3GOX A;  2V53 A;  2V1C C;  1TOT A;  2QQC A;  1SGP I;  4UXI A;  3KY9 A;  1KBE A;  2BUS A;  2ENZ A;  2L7X A;  2KCX A;  3SGB I;  2OD1 A;  2B8T A;  1HDL A;  1UUC A;  5DAE A;  3SGQ I;  4L9M A;  5CCM A;  1FYB A;  3OVO A;  2JYY A;  2M5X A;  2KMQ A;  1CGJ I;  1LR9 A;  1N13 A;  1VDD A;  1W4R A;  2J87 A;  3CXL A;  3RU0 A;  3FC3 A;  2SGF I;  2KMR A;  5FUX A;  1FAR A;  1DS2 I;  1X4S A;  1IW4 A;  2E73 A;  5HI7 A;  5JHW C;  2P6A C;  3SEK C;  4UXJ A;  1V1H A;  2ODD A;  4B6D A;  1CHO I;  2NU2 I;  1BMO A;  1AN1 I;  1CT0 I;  1SGD I;  1FAQ A;  2N17 A;  2N1A B;  2WVJ A;  1OVO A;  4OVO A;  3UEY A;  1H0Z A;  1UVF A;  5HQ8 A;  3OXG A;  3QTL D;  2N71 A;  2E5R A;  2GKR I;  4JCV E;  1Y1B A;  2V1C A;  1OYV I;  1V1I A;  5EX0 A;  1SGN I;  2GVI A;  1TIH A;  2GKV A;  1CT2 I;  2A20 A;  3BJI A;  1IY6 A;  2ELI A;  2ORW A;  2NU3 I;  2QQ0 A;  2KMP A;  5FUY A;  3UGD A;  1TUR A;  2K9H A;  3D00 A;  1KBF A;  1PCE A;  1U5K A;  1R0R I;  1PTQ A;  1YU6 C;  2NU0 I;  2VRW B;  2QQE A;  2DIP A;  1PTR A;  1TBN A;  2JZM A;  1TBQ R;  4GI3 C;  3E59 A;  1IY5 A;  2NU4 I;  2QPO A;  1SGQ I;  3OXL A;  1W3S A;  1YTP A;  3UGL A;  1TBO A;  1CE3 A;  3E2I A;  1TBR R;  2B0U C;  5FUW A;  1R79 A;  2ENN A;  1XBT A;  2SGD I;  2JW6 A;  2F3C I;  1M8C A;  2GKT I;  2OVO A;  1HPT A;  1UVG A;  2ROW A;  2W0T A;  2QQD A;  4A24 A;  2KMO A;  1KMA A;  1X74 A;  1OMT A;  3TJQ A;  2NU1 I;  3MEK A;  1CGI I;  3UEJ A;  2DB6 A;  1NUB A;  1MT1 A;  2YUU A;  2L8E A;  1Z7K B;  2CJS C;  3QWP A;  2SGQ I;  3PDN A;  1XA6 A;  4UXH A;  5CCL A;  3HH2 C;  1SGE I;  1TUS A;  4E1R A;  2ERW A;  2FNF X;  2JA1 A;  3OXF A;  1M8B A;  4FKD A;  1DS3 I;  1HJA I;  2ORV A;  3OL0 A;  3B4V C;  1XX6 A;  2N52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...