2JYYA

Solution structure of c8a/c37a-t1 from nicotiana alata
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
53
structure length
53
Chain Sequence
DRICTNCAAGTKGCKYFSDDGTFVCEGESDPRNPKAAPRNCDPRIAYGICPLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase inhibitor
publication title Selective removal of individual disulfide bonds in the Nicotiana alata proteinase inhibitor T1 reveals different stabilisation of the reactive site loop
rcsb
source organism Nicotiana alata
molecule tags Hydrolase inhibitor
total genus 11
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2007-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2jyyA00
1KMAA 4HGUA 1HDLA 2OVOA 1Y1CA 2SGPI 1CT2I 2SGEI 1SGNI 3SEKC 1LR7A 1OYVI 1PJUA 2KMPA 3TJQA 1PCEA 2JZMA 1HJAI 2NU2I 1H0ZA 1N13A 4OVOA 2F3CI 1CHOI 1AN1I 1LR9A 1YTPA 2KMQA 1Z7KB 1CT0I 1CSOI 2JXDA 3B4VC 2GKTI 2NU0I 1R0RI 1DS2I 2ARPF 2N52A 2N71A 1SGEI 1M8BA 2NU1I 1TGSI 2ERWA 2LEOA 1IY5A 4SGBI 2GKVA 1CGJI 1SGRI 1TIHA 1IW4A 1OMUA 2JYYA 1SGDI 3QTLD 3OVOA 2XRCA 1UUCA 2WCYA 1M8CA 1UVGA 1FYBA 1BMOA 1SGPI 4GI3C 1UVFA 2QQDA 2N17A 2SGFI 1BUSA 2B0UC 2GKRI 1CT4I 1HPTA 1TBRR 1OMTA 2P6AC 2NU4I 3HH2C 1OVOA 1CE3A 1DS3I 2SGDI 1SGQI 2SGQI 1MT1A 2V53A 1Y1BA 1LR8A 5JHWC 1TUSA 2QQCA 1CGII 3SGBI 2BUSA 1NUBA 5DAEA 1TBQR 1SGYI 1PPFI 2KMRA 2NU3I 3SGQI 1TURA 2M5XA 2KCXA 1IY6A 2KMOA 1YU6C
chains in the Genus database with same CATH superfamily
2QQ0A 2L7XA 2CWGA 3QAHA 2ENZA 2L8EA 3UEJA 1Q9BA 1KMAA 4HGUA 1HDLA 3KY9A 1K7VA 2LUYA 2OVOA 1ULNA 1Y1CA 2YUUA 2ODDA 3VDPA 2SGPI 1CT2I 2WGCA 3QWPA 1W4RA 2SGEI 1SGNI 3SEKC 1LR7A 1OYVI 1PJUA 3GOXA 2KMPA 5J8CA 2DIPA 2ENNA 3TJQA 1PCEA 3TOAA 5EX3A 2JZMA 4E1RA 1HJAI 2NU2I 1XX6A 3UGIA 1H0ZA 2J9RA 1N13A 1WTJA 2WVJA 3PDNA 1FARA 2E5RA 3R5AA 1FAQA 1VDDA 1P9GA 3R5BA 4OVOA 1TBOA 2F3CI 3UGLA 2GIVA 1CHOI 9WGAA 1AN1I 1LR9A 2JA1A 3R5CA 1YTPA 2KMQA 1Y8FA 1Z7KB 4UXJA 1WGTA 5CCMA 1CT0I 1FY7A 3UGDA 1CSOI 3E59A 2JXDA 3B4VC 4B6DA 4AMLA 2GKTI 2NU0I 5HI7A 1WKXA 1R0RI 1TBNA 4UXIA 1DS2I 5FUYA 2UVOA 2ARPF 2X52A 5CCLA 2N52A 2N71A 2X3TA 4E1PA 7WGAA 2ROWA 3UEYA 5HQ8A 2QPOA 3OL0A 3VDUA 1SGEI 1M8BA 2NU1I 2FNFX 1TGSI 2ERWA 2LEOA 1IY5A 3TOBA 4SGBI 2GKVA 1CGJI 1SGRI 1TIHA 2ORWA 1OMUA 1S20A 2V1CA 2JYYA 3TO7A 1IW4A 1SGDI 3QTLD 1UHAA 1R79A 3FSXA 3OVOA 5E3RA 3RU0A 2QQEA 2N1AB 2XRCA 1KBFA 1UUCA 2OU2A 2WCYA 1K7UA 3E2IA 1M8CA 1UVGA 2CWFA 1FYBA 1BMOA 1SGPI 1X74A 2Y0MA 1XBTA 3MEKA 4GI3C 5FUVA 3UFFA 1UVFA 2QQDA 4WP4A 1X4SA 2JW6A 2K9HA 2N17A 2SGFI 3BJIA 1ULKA 1BUSA 2B0UC 2GKRI 1CT4I 1V1HA 1HPTA 1TBRR 1MJ9A 1OMTA 2P6AC 2NU4I 3D00A 3OXGA 3HH2C 2VRWB 3TO9A 1OVOA 1CE3A 1DS3I 2SGDI 1SGQI 2SGQI 1MT1A 2V53A 2PQ8A 1K7TA 1Y1BA 2E73A 2RC4A 2V1CC 1KBEA 1W3SA 1Z2IA 1WGCA 2LB7A 1LR8A 5JHWC 1TUSA 2CWHA 1PTRA 4L9MA 5EX0A 3TO6A 1MJBA 5J8FA 2GVIA 2QQCA 1NXUA 2DKVA 1CGII 1U5KA 2W0TA 2BUSA 1NUBA 2CJSC 1TBQR 2DB6A 1TOTA 5DAEA 5E3PA 3SGBI 5E3QA 1SGYI 1PPFI 3CXLA 2ORVA 4UXHA 2KMRA 2NU3I 4DNCA 3VE5A 2YQPA 1V1IA 3SGQI 5FUXA 1TURA 2A20A 3OXLA 3UOEA 4FKDA 1PTQA 3OXFA 5FUWA 4MPIA 2M5XA 2ELIA 3FSYA 2B8TA 2KCXA 2OD1A 1ULMA 1IY6A 1MJAA 2J87A 2KMOA 3FC3A 2RIJA 1RFHA 2OZUA 1XA6A 1P9ZA 4A24A 1YU6C 3R5DA 4JCVE 1HEVA 2UZ3A
chains in the Genus database with same CATH topology
2QQ0A 2L7XA 2ENZA 2L8EA 3UEJA 1KMAA 4HGUA 1HDLA 3KY9A 2LUYA 2OVOA 2YUUA 1Y1CA 2ODDA 3VDPA 2SGPI 1CT2I 3QWPA 1W4RA 2SGEI 1SGNI 3SEKC 1LR7A 1OYVI 1PJUA 3GOXA 2KMPA 2DIPA 2ENNA 3TJQA 1PCEA 5EX3A 2JZMA 4E1RA 1HJAI 2NU2I 1XX6A 3UGIA 1H0ZA 2J9RA 1N13A 2WVJA 3PDNA 1FARA 2E5RA 1FAQA 1VDDA 4OVOA 1TBOA 2F3CI 3UGLA 1CHOI 1AN1I 1LR9A 2JA1A 1YTPA 2KMQA 1Y8FA 1Z7KB 4UXJA 5CCMA 1CT0I 3UGDA 1CSOI 3E59A 2JXDA 3B4VC 4B6DA 2GKTI 2NU0I 5HI7A 1R0RI 1TBNA 4UXIA 1DS2I 5FUYA 5CCLA 2ARPF 2N52A 2N71A 4E1PA 2ROWA 3UEYA 5HQ8A 2QPOA 3OL0A 3VDUA 1SGEI 1M8BA 2NU1I 2FNFX 1TGSI 2ERWA 2LEOA 1IY5A 4SGBI 2GKVA 1CGJI 1SGRI 1TIHA 2ORWA 1OMUA 2V1CA 1IW4A 2JYYA 1SGDI 3QTLD 3OVOA 1R79A 3RU0A 2QQEA 2N1AB 2XRCA 1KBFA 1UUCA 2WCYA 3E2IA 1M8CA 1UVGA 1FYBA 1BMOA 1SGPI 1X74A 3UFFA 1XBTA 3MEKA 4GI3C 5FUVA 1UVFA 2QQDA 1X4SA 2JW6A 2K9HA 2N17A 2SGFI 3BJIA 1BUSA 2B0UC 2GKRI 1CT4I 1V1HA 1HPTA 1TBRR 1OMTA 2P6AC 2NU4I 3D00A 3OXGA 3HH2C 2VRWB 1OVOA 1CE3A 1DS3I 2SGDI 1SGQI 2SGQI 1MT1A 2V53A 1Y1BA 2E73A 2V1CC 1KBEA 1W3SA 1LR8A 5JHWC 1TUSA 4L9MA 1PTRA 5EX0A 2GVIA 2QQCA 1CGII 1U5KA 2W0TA 2BUSA 1NUBA 2CJSC 1TBQR 2DB6A 1TOTA 5DAEA 3SGBI 1SGYI 1PPFI 3CXLA 2ORVA 4UXHA 2KMRA 2NU3I 3VE5A 2YQPA 1V1IA 3SGQI 5FUXA 1TURA 2A20A 3OXLA 4FKDA 1PTQA 3OXFA 5FUWA 2M5XA 2ELIA 2B8TA 2KCXA 2OD1A 1IY6A 2J87A 2KMOA 3FC3A 1RFHA 1XA6A 4A24A 1YU6C 4JCVE 2UZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KMA A;  4HGU A;  1HDL A;  2OVO A;  1Y1C A;  2SGP I;  1CT2 I;  2SGE I;  1SGN I;  3SEK C;  1LR7 A;  1OYV I;  1PJU A;  2KMP A;  3TJQ A;  1PCE A;  2JZM A;  1HJA I;  2NU2 I;  1H0Z A;  1N13 A;  4OVO A;  2F3C I;  1CHO I;  1AN1 I;  1LR9 A;  1YTP A;  2KMQ A;  1Z7K B;  1CT0 I;  1CSO I;  2JXD A;  3B4V C;  2GKT I;  2NU0 I;  1R0R I;  1DS2 I;  2ARP F;  2N52 A;  2N71 A;  1SGE I;  1M8B A;  2NU1 I;  1TGS I;  2ERW A;  2LEO A;  1IY5 A;  4SGB I;  2GKV A;  1CGJ I;  1SGR I;  1TIH A;  1IW4 A;  1OMU A;  2JYY A;  1SGD I;  3QTL D;  3OVO A;  2XRC A;  1UUC A;  2WCY A;  1M8C A;  1UVG A;  1FYB A;  1BMO A;  1SGP I;  4GI3 C;  1UVF A;  2QQD A;  2N17 A;  2SGF I;  1BUS A;  2B0U C;  2GKR I;  1CT4 I;  1HPT A;  1TBR R;  1OMT A;  2P6A C;  2NU4 I;  3HH2 C;  1OVO A;  1CE3 A;  1DS3 I;  2SGD I;  1SGQ I;  2SGQ I;  1MT1 A;  2V53 A;  1Y1B A;  1LR8 A;  5JHW C;  1TUS A;  2QQC A;  1CGI I;  3SGB I;  2BUS A;  1NUB A;  5DAE A;  1TBQ R;  1SGY I;  1PPF I;  2KMR A;  2NU3 I;  3SGQ I;  1TUR A;  2M5X A;  2KCX A;  1IY6 A;  2KMO A;  1YU6 C; 
#chains in the Genus database with same CATH topology
 2QQ0 A;  2L7X A;  2CWG A;  3QAH A;  2ENZ A;  2L8E A;  3UEJ A;  1Q9B A;  1KMA A;  4HGU A;  1HDL A;  3KY9 A;  1K7V A;  2LUY A;  2OVO A;  1ULN A;  1Y1C A;  2YUU A;  2ODD A;  3VDP A;  2SGP I;  1CT2 I;  2WGC A;  3QWP A;  1W4R A;  2SGE I;  1SGN I;  3SEK C;  1LR7 A;  1OYV I;  1PJU A;  3GOX A;  2KMP A;  5J8C A;  2DIP A;  2ENN A;  3TJQ A;  1PCE A;  3TOA A;  5EX3 A;  2JZM A;  4E1R A;  1HJA I;  2NU2 I;  1XX6 A;  3UGI A;  1H0Z A;  2J9R A;  1N13 A;  1WTJ A;  2WVJ A;  3PDN A;  1FAR A;  2E5R A;  3R5A A;  1FAQ A;  1VDD A;  1P9G A;  3R5B A;  4OVO A;  1TBO A;  2F3C I;  3UGL A;  2GIV A;  1CHO I;  9WGA A;  1AN1 I;  1LR9 A;  2JA1 A;  3R5C A;  1YTP A;  2KMQ A;  1Y8F A;  1Z7K B;  4UXJ A;  1WGT A;  5CCM A;  1CT0 I;  1FY7 A;  3UGD A;  1CSO I;  3E59 A;  2JXD A;  3B4V C;  4B6D A;  4AML A;  2GKT I;  2NU0 I;  5HI7 A;  1WKX A;  1R0R I;  1TBN A;  4UXI A;  1DS2 I;  5FUY A;  2UVO A;  2ARP F;  2X52 A;  5CCL A;  2N52 A;  2N71 A;  2X3T A;  4E1P A;  7WGA A;  2ROW A;  3UEY A;  5HQ8 A;  2QPO A;  3OL0 A;  3VDU A;  1SGE I;  1M8B A;  2NU1 I;  2FNF X;  1TGS I;  2ERW A;  2LEO A;  1IY5 A;  3TOB A;  4SGB I;  2GKV A;  1CGJ I;  1SGR I;  1TIH A;  2ORW A;  1OMU A;  1S20 A;  2V1C A;  2JYY A;  3TO7 A;  1IW4 A;  1SGD I;  3QTL D;  1UHA A;  1R79 A;  3FSX A;  3OVO A;  5E3R A;  3RU0 A;  2QQE A;  2N1A B;  2XRC A;  1KBF A;  1UUC A;  2OU2 A;  2WCY A;  1K7U A;  3E2I A;  1M8C A;  1UVG A;  2CWF A;  1FYB A;  1BMO A;  1SGP I;  1X74 A;  2Y0M A;  1XBT A;  3MEK A;  4GI3 C;  5FUV A;  3UFF A;  1UVF A;  2QQD A;  4WP4 A;  1X4S A;  2JW6 A;  2K9H A;  2N17 A;  2SGF I;  3BJI A;  1ULK A;  1BUS A;  2B0U C;  2GKR I;  1CT4 I;  1V1H A;  1HPT A;  1TBR R;  1MJ9 A;  1OMT A;  2P6A C;  2NU4 I;  3D00 A;  3OXG A;  3HH2 C;  2VRW B;  3TO9 A;  1OVO A;  1CE3 A;  1DS3 I;  2SGD I;  1SGQ I;  2SGQ I;  1MT1 A;  2V53 A;  2PQ8 A;  1K7T A;  1Y1B A;  2E73 A;  2RC4 A;  2V1C C;  1KBE A;  1W3S A;  1Z2I A;  1WGC A;  2LB7 A;  1LR8 A;  5JHW C;  1TUS A;  2CWH A;  1PTR A;  4L9M A;  5EX0 A;  3TO6 A;  1MJB A;  5J8F A;  2GVI A;  2QQC A;  1NXU A;  2DKV A;  1CGI I;  1U5K A;  2W0T A;  2BUS A;  1NUB A;  2CJS C;  1TBQ R;  2DB6 A;  1TOT A;  5DAE A;  5E3P A;  3SGB I;  5E3Q A;  1SGY I;  1PPF I;  3CXL A;  2ORV A;  4UXH A;  2KMR A;  2NU3 I;  4DNC A;  3VE5 A;  2YQP A;  1V1I A;  3SGQ I;  5FUX A;  1TUR A;  2A20 A;  3OXL A;  3UOE A;  4FKD A;  1PTQ A;  3OXF A;  5FUW A;  4MPI A;  2M5X A;  2ELI A;  3FSY A;  2B8T A;  2KCX A;  2OD1 A;  1ULM A;  1IY6 A;  1MJA A;  2J87 A;  2KMO A;  3FC3 A;  2RIJ A;  1RFH A;  2OZU A;  1XA6 A;  1P9Z A;  4A24 A;  1YU6 C;  3R5D A;  4JCV E;  1HEV A;  2UZ3 A; 
#chains in the Genus database with same CATH homology
 2QQ0 A;  2L7X A;  2ENZ A;  2L8E A;  3UEJ A;  1KMA A;  4HGU A;  1HDL A;  3KY9 A;  2LUY A;  2OVO A;  2YUU A;  1Y1C A;  2ODD A;  3VDP A;  2SGP I;  1CT2 I;  3QWP A;  1W4R A;  2SGE I;  1SGN I;  3SEK C;  1LR7 A;  1OYV I;  1PJU A;  3GOX A;  2KMP A;  2DIP A;  2ENN A;  3TJQ A;  1PCE A;  5EX3 A;  2JZM A;  4E1R A;  1HJA I;  2NU2 I;  1XX6 A;  3UGI A;  1H0Z A;  2J9R A;  1N13 A;  2WVJ A;  3PDN A;  1FAR A;  2E5R A;  1FAQ A;  1VDD A;  4OVO A;  1TBO A;  2F3C I;  3UGL A;  1CHO I;  1AN1 I;  1LR9 A;  2JA1 A;  1YTP A;  2KMQ A;  1Y8F A;  1Z7K B;  4UXJ A;  5CCM A;  1CT0 I;  3UGD A;  1CSO I;  3E59 A;  2JXD A;  3B4V C;  4B6D A;  2GKT I;  2NU0 I;  5HI7 A;  1R0R I;  1TBN A;  4UXI A;  1DS2 I;  5FUY A;  5CCL A;  2ARP F;  2N52 A;  2N71 A;  4E1P A;  2ROW A;  3UEY A;  5HQ8 A;  2QPO A;  3OL0 A;  3VDU A;  1SGE I;  1M8B A;  2NU1 I;  2FNF X;  1TGS I;  2ERW A;  2LEO A;  1IY5 A;  4SGB I;  2GKV A;  1CGJ I;  1SGR I;  1TIH A;  2ORW A;  1OMU A;  2V1C A;  1IW4 A;  2JYY A;  1SGD I;  3QTL D;  3OVO A;  1R79 A;  3RU0 A;  2QQE A;  2N1A B;  2XRC A;  1KBF A;  1UUC A;  2WCY A;  3E2I A;  1M8C A;  1UVG A;  1FYB A;  1BMO A;  1SGP I;  1X74 A;  3UFF A;  1XBT A;  3MEK A;  4GI3 C;  5FUV A;  1UVF A;  2QQD A;  1X4S A;  2JW6 A;  2K9H A;  2N17 A;  2SGF I;  3BJI A;  1BUS A;  2B0U C;  2GKR I;  1CT4 I;  1V1H A;  1HPT A;  1TBR R;  1OMT A;  2P6A C;  2NU4 I;  3D00 A;  3OXG A;  3HH2 C;  2VRW B;  1OVO A;  1CE3 A;  1DS3 I;  2SGD I;  1SGQ I;  2SGQ I;  1MT1 A;  2V53 A;  1Y1B A;  2E73 A;  2V1C C;  1KBE A;  1W3S A;  1LR8 A;  5JHW C;  1TUS A;  4L9M A;  1PTR A;  5EX0 A;  2GVI A;  2QQC A;  1CGI I;  1U5K A;  2W0T A;  2BUS A;  1NUB A;  2CJS C;  1TBQ R;  2DB6 A;  1TOT A;  5DAE A;  3SGB I;  1SGY I;  1PPF I;  3CXL A;  2ORV A;  4UXH A;  2KMR A;  2NU3 I;  3VE5 A;  2YQP A;  1V1I A;  3SGQ I;  5FUX A;  1TUR A;  2A20 A;  3OXL A;  4FKD A;  1PTQ A;  3OXF A;  5FUW A;  2M5X A;  2ELI A;  2B8T A;  2KCX A;  2OD1 A;  1IY6 A;  2J87 A;  2KMO A;  3FC3 A;  1RFH A;  1XA6 A;  4A24 A;  1YU6 C;  4JCV E;  2UZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...