1CT4I

Crystal structure of the omtky3 p1 variant omtky3-val18i in complex with sgpb
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTVEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEINASE B
publication title Deleterious effects of beta-branched residues in the S1 specificity pocket of Streptomyces griseus proteinase B (SGPB): crystal structures of the turkey ovomucoid third domain variants Ile18I, Val18I, Thr18I, and Ser18I in complex with SGPB.
pubmed rcsb
source organism Meleagris gallopavo
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1999-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1ct4I00
2OVOA 1M8CA 1YU6C 2NU1I 1N13A 1LR9A 2NU2I 1PJUA 1R0RI 1HJAI 2SGEI 1HDLA 1SGQI 1H0ZA 3B4VC 1SGYI 1SGEI 2GKRI 1PCEA 2SGDI 2KMPA 1SGDI 1CHOI 2N52A 3SEKC 4OVOA 1OMUA 2QQDA 2QQCA 1BMOA 1UVGA 2XRCA 2SGPI 2F3CI 1CT0I 1TIHA 2P6AC 3QTLD 1HPTA 1LR8A 1BUSA 3SGBI 2SGFI 2LEOA 2NU0I 1OYVI 2NU3I 2KMRA 2JYYA 1TBRR 1DS2I 2KMQA 1Z7KB 2JZMA 2BUSA 2JXDA 3HH2C 4SGBI 1CT4I 1Y1CA 2SGQI 5JHWC 5DAEA 1Y1BA 1IY5A 1UUCA 1MT1A 2V53A 1TURA 1OVOA 1SGRI 1CGJI 1UVFA 1NUBA 2NU4I 1PPFI 1M8BA 2B0UC 2GKTI 1LR7A 1SGPI 1TGSI 2ARPF 2N17A 2M5XA 1CSOI 1OMTA 3OVOA 1CE3A 1YTPA 1DS3I 2KMOA 4GI3C 3SGQI 1TBQR 2ERWA 2GKVA 1CGII 2N71A 4HGUA 1IW4A 1TUSA 1FYBA 1IY6A 1AN1I 1SGNI 1CT2I 3TJQA 1KMAA 2KCXA 2WCYA
chains in the Genus database with same CATH superfamily
2UZ3A 2OVOA 1M8CA 1YU6C 2NU1I 1N13A 5FUYA 3E2IA 1LR9A 2NU2I 1PJUA 1UHAA 1R0RI 1HJAI 2SGEI 1HDLA 1SGQI 2VRWB 1H0ZA 3B4VC 2ENZA 1SGYI 2RIJA 2DIPA 1SGEI 1RFHA 3R5BA 5CCMA 2GKRI 2N1AB 2QQ0A 4B6DA 1PCEA 3QAHA 2J9RA 1X74A 2SGDI 2KMPA 2OD1A 1SGDI 5E3PA 1ULKA 1CHOI 1K7VA 2E73A 2N52A 3OXGA 3SEKC 4OVOA 1OMUA 2QQDA 3CXLA 1MJBA 2K9HA 1K7UA 2QQCA 5FUVA 1BMOA 1UVGA 2XRCA 5J8CA 1MJAA 2SGPI 2F3CI 2ROWA 7WGAA 1CT0I 1HEVA 1TIHA 2P6AC 3QTLD 2GVIA 2V1CC 2LUYA 3R5CA 1HPTA 3R5AA 5CCLA 1LR8A 3FSYA 1Z2IA 2YUUA 1ULNA 1BUSA 3SGBI 1VDDA 3TO7A 2ELIA 3VDPA 4A24A 2SGFI 1P9GA 1Q9BA 1U5KA 3OL0A 4L9MA 3TOAA 2LEOA 3FC3A 1TBNA 2ORVA 2QPOA 3UFFA 2NU0I 1OYVI 1Y8FA 2NU3I 2X3TA 1X4SA 2KMRA 4FKDA 2JYYA 5EX0A 1TBRR 1DS2I 2KMQA 3OXFA 1Z7KB 4E1PA 3UGDA 1TOTA 2A20A 3UOEA 2JZMA 3OXLA 3PDNA 2W0TA 2BUSA 3BJIA 2JXDA 2DKVA 3HH2C 4SGBI 1P9ZA 1CT4I 1Y1CA 1WGTA 1WKXA 2SGQI 4MPIA 5DAEA 2WVJA 3TO9A 1W4RA 1WGCA 1Y1BA 1IY5A 2B8TA 2UVOA 1UUCA 2JA1A 3MEKA 1MT1A 2V53A 1TURA 1OVOA 1SGRI 1TBOA 3VE5A 3GOXA 1CGJI 1MJ9A 1FY7A 4E1RA 1UVFA 3FSXA 1NUBA 1ULMA 2JW6A 3UGLA 2X52A 3UEYA 2NU4I 2ORWA 1K7TA 2V1CA 2CJSC 5E3RA 1PPFI 3UEJA 4UXHA 5E3QA 3RU0A 1M8BA 4UXIA 2J87A 5HQ8A 2B0UC 2GKTI 4WP4A 3TO6A 1PTQA 1LR7A 9WGAA 2FNFX 1SGPI 1TGSI 2LB7A 2ARPF 5EX3A 3E59A 2M5XA 2N17A 1CSOI 1OMTA 3OVOA 2CWGA 1DS3I 1YTPA 1CE3A 2OU2A 2KMOA 3D00A 5FUXA 4GI3C 3SGQI 3TOBA 2DB6A 1TBQR 4DNCA 2ERWA 2GKVA 1V1HA 1XA6A 2QQEA 1CGII 3QWPA 2E5RA 2N71A 2ENNA 1S20A 2PQ8A 4HGUA 1KBEA 3UGIA 3KY9A 1FAQA 5FUWA 1KBFA 2CWFA 4AMLA 1IW4A 1TUSA 3VDUA 1IY6A 1R79A 1FYBA 1V1IA 1AN1I 2L8EA 4JCVE 1SGNI 1CT2I 2GIVA 5HI7A 2RC4A 3TJQA 1XBTA 2L7XA 2WGCA 1PTRA 5J8FA 1W3SA 2OZUA 5JHWC 4UXJA 1KMAA 1WTJA 2CWHA 2KCXA 2YQPA 3R5DA 2Y0MA 1NXUA 1XX6A 2ODDA 1FARA 2WCYA
chains in the Genus database with same CATH topology
2UZ3A 2OVOA 1M8CA 1YU6C 2NU1I 1N13A 5FUYA 3E2IA 1LR9A 2NU2I 1PJUA 1R0RI 1HJAI 2SGEI 1HDLA 1SGQI 2VRWB 1H0ZA 3B4VC 2ENZA 1SGYI 2DIPA 1SGEI 1RFHA 5CCMA 2GKRI 2N1AB 2QQ0A 4B6DA 1PCEA 2J9RA 1X74A 2SGDI 2KMPA 2OD1A 1SGDI 1CHOI 2E73A 2N52A 3OXGA 3SEKC 4OVOA 1OMUA 2QQDA 3CXLA 2K9HA 2QQCA 5FUVA 1BMOA 1UVGA 2XRCA 2SGPI 2F3CI 2ROWA 1CT0I 1TIHA 2P6AC 3QTLD 2GVIA 2V1CC 2LUYA 5CCLA 1HPTA 1LR8A 2YUUA 1BUSA 3SGBI 1VDDA 3VDPA 2ELIA 4A24A 2SGFI 3OL0A 3FC3A 1U5KA 4L9MA 2LEOA 1TBNA 2ORVA 2QPOA 3UFFA 2NU0I 1OYVI 1Y8FA 2NU3I 4FKDA 1X4SA 2KMRA 2JYYA 5EX0A 1TBRR 1DS2I 2KMQA 3OXFA 1Z7KB 4E1PA 3UGDA 1TOTA 2A20A 2JZMA 3OXLA 3PDNA 2W0TA 2BUSA 3BJIA 2JXDA 3HH2C 4SGBI 1CT4I 1Y1CA 2SGQI 5JHWC 5DAEA 2WVJA 1W4RA 1Y1BA 1IY5A 2B8TA 1UUCA 2JA1A 3MEKA 1MT1A 2V53A 1TURA 1OVOA 1SGRI 1TBOA 3VE5A 3GOXA 1CGJI 4E1RA 1UVFA 1NUBA 2JW6A 3UGLA 3UEYA 2NU4I 2ORWA 2V1CA 2CJSC 1PPFI 3UEJA 4UXHA 3RU0A 1M8BA 4UXIA 2J87A 5HQ8A 2B0UC 2GKTI 1PTQA 1LR7A 2FNFX 1SGPI 1TGSI 2ARPF 5EX3A 3E59A 2M5XA 2N17A 1CSOI 1OMTA 3OVOA 1CE3A 1YTPA 1DS3I 2KMOA 3D00A 5FUXA 4GI3C 3SGQI 2DB6A 1TBQR 2ERWA 2GKVA 1V1HA 1XA6A 2QQEA 1CGII 3QWPA 2E5RA 2N71A 2ENNA 4HGUA 1KBEA 3UGIA 3KY9A 1FAQA 5FUWA 1KBFA 1IW4A 1TUSA 3VDUA 1IY6A 1R79A 1FYBA 1V1IA 1AN1I 2L8EA 4JCVE 1SGNI 1CT2I 5HI7A 3TJQA 1XBTA 2L7XA 1PTRA 1W3SA 1KMAA 4UXJA 2KCXA 2YQPA 1XX6A 2ODDA 1FARA 2WCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OVO A;  1M8C A;  1YU6 C;  2NU1 I;  1N13 A;  1LR9 A;  2NU2 I;  1PJU A;  1R0R I;  1HJA I;  2SGE I;  1HDL A;  1SGQ I;  1H0Z A;  3B4V C;  1SGY I;  1SGE I;  2GKR I;  1PCE A;  2SGD I;  2KMP A;  1SGD I;  1CHO I;  2N52 A;  3SEK C;  4OVO A;  1OMU A;  2QQD A;  2QQC A;  1BMO A;  1UVG A;  2XRC A;  2SGP I;  2F3C I;  1CT0 I;  1TIH A;  2P6A C;  3QTL D;  1HPT A;  1LR8 A;  1BUS A;  3SGB I;  2SGF I;  2LEO A;  2NU0 I;  1OYV I;  2NU3 I;  2KMR A;  2JYY A;  1TBR R;  1DS2 I;  2KMQ A;  1Z7K B;  2JZM A;  2BUS A;  2JXD A;  3HH2 C;  4SGB I;  1CT4 I;  1Y1C A;  2SGQ I;  5JHW C;  5DAE A;  1Y1B A;  1IY5 A;  1UUC A;  1MT1 A;  2V53 A;  1TUR A;  1OVO A;  1SGR I;  1CGJ I;  1UVF A;  1NUB A;  2NU4 I;  1PPF I;  1M8B A;  2B0U C;  2GKT I;  1LR7 A;  1SGP I;  1TGS I;  2ARP F;  2N17 A;  2M5X A;  1CSO I;  1OMT A;  3OVO A;  1CE3 A;  1YTP A;  1DS3 I;  2KMO A;  4GI3 C;  3SGQ I;  1TBQ R;  2ERW A;  2GKV A;  1CGI I;  2N71 A;  4HGU A;  1IW4 A;  1TUS A;  1FYB A;  1IY6 A;  1AN1 I;  1SGN I;  1CT2 I;  3TJQ A;  1KMA A;  2KCX A;  2WCY A; 
#chains in the Genus database with same CATH topology
 2UZ3 A;  2OVO A;  1M8C A;  1YU6 C;  2NU1 I;  1N13 A;  5FUY A;  3E2I A;  1LR9 A;  2NU2 I;  1PJU A;  1UHA A;  1R0R I;  1HJA I;  2SGE I;  1HDL A;  1SGQ I;  2VRW B;  1H0Z A;  3B4V C;  2ENZ A;  1SGY I;  2RIJ A;  2DIP A;  1SGE I;  1RFH A;  3R5B A;  5CCM A;  2GKR I;  2N1A B;  2QQ0 A;  4B6D A;  1PCE A;  3QAH A;  2J9R A;  1X74 A;  2SGD I;  2KMP A;  2OD1 A;  1SGD I;  5E3P A;  1ULK A;  1CHO I;  1K7V A;  2E73 A;  2N52 A;  3OXG A;  3SEK C;  4OVO A;  1OMU A;  2QQD A;  3CXL A;  1MJB A;  2K9H A;  1K7U A;  2QQC A;  5FUV A;  1BMO A;  1UVG A;  2XRC A;  5J8C A;  1MJA A;  2SGP I;  2F3C I;  2ROW A;  7WGA A;  1CT0 I;  1HEV A;  1TIH A;  2P6A C;  3QTL D;  2GVI A;  2V1C C;  2LUY A;  3R5C A;  1HPT A;  3R5A A;  5CCL A;  1LR8 A;  3FSY A;  1Z2I A;  2YUU A;  1ULN A;  1BUS A;  3SGB I;  1VDD A;  3TO7 A;  2ELI A;  3VDP A;  4A24 A;  2SGF I;  1P9G A;  1Q9B A;  1U5K A;  3OL0 A;  4L9M A;  3TOA A;  2LEO A;  3FC3 A;  1TBN A;  2ORV A;  2QPO A;  3UFF A;  2NU0 I;  1OYV I;  1Y8F A;  2NU3 I;  2X3T A;  1X4S A;  2KMR A;  4FKD A;  2JYY A;  5EX0 A;  1TBR R;  1DS2 I;  2KMQ A;  3OXF A;  1Z7K B;  4E1P A;  3UGD A;  1TOT A;  2A20 A;  3UOE A;  2JZM A;  3OXL A;  3PDN A;  2W0T A;  2BUS A;  3BJI A;  2JXD A;  2DKV A;  3HH2 C;  4SGB I;  1P9Z A;  1CT4 I;  1Y1C A;  1WGT A;  1WKX A;  2SGQ I;  4MPI A;  5DAE A;  2WVJ A;  3TO9 A;  1W4R A;  1WGC A;  1Y1B A;  1IY5 A;  2B8T A;  2UVO A;  1UUC A;  2JA1 A;  3MEK A;  1MT1 A;  2V53 A;  1TUR A;  1OVO A;  1SGR I;  1TBO A;  3VE5 A;  3GOX A;  1CGJ I;  1MJ9 A;  1FY7 A;  4E1R A;  1UVF A;  3FSX A;  1NUB A;  1ULM A;  2JW6 A;  3UGL A;  2X52 A;  3UEY A;  2NU4 I;  2ORW A;  1K7T A;  2V1C A;  2CJS C;  5E3R A;  1PPF I;  3UEJ A;  4UXH A;  5E3Q A;  3RU0 A;  1M8B A;  4UXI A;  2J87 A;  5HQ8 A;  2B0U C;  2GKT I;  4WP4 A;  3TO6 A;  1PTQ A;  1LR7 A;  9WGA A;  2FNF X;  1SGP I;  1TGS I;  2LB7 A;  2ARP F;  5EX3 A;  3E59 A;  2M5X A;  2N17 A;  1CSO I;  1OMT A;  3OVO A;  2CWG A;  1DS3 I;  1YTP A;  1CE3 A;  2OU2 A;  2KMO A;  3D00 A;  5FUX A;  4GI3 C;  3SGQ I;  3TOB A;  2DB6 A;  1TBQ R;  4DNC A;  2ERW A;  2GKV A;  1V1H A;  1XA6 A;  2QQE A;  1CGI I;  3QWP A;  2E5R A;  2N71 A;  2ENN A;  1S20 A;  2PQ8 A;  4HGU A;  1KBE A;  3UGI A;  3KY9 A;  1FAQ A;  5FUW A;  1KBF A;  2CWF A;  4AML A;  1IW4 A;  1TUS A;  3VDU A;  1IY6 A;  1R79 A;  1FYB A;  1V1I A;  1AN1 I;  2L8E A;  4JCV E;  1SGN I;  1CT2 I;  2GIV A;  5HI7 A;  2RC4 A;  3TJQ A;  1XBT A;  2L7X A;  2WGC A;  1PTR A;  5J8F A;  1W3S A;  2OZU A;  5JHW C;  4UXJ A;  1KMA A;  1WTJ A;  2CWH A;  2KCX A;  2YQP A;  3R5D A;  2Y0M A;  1NXU A;  1XX6 A;  2ODD A;  1FAR A;  2WCY A; 
#chains in the Genus database with same CATH homology
 2UZ3 A;  2OVO A;  1M8C A;  1YU6 C;  2NU1 I;  1N13 A;  5FUY A;  3E2I A;  1LR9 A;  2NU2 I;  1PJU A;  1R0R I;  1HJA I;  2SGE I;  1HDL A;  1SGQ I;  2VRW B;  1H0Z A;  3B4V C;  2ENZ A;  1SGY I;  2DIP A;  1SGE I;  1RFH A;  5CCM A;  2GKR I;  2N1A B;  2QQ0 A;  4B6D A;  1PCE A;  2J9R A;  1X74 A;  2SGD I;  2KMP A;  2OD1 A;  1SGD I;  1CHO I;  2E73 A;  2N52 A;  3OXG A;  3SEK C;  4OVO A;  1OMU A;  2QQD A;  3CXL A;  2K9H A;  2QQC A;  5FUV A;  1BMO A;  1UVG A;  2XRC A;  2SGP I;  2F3C I;  2ROW A;  1CT0 I;  1TIH A;  2P6A C;  3QTL D;  2GVI A;  2V1C C;  2LUY A;  5CCL A;  1HPT A;  1LR8 A;  2YUU A;  1BUS A;  3SGB I;  1VDD A;  3VDP A;  2ELI A;  4A24 A;  2SGF I;  3OL0 A;  3FC3 A;  1U5K A;  4L9M A;  2LEO A;  1TBN A;  2ORV A;  2QPO A;  3UFF A;  2NU0 I;  1OYV I;  1Y8F A;  2NU3 I;  4FKD A;  1X4S A;  2KMR A;  2JYY A;  5EX0 A;  1TBR R;  1DS2 I;  2KMQ A;  3OXF A;  1Z7K B;  4E1P A;  3UGD A;  1TOT A;  2A20 A;  2JZM A;  3OXL A;  3PDN A;  2W0T A;  2BUS A;  3BJI A;  2JXD A;  3HH2 C;  4SGB I;  1CT4 I;  1Y1C A;  2SGQ I;  5JHW C;  5DAE A;  2WVJ A;  1W4R A;  1Y1B A;  1IY5 A;  2B8T A;  1UUC A;  2JA1 A;  3MEK A;  1MT1 A;  2V53 A;  1TUR A;  1OVO A;  1SGR I;  1TBO A;  3VE5 A;  3GOX A;  1CGJ I;  4E1R A;  1UVF A;  1NUB A;  2JW6 A;  3UGL A;  3UEY A;  2NU4 I;  2ORW A;  2V1C A;  2CJS C;  1PPF I;  3UEJ A;  4UXH A;  3RU0 A;  1M8B A;  4UXI A;  2J87 A;  5HQ8 A;  2B0U C;  2GKT I;  1PTQ A;  1LR7 A;  2FNF X;  1SGP I;  1TGS I;  2ARP F;  5EX3 A;  3E59 A;  2M5X A;  2N17 A;  1CSO I;  1OMT A;  3OVO A;  1CE3 A;  1YTP A;  1DS3 I;  2KMO A;  3D00 A;  5FUX A;  4GI3 C;  3SGQ I;  2DB6 A;  1TBQ R;  2ERW A;  2GKV A;  1V1H A;  1XA6 A;  2QQE A;  1CGI I;  3QWP A;  2E5R A;  2N71 A;  2ENN A;  4HGU A;  1KBE A;  3UGI A;  3KY9 A;  1FAQ A;  5FUW A;  1KBF A;  1IW4 A;  1TUS A;  3VDU A;  1IY6 A;  1R79 A;  1FYB A;  1V1I A;  1AN1 I;  2L8E A;  4JCV E;  1SGN I;  1CT2 I;  5HI7 A;  3TJQ A;  1XBT A;  2L7X A;  1PTR A;  1W3S A;  1KMA A;  4UXJ A;  2KCX A;  2YQP A;  1XX6 A;  2ODD A;  1FAR A;  2WCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...