2DKVA

Crystal structure of class i chitinase from oryza sativa l. japonica
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
298
structure length
286
Chain Sequence
b'EQCGAQAGGARCPNCLCCSRWGWCGTTSDFCGDGCQSQCSGCDGVGSIVPRDLFERLLLHRNDGACPARGFYTYEAFLAAAAAFPAFGGTGNTETRKREVAAFLGQTSHETTGGWPTAPDGPFSWGYCFKQEQNPPSDYCQPSPEWPCAPGRKYYGRGPIQLSFNFNYGPAGRAIGVDLLSNPDLVATDATVSFKTALWFWMTPQGNKPSSHDVITGRWAPSPADAAAGRAPGYGVITNIVNGGLECGHGPDDRVANRIGFYQRYCGAFGIGTGGNLDCYNQRPFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chitinase
publication title Structure of full-length class I chitinase from rice revealed by X-ray crystallography and small-angle X-ray scattering
doi rcsb
source organism Oryza sativa japonica group
molecule tags Hydrolase
total genus 99
structure length 286
sequence length 298
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2006-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00182 Glyco_hydro_19 Chitinase class I
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 2dkvA02
3.30.20.10 Alpha Beta 2-Layer Sandwich Endochitinase; domain 2 Endochitinase, domain 2 2dkvA03
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 2dkvA01
5KXMA 1LHMA 4ZFPA 1LZ4A 3LN2A 4XJDA 3ZVQB 1GFUA 2BQHA 5FEKA 1XGTC 1ULMA 1B5YA 4HJZA 1K7UA 3G3AB 4GCFA 1HMLA 3W6AA 1UCOA 1MLCE 1B5UA 4H8XA 1GE2A 1F10A 4G49A 2NWDX 1EQ4A 3N9AA 4J0LA 4ML7A 2EKSC 2MEIA 5KXOA 2X52A 2XJWA 4HTKA 4WM1A 4NGYA 5DN5A 5B05A 3FI7A 4GLVA 2HTXA 1A4VA 4B4IA 4N1EI 1UUZC 3RT5X 2YBHA 2D4JA 1JPOA 1JISA 1HF4A 1UHAA 1HC0A 2H5ZA 4ZEEA 1GBWA 1QTEA 5FDJA 2DQHY 5C6JA 1GFGA 2EPEA 1DI5A 1LSNA 1REYA 3BKHA 1J1XY 1IX0A 1GFEA 5IDDA 4XJGA 3HBEX 2BQGA 1VAUA 1BWJA 4W94A 4Z98A 1LKSA 1LSDA 2LYOA 1NF5A 4N1CC 4DDAA 4TX7A 1LJHA 2FYCA 5F9UA 4N5RA 5I4XA 1XGUC 5B1GA 4NEBA 4XJIA 3AZ4A 3M18B 3WYHA 2RSCA 4NSGA 2F2NA 3N9CA 3P68A 1RFPA 1CKHA 3QY4A 3TMXA 3A92A 1XFPL 4LT2A 3P4ZA 4RLMA 1DPXA 4NGWA 4PPOA 3B0IA 2BQEA 3ATNA 4WL6A 1LZRA 1YAMA 4DD3A 1HNLA 1HFYA 4XJBA 1RI8B 2YVBA 2ZYPA 1C10A 4LT1A 4NG8A 3LZTA 4NFVA 3F6ZA 5KXPA 1LMPA 3TMWA 5I54A 1IP2A 1FKVA 2HEBA 2LZ2A 3LYOA 2BQJA 5D5CA 1IOQA 1LTMA 2YBNA 3P65A 1IP6A 1B5WA 2YBMA 2ZWBA 4H9IA 3A96A 2A7FA 5FHWA 4NHTA 1WQMA 1IOSA 5B59A 3RNXA 1ZV5L 1IC4Y 2BPUA 1UA6Y 1YIKA 4KPMA 1B7QA 1BB4A 1K7TA 133LA 1GAZA 4OWHA 3B72A 1LHHA 2Z18A 1LPIA 1GBSA 4FJRA 1BVKC 1LSFA 1OUHA 1GEVA 1JJ3A 1BB6A 1D9UA 1GE3A 1HSWA 1YKYX 4NHIA 4R6CA 5LA8A 5KXRA 1WTMA 1FLUA 1LZ9A 3AGIA 4ETCA 1JSFA 4WMGA 1G7HC 1LZDA 1YAPA 3CT1A 4QEQA 2DQJY 3E3DA 2ZIKA 3TXJA 4MPIA 2D4KA 1OUDA 3QNGA 5IELA 4H8YA 4GN3A 3W6EA 2Z38A 5DL9A 5KKJA 1J1PY 1IP4A 4MCKA 1VDPA 1GF8A 3CSRA 1LMOA 3A67Y 5I53A 3WUNA 4L41A 5F9XA 3FE0A 5D5FA 3W3EA 1V7SA 3B0KA 1LZYA 1H6MA 2Z39A 3OK0A 2MEBA 2H9KA 4LYZA 4PRUA 1OUBA 2DQGY 4WLDA 4NHPA 1KXXA 1GXV2 208LA 1LSBA 1UIBA 1F0WA 1MELL 1LJIA 4MR1A 2BAAA 4OW1A 4ET8A 5APFA 1YAOA 1B5XA 4H9EA 5K7OA 5LAFA 4DWXA 4NWEA 2LYZA 1AKIA 4H1PA 2CGIA 2DBTA 2DQAA 1HERA 3LYTA 1LZGA 1B7PA 4WLYA 1LAAA 1GWDA 4H9CA 1LJJA 2ZQ4A 3A90A 3EO5A 1OUJA 1TDYA 4J1BA 1BVXA 5LVHA 4M4OA 4NHQA 5A3ZA 1JSEA 5DN4A 4BS7A 5HMVA 1DXJA 5J7CA 4NGOA 5HMJA 2YBLA 1DKKA 135LA 2H9JA 3A93A 5ILFA 1LHLA 1LOZA 1IVMA 4HV1A 3WU7A 2HECA 1EQEA 3WVYA 1KIPC 2BQLA 3IJUA 1LZ6A 2YDGA 2ZNXY 3QE8A 4YF2A 2Y8PA 1UACY 3CQLA 1Z55A 4YEOA 4Z46A 4DDBA 4RW1A 4XENA 1LZ1A 4LZTA 1FBIX 2Q0MX 2VB1A 2BQNA 1UICA 1T3PA 1UIAA 4LT3A 5KKIA 1QDTA 1XGQC 1LSYA 3AW6A 4H92A 1UIHA 3TXHA 1GB7A 5HLLA 3A95A 2CJLA 2WGCA 2MECA 5FELA 1IWZA 1GF9A 1UIDA 1YANA 1A2YC 1LZCA 2DQFC 4A7DA 3CSZA 1BGIA 4TUNA 1WQPA 4HJVA 1C43A 1WVVA 3A3QA 4QDNA 1NDGC 5L3HA 1WKXA 5LYMA 3HBHA 2HEFA 1IIZA 1WVUA 4NGJA 1OQMA 1GXXA 1UC0A 193LA 1IY4A 4TTDA 3WPJA 1TAYA 1BWHA 1GE1A 5LIOA 4BADA 2IFFY 1G7MC 4J7VA 3VWOA 1B7RA 5KY1A 1YKZX 5KXLA 4DD9A 4EMNA 1CKFA 153LA 1VEDA 1WQQA 3TMUA 2ZNWY 1GB5A 2XBRA 4M6DA 5LAGA 1GEZA 1GB3A 1FKQA 1REXA 1UIFA 3CSQA 3N9EA 4LYMA 4OWBA 5B06A 2BQAA 3HFMY 3OJPA 2Z2FA 2D4IA 4IATA 4NHSA 4XADA 1XEIA 2Z37A 4HV2A 3LYZA 1P9ZA 2DQIY 1NDMC 4CGEA 3RU5A 1UIGA 7LYZA 2CWIA 132LA 1LMTA 5M1YA 5LVIA 1NBYC 1GB6A 4J1AA 4DDCA 2HEEA 1JJ0A 4DD1A 3CB7A 1LJFA 3WU8A 3ZEKA 1RCMA 1B5VA 4KT3A 3A3RX 4NGIA 3W6CA 2LHMA 2B5ZA 1IORA 1VATA 2XTHA 4MSTA 1DI4A 2D6BA 1CJ9A 1RJCB 1NMMA 4PHIA 1JHLA 1KIQC 1LSZA 4KXIA 2ZIJA 1JEFA 4U3XB 1HFXA 4H9HA 1LZEA 5KXTA 1GB2A 1GE0A 1LMQA 4LYBA 1LJGA 3WW5A 4CFOA 1LHJA 1IC7Y 1JKCA 5B07A 1N4FA 1GF7A 1C08C 1C7PA 1YROA 4XN6A 1JJ1A 1DPWA 3GXRA 1F6RA 2GV0A 4GN5C 3TXIA 154LA 1B2KA 1HHLA 1SQ2L 4HPEA 3ATOA 1W6ZA 1VDQA 1LCNA 5KXKA 4EOFA 3A34A 4XJFA 4R0FA 4TSCA 1QDRA 3AB6A 4NGVA 2W1MA 2MEEA 1UBZA 1HEOA 1LJNA 1D0LA 1HEQA 2YBJA 4NGLA 2MEFA 2W1LA 4WOAA 1LSMA 4G9SA 4B0DA 3EMSA 5KXZA 1I56A 2F4GA 4G4HA 4H90A 1NHEA 1V7TA 4OOOA 1YILA 3IJVA 4LYCA 3B6LA 4GLAA 4WM6A 1LJKA 4PRQA 4DD7A 1SLYA 1LJ4A 4Z3MA 1VFBC 3TMVA 1OUFA 2D91A 1DI3A 1JUGA 2DQEY 3WMKA 2DQDY 1RE2A 3J6KA 4CJ2A 1GB9A 3LYMA 3LHMA 1FDLY 1TEWA 1P2CC 3CT0A 2W1XA 1B7LA 1LJ3A 1OUGA 1LZSA 1PZYA 1GHLA 2N5ZA 3G3BB 1YAQA 1GFAA 2BQBA 4PGJB 1GD6A 4YEMA 1XEJA 1WQNA 4II8A 1B7OA 2UVOA 1QQYA 4WG7A 1BQLY 1DKJA 1GB8A 5LVKA 4NSJA 5L3IA 1IR7A 1GFVA 1XEKA 2F4AA 4BAPA 3RZ4A 3TXDA 1LMAA 1HMKA 1YL0X 1GDXA 3TXBA 4IJ4A 3AZ5A 2BLXA 1NWGA 1GBZA 3AW7A 4NY5A 1TBYA 4CFPA 1BB3A 1IWUA 1OUCA 3WL2A 5LA5A 4HTNA 1KXYA 9LYZA 5LINA 4QY9A 2G4PA 1OUEA 3WU9A 1QTKA 2MEHA 4HSFA 4OWCA 4I0CA 4UWUA 3HBDA 2BQKA 4HP0A 4WM3A 4B4JA 2I6ZA 2FBBA 5LYTA 1WQOA 4X3BA 2F30A 4HPIA 1GE4A 1G7IC 1LMNA 1GF0A 1YKXX 2YSSC 4NGZA 1LHIA 5E9RA 1CKGA 9WGAA 5APCA 2WARA 2DQCY 4LT0A 5LXWA 3ULRA 2EQLA 1B7SA 4WO9A 1IWTA 1HEWA 1T6VL 4H9AA 1GFJA 2HUBA 4DC4A 4ETDA 1YQVY 4WM4A 2G4NA 1CJ8A 1QUTA 3AZ6A 5EBHA 1IWYA 1IP1A 1LZBA 2CDSA 2W1YA 3D3DA 1JKDA 2FBDA 2LB7A 1GDWA 4LGKA 5I4WA 1ALCA 1DZBX 1PS5A 1JTOL 1OP9B 1UIEA 3LZ2A 4NSHA 3W6FA 8LYZA 4HJYA 4UWNA 4WLXA 1B7NA 4NSIA 3AGHA 1LYSA 3A8ZA 3WPKA 1HEMA 1LSCA 5DLAA 2FYDA 5B1FA 2YBIA 2BQCA 4ET9A 1GAYA 1LMCA 2EIZC 4I8SA 4OWAA 1REZA 4WM5A 1JITA 3A91A 1LHKA 3WUAA 1WGCA 5FSTA 5IHGA 1AM7A 4ANRA 4D9ZA 1W08A 4C5FA 1GBOA 3A94A 1REMA 4B49A 1FLQA 4NIJA 4DYGA 4Z41A 4WO6A 1IWVA 1GBYA 1OUIA 2I26L 1FN5A 4ETEA 4WM2A 1LJEA 1CJ6A 3AJNA 4WG1A 2LYMA 4WLTA 5T3FA 1XSFA 1ULKA 2X0AA 3WW6A 2PC2A 4ZIXA 3IWRA 1QSWA 3SP3A 5LVJA 1WTNA 4H8ZA 1BHZA 1O23A 1VDSA 4OWEA 1XGPC 4YOPA 1INUA 1LSAA 2BQOA 1IP3A 5DM9A 4WP4A 2HU3A 4B4EA 5F81A 1IOTA 1CNSA 4H9FA 2I25L 1FLYA 1LSGA 5I4YA 1Q9BA 5HNCA 5JENB 1H87A 1ZMYL 1LSPA 2DKVA 2C8PA 2HEDA 2BQMA 4GCDA 3J4GA 4C3WA 5L9JA 5KXYA 1GF4A 1IWXA 1QSAA 5LVGA 1FLWA 2BQIA 2IHLA 4DD0A 1IR8A 4LYTA 1VDTA 4G4BA 3W6BA 3RW8A 1GB0A 3BKVA 3WUMA 1AT6A 5I5QA 1E8LA 4DD2A 1GFKA 1D0MA 2ZILA 5AMYA 5C6LA 1XGRC 3AZ7A 1D6PA 1IR9A 1ZVYB 4H93A 1JWRA 3ZVQA 1YL1X 4LFXA 5KXXA 1DQJC 1C45A 4GN4A 2HEAA 1NKHA 4N8ZA 2Z2EA 5F16A 1I20A 3MGWA 1CJ7A 1BB5A 5FCPA 3P64A 2X3TA 3A6CY 5A3EA 1CKCA 1LSEA 1B7MA 1LYYA 3TXEA 2C8OA 3WXTA 3WVXA 1G7JC 207LA 5APDA 5KXWA 4B1AA 1IY3A 134LA 3WULA 1D6QA 1C46A 4IASA 5KJ9A 1IP7A 4XYYA 1JKAA 1LYOA 5C6IA 3W6DA 1JIYA 4YM8A 4QGZA 194LA 1D0KA 5HNLA 1GBXA 5KXNA 1J1OY 4XJHA 5KXSA 4W96A 4GCCA 1HENA 4NG1A 3GXKA 3TXGA 3WXUA 1HSXA 3KAMA 1F6SA 5HQ1A 4N0JA 5II3A 3EXDA 3TXFA 4YENA 1OUAA 4AXTA 3T6UA 1QUSA 4TWSA 3P66A 3B0OA 1ZVHL 1GFHA 2MEAA 4FDYA 4H91A 3EBAB 4LYOA 3WH1A 6LYZA 3AGGG 5F14A 1AT5A 1GF3A 1ULNA 3T36A 4AMLA 1WGTA 1IWWA 3A6BY 1QIOA 4GCEA 4H9BA 4PJ2C 1GF5A 4OOTA 6LYTA 4ETBA 5E4PA 4KL7A 1KXWA 5LYZA 4G4CA 4O34A 1NQIA 1KIRC 1LZNA 1IC5Y 1IP5A 2Z12A 4NGKA 4TSBA 4UWVA 2HU1A 2Z19A 4WL7A 3WPLA 2A7DA 7WGAA 1LKRA 1GFTA 1NBZC 4P2EA 1LZAA 2BQFA 3M3UA 4H94A 1TCYA 1BWIA 1LZ5A 4BAFA 1IOCA 1HFZA 1G7LC 1LZ8A 1P9GA 2BLYA 1GPQC 2G4QA 1HEVA 4AGAA 4DT3A 2BQDA 2CWGA 4RLNA 4HTQA 1I1ZA 1LZTA 3TXKA 4GCBA 4N9RA 1B9OA 2LZTA 3CT5A 5APEA 5ILCA 1EQ5A 1LYZA 4CHXA 4RW2A 1IO5A 3K3TA 4ETAA 1CKDA 4LFPA 1GFRA 1JTPL 1WQRA 2ZQ3A 2ZYCA 3AYQA 1B5ZA 1IEEA 2XBSA 1EL1A 1GF6A 2AUBA 2MEDA 4E3UA 1B0DA 2MEGA 4RDSA 1JTTL 1HELA 4NWHA 1AZFA 1BB7A 3D9AC 1JKBA 1K7VA 1HEPA
chains in the Genus database with same CATH superfamily
3SB7A 4E1PA 1XGTC 1K28A 113LA 1K7UA 149LA 4H8XA 1B5UA 3PDNA 2NWDX 1EQ4A 3N9AA 4ML7A 1L57A 1DYAA 2X52A 1P64A 242LA 2XJWA 1OVKA 1T6HA 1L53A 1TLAA 5CCMA 3FI7A 4GLVA 1YTPA 2HTXA 3C81A 4N1EI 4W51A 1L09A 1C6IA 1L86A 1L39A 1UHAA 1L92A 1GBWA 1QTEA 1LSNA 3BKHA 4XJGA 2LUYA 4W94A 3UOEA 1CUQA 1LJHA 143LA 4N5RA 1DYCA 1L94A 1L14A 4NEBA 4XJIA 3WYHA 1QSQA 3N9CA 1CX7A 3NY9A 4RLMA 1CV3A 4WL6A 3ATNA 1QT4A 4XJBA 2B8TA 4LT1A 3LZTA 1G0GA 4NFVA 3GUJA 4ARPA 5I54A 107LA 3GUKA 1FKVA 2ODDA 225LA 1L73A 3LYOA 5D5CA 1LTMA 2YBNA 1B5WA 4H9IA 1V1IA 2NTHA 3C7ZA 151LA 2BPUA 1HDLA 1B7QA 3TJQA 2J9RA 2OTYX 5CCLA 1BVKC 111LA 1LSFA 1BB6A 1GE3A 3QAHA 5KXRA 1P2RA 3DMZA 4ETCA 4WMGA 3GULA 3E2IA 1LZDA 2DQJY 177LA 1L98A 3W6EA 2Z38A 5DL9A 5KKJA 5I53A 2RH1A 1L85A 1V7SA 3B0KA 1H6MA 3HUQA 1Z2IA 176LA 199LA 3V2WA 1GXV2 1VDDA 208LA 1F0WA 4MR1A 2BAAA 4OW1A 5LAFA 4DWXA 4NWEA 210LA 2CGIA 2DBTA 3D00A 1KNIA 1GWDA 1L01A 110LA 1C69A 2ZQ4A 3A90A 3EO5A 2KMOA 2RBNA 1TDYA 5LVHA 4NHQA 5HMVA 1JSEA 1CE3A 135LA 1KIPC 4YF2A 3QE8A 3SEKC 192LA 3TOBA 4YEOA 4Z46A 1P3NA 1TURA 2BQNA 1UIAA 5KKIA 3AW6A 1XGQC 1L18A 1KMAA 1QT6A 1IWZA 4I7MA 1YANA 1A2YC 3CSZA 4TUNA 4HJVA 3A3QA 1L19A 4LDLA 2RB0X 3WPJA 1QT7A 5LIOA 1TBQR 4EJ4A 5E3RA 3TMUA 4M6DA 1C6CA 2HULA 3HTDA 1FKQA 3N9EA 4OWBA 2ANVA 1MJAA 1QT8A 4YXCA 3CDVA 4XADA 1XEIA 1XJUA 1P9ZA 4CGEA 1UIGA 1V1HA 1LW9A 132LA 5FUYA 5M1YA 5LVIA 170LA 1JJ0A 3CB7A 1LJFA 4W59A 1RCMA 4KT3A 3A3RX 1CGII 1CV4A 4DKLA 1KW7A 1LSZA 1CUPA 2ELIA 2N1AB 1EPYA 1LI2A 1GE0A 1LMQA 1FAQA 4CFOA 1XBTA 125LA 1N4FA 1C6LA 1YROA 237LA 2GV0A 1B2KA 256LA 3ATOA 1C6KA 1LCNA 3DN0A 2YQPA 1L80A 1L74A 4NGVA 1L55A 1UBZA 3C8SA 4WOAA 1HEQA 2SGEI 1NHEA 1C6AA 1YILA 1KS3A 112LA 1JUGA 2DQDY 3J6KA 3LYMA 2B74A 3LHMA 1FDLY 1TEWA 200LA 3CT0A 3G3BB 4HV1A 1PZYA 4YEMA 1PTQA 1B7OA 2OE7X 159LA 137LA 1TBRR 1SGPI 3OVOA 1GFVA 1D3JA 1LMAA 3GUMA 1P5CA 1YL0X 3TXBA 1C65A 1TBYA 1BB3A 5LA5A 5LINA 1C6BA 1LR8A 2G4PA 1QTKA 4UWUA 4UXJA 3HBDA 4HP0A 2OEAX 5LYTA 1WQOA 4EKRA 1G7IC 1GF0A 2YSSC 5APCA 2WARA 1L06A 4LT0A 2F2QA 3ULRA 1B7SA 1HEWA 3ODUA 4ETDA 1L67A 1QUTA 3AZ6A 2RBOA 1IWYA 1LYIA 2W1YA 146LA 155LA 1C68A 2NU4I 1XEPA 1ALCA 1PS5A 4NSHA 8LYZA 4HJYA 4UWNA 3R5CA 1LYSA 1S20A 1LSCA 1QT5A 1N13A 3QTLD 1L31A 1L75A 3HU8A 1LMCA 3SB5A 2GVIA 4OWAA 2B75A 3A91A 1WGCA 1AM7A 3HDFA 3C8RA 2OU9A 4B49A 4Z41A 1GBYA 1OUIA 3CXLA 1CV5A 3SB6A 2PC2A 1P37A 2OE9X 1BHZA 171LA 1L82A 1L65A 2BQOA 4WP4A 2HU3A 1IOTA 1CNSA 1L30A 2I25L 1L70A 1LSGA 5I4YA 214LA 1H87A 1L21A 1LSPA 1L37A 5L9JA 5KXYA 4DD0A 1GB0A 3WUMA 2O79A 3C7YA 1E8LA 4DD2A 1GFKA 1D0MA 4H93A 4LFXA 2OD1A 1DQJC 2Z2EA 5F16A 1I20A 2RBSA 3SB8A 1BB5A 5FCPA 142LA 3A6CY 5A3EA 1B7MA 1LYYA 1L22A 4ARQA 3FSYA 1G7JC 1BMOA 207LA 4B1AA 4ARMB 1C46A 4HGUA 1IP7A 1SSWA 1JIYA 1L61A 1J1OY 5KXSA 4DNCA 1HENA 3WXUA 3KAMA 1F6SA 5HQ1A 1L38A 3EXDA 2N52A 1OUAA 1ZVHL 4H91A 1L89A 4LYOA 3WH1A 2F47A 1GF3A 1R0RI 3A6BY 4PJ2C 2NU0I 4OOTA 1SGQI 238LA 167LA 2V1CA 1L62A 4G4CA 1L17A 2N17A 1IP5A 2Z12A 2Z19A 245LA 1L49A 2A7DA 3CDRA 1BWIA 1LZ8A 1P9GA 2G4QA 1HEVA 4DT3A 1I1ZA 1MJBA 1OWZA 3TXKA 1B9OA 5APEA 2F3CI 1EQ5A 2B0UC 1IO5A 4ETAA 2V53A 1JTPL 1P56A 1CGJI 3AYQA 2XBSA 1BUSA 1EL1A 1QUHA 4E3UA 1HELA 1L88A 3D9AC 1IP3A 3SBBC 1LHMA 1LZ4A 220LA 3ZVQB 1GFUA 1B5YA 140LA 1P2LA 1UVGA 4GCFA 3W6AA 1GE2A 1M8BA 4HTKA 109LA 2YBHA 2D4JA 1JISA 2H5ZA 4LDEA 114LA 1GFGA 5I14A 1GFEA 1LYHA 2BQGA 1QS9A 1VAUA 211LA 2QQDA 2FYCA 1XGUC 3C80A 244LA 3AZ4A 224LA 3M18B 1CV6A 2RSCA 257LA 4NSGA 2V1CC 3DN8A 3P68A 5FUXA 3A92A 3D4SA 102LA 3B0IA 1CU3A 4DD3A 1HNLA 2ZYPA 1PCEA 4OVOA 1LMPA 2LZ2A 4EKQA 2BQJA 1IP6A 2ZWBA 3HH6A 1IOSA 5J8FA 1UA6Y 1YIKA 2NU2I 133LA 1GAZA 1LHHA 2Z18A 1GBSA 4FJRA 191LA 4NHIA 1L44A 1YKYX 1L56A 2Q9DA 1WTMA 3OXLA 1JSFA 1OVHA 2CJSC 3CT1A 173LA 2D4KA 3QNGA 4H8YA 2XQOA 1FY7A 1PQMA 1J1PY 1VDPA 1GF8A 3WUNA 1ZWNA 4L41A 5F9XA 185LA 3FE0A 215LA 4EPIA 3W3EA 1DS3I 4LYZA 2IGCA 4WLDA 3C83A 1KXXA 1H0ZA 2OE4X 4ET8A 1YAOA 2ERWA 5K7OA 3HTFA 2LYZA 1AKIA 4H1PA 1C6HA 2DQAA 4OO9A 1LZGA 4H9CA 2OU8A 1BVXA 3FI5A 4BS7A 1DXJA 2YBLA 2B73A 3WVYA 2HECA 3IJUA 1IW4A 1LZ6A 2ZNXY 3K2RA 2Y8PA 3GUNA 5J8CA 3HH3A 1SGNI 3CQLA 4RW1A 4XENA 232LA 5EX0A 3TXHA 4I7JA 2SGFI 5HLLA 2MECA 4AQNA 2UZ3A 2DQFC 1BGIA 2GKRI 5L3HA 1C43A 1WKXA 1T8AA 5LYMA 3HBHA 2HEFA 1IIZA 174LA 1WVUA 1OQMA 168LA 4NGJA 1UC0A 1BWHA 1GE1A 4BADA 2CWFA 5JHWC 1DYDA 1VEDA 2XBRA 5LAGA 1PJUA 2RB1X 1LWKA 4IATA 2Z37A 2DQIY 1NDMC 2B6ZA 3DNAA 213LA 2Q9EA 1GB6A 4DD1A 2RAZX 3WU8A 3ZEKA 1LYEA 2B5ZA 164LA 2NTGA 1CJ9A 1D3NA 4PHIA 1OVOA 3TOAA 1L24A 3C8QA 4KXIA 1G1VA 1L07A 4U3XB 1L76A 4H9HA 5KXTA 241LA 1LJGA 1LHJA 1JKCA 4XN6A 3GXRA 4GN5C 154LA 1JQUA 1W6ZA 1VDQA 2WVJA 4EOFA 1LI6A 3AB6A 1CTWA 2W1MA 2JZMA 3R5DA 1HEOA 1LJNA 1D0LA 1R79A 4B0DA 5KXZA 2F4GA 3R5AA 119LA 3IJVA 4LYCA 1XA6A 2JYYA 1LJKA 4ARLA 233LA 3KY9A 1L02A 1C61A 229LA 1LZSA 2N5ZA 115LA 1YAQA 1GFAA 1L66A 1GD6A 1L08A 4A24A 1WQNA 2LZMA 2O7AA 1GB8A 1QTBA 129LA 4NSJA 5L3IA 1IY6A 4BAPA 3TXDA 3RUNA 2B72A 3OL0A 1GBZA 1L42A 3AW7A 1D9WA 3DMXA 1IWUA 5LZMA 9LYZA 144LA 2MEHA 4OWCA 4I0CA 141LA 2M5XA 4B4JA 1DYGA 2FBBA 259LA 1YKXX 4NGZA 5E9RA 186LA 3C82A 1L64A 5LXWA 4S0WA 3CDOA 3UEYA 2HUBA 212LA 1CJ8A 1L29A 2CDSA 4I7QA 2B6XA 2LB7A 1GDWA 5I4WA 1L13A 1T8GA 1DZBX 3AGHA 3WPKA 4GRVA 1HEMA 1SX2A 1ZURA 2A4TA 2FYDA 2RC4A 1L10A 5B1FA 2P6AC 1GAYA 1L43A 2EIZC 4WM5A 1LHKA 3WUAA 5FSTA 1W08A 4C5FA 184LA 1L04A 1REMA 2KMRA 1IWVA 2ORVA 2Y0MA 2I26L 4WM2A 1ULKA 1X74A 4WLTA 1L99A 1OVJA 1L32A 4ZIXA 1QSWA 1O23A 1VDSA 4YOPA 1INUA 1KY1A 5DM9A 1LR7A 1Q9BA 1LYJA 4DQ7A 3OE8A 5HNCA 5JENB 1ZMYL 2HEDA 2BQMA 3J4GA 5LVGA 2IHLA 2DIPA 1MJ9A 4G4BA 1AT6A 5C6LA 3AZ7A 1LR9A 1D6PA 1IR9A 3HTBA 2HEAA 1NKHA 4N8ZA 1L63A 1FARA 1CJ7A 1PQOA 3HH4A 3P64A 2X3TA 1CKCA 1G0MA 3TXEA 2C8OA 1U5KA 145LA 3WXTA 3PDSA 5APDA 2L8EA 5KXWA 1P46A 1IY3A 134LA 4XYYA 4YM8A 1JKAA 138LA 1PTRA 194LA 3TO9A 5HNLA 1C66A 1GBXA 4W96A 1C6MA 3FSXA 4NG1A 3GXKA 1NUBA 1QTCA 5II3A 2RAYX 4YENA 1L90A 2NU1I 1OV5A 3T6UA 1P7SA 1GFHA 163LA 3EBAB 3HU9A 4AMLA 4K5YA 2L7XA 3SB9A 118LA 1D3FA 4UWVA 161LA 4H94A 1TCYA 1HFZA 1CVKA 1GPQC 128LA 1L84A 4RLNA 1L28A 4HTQA 1LZTA 4GCBA 2LZTA 3CT5A 2ZQ3A 2DB6A 1IEEA 1GF6A 3OE0A 2MEGA 1CT0I 1JTTL 1C64A 1CHOI 2E5RA 1SLYA 3LZ2A 5KXMA 5FUWA 2BQHA 1ULMA 3FA0A 3DN3A 1L11A 1UCOA 1F10A 1G06A 2EKSC 2SGPI 222LA 5DN5A 4ARQB 4B4IA 3RT5X 197LA 4ZEEA 4PJZA 5FDJA 2DQHY 2EPEA 1DI5A 1REYA 3G3VA 1J1XY 1UUCA 1LKSA 2LYOA 1NF5A 4N1CC 3R5BA 4TX7A 5F9UA 5I4XA 3HT7A 2JW6A 5B1GA 1CU6A 1RFPA 4I7OA 1SWZA 247LA 3QY4A 1QTZA 3TMXA 1XFPL 3P4ZA 1DPXA 3SBAA 4NGWA 1L33A 1LZRA 2GIVA 1HFYA 1RI8B 2YVBA 4NG8A 166LA 5KXPA 2RBRA 2PQ8A 2HEBA 1L52A 5DAEA 3A96A 4DQJA 1CSOI 3RNXA 1IC4Y 1ZYTA 1BB4A 1K7TA 1LPIA 1G0LA 1OUHA 1GEVA 1JJ3A 3DN1A 1HSWA 4R6CA 5LA8A 162LA 1FLUA 1P6YA 226LA 1G7HC 1DYBA 1YAPA 4QEQA 4DAJA 156LA 3TXJA 4MPIA 127LA 4GN3A 2QPOA 1C67A 1L45A 1IP4A 4MCKA 3CSRA 3A67Y 4E97A 5D5FA 2O4WA 1NXUA 1TUSA 2H9KA 3HT8A 1OUBA 2DQGY 4PRUA 2SGQI 3L64A 3OXFA 1LSBA 1SGDI 104LA 1KW5A 3GUPA 240LA 3UGLA 1CU5A 1CT4I 1HERA 4WLYA 1B7PA 1LAAA 231LA 3HWLA 1LJJA 3FADA 1QTDA 1OUJA 4J1BA 5J7CA 4NGOA 5HMJA 1DKKA 2H9JA 5ILFA 1LHLA 1LOZA 1C6FA 4DQ5A 3UFFA 1EQEA 2BQLA 2YDGA 1UACY 108LA 178LA 1MT1A 2HUKA 1C6TA 1Z55A 3HT6A 1L05A 4LDOA 1FBIX 2Q0MX 1T8FA 4EKPA 3L2XA 1WTJA 1LSYA 1UIHA 1QTVA 2CJLA 1Z7KB 1GF9A 251LA 1SSYA 1LZCA 180LA 2WCYA 1JKBA 4QDNA 3HUAA 7LZMA 2HUMA 1GXXA 148LE 1IY4A 1LYGA 1TAYA 3CDQA 2IFFY 5KY1A 1B7RA 5KXLA 4DD9A 1WQQA 3PBLA 1GEZA 3RZEA 4FKDA 1DS2I 4LYMA 2BQAA 206LA 3OJPA 3DMVA 2D4IA 7LYZA 2CWIA 1YU6C 2NU3I 2HEEA 2XRCA 4W58A 3VW7A 205LA 5E3PA 3SN6R 1L72A 4NGIA 1C6PA 5EX3A 1IORA 1VATA 2XTHA 1NMMA 1JHLA 1KIQC 201LA 6LZMA 120LA 1HFXA 2A20A 1HPTA 1IC7Y 1OV7A 1C08C 1GF7A 2RBQA 1Y8FA 195LA 1QT3A 1DPWA 3BJIA 4ZPUA 2B6WA 1HHLA 4HPEA 2K9HA 5KXKA 4XJFA 4R0FA 1QDRA 1LWGA 2MEFA 165LA 1I56A 4H90A 2YUUA 1V7TA 3E59A 3VDPA 4GLAA 4PRQA 1LJ4A 4Z3MA 4W53A 1OUFA 2D91A 3WMKA 4CJ2A 4EXMA 209LA 249LA 2BQBA 2FNFX 1XEJA 4I7TA 4II8A 1QQYA 1BQLY 1DKJA 5LVKA 1JTNA 2F4AA 216LA 1HMKA 1GDXA 1T97A 4IJ4A 2SGDI 3AZ5A 2BLXA 3WL2A 1LGXA 1OWYA 1OUEA 3UGIA 3DN6A 2BQKA 2I6ZA 243LA 2OZUA 1GE4A 1LMNA 1LHIA 183LA 2RB2X 2EQLA 1QTHA 1IWTA 1T6VL 4H9AA 1GFJA 150LA 4W55A 4DC4A 1XJTA 4WM4A 4UXHA 3UONA 1IP1A 3EMLA 2FBDA 3CDTA 3NYAA 4LGKA 1OP9B 1UIEA 1L35A 1QUDA 1L97A 2BQCA 4ET9A 2KMQA 1REZA 1L51A 1JITA 4ANRA 4D9ZA 1GBOA 3A94A 1FLQA 4DYGA 4WO6A 3HH5A 2OVOA 3OE9A 1FN5A 5T3FA 2QQ0A 1CJ6A 3AJNA 2LYMA 1QSBA 2X0AA 3WW6A 1L68A 2W0TA 2QB0B 5LVJA 1WTNA 3TO6A 126LA 4H8ZA 1LSAA 4H9FA 1FLYA 4I7KA 2DKVA 1PQJA 2C8PA 5FUVA 1OYUA 1IWXA 2BQIA 1IR8A 4LYTA 3W6BA 5I5QA 198LA 4EKSA 5AMYA 1ZVYB 1JWRA 1YL1X 1QS5A 1C45A 4GN4A 3SGBI 3MGWA 5E3QA 1TOTA 4DJHA 1LSEA 1Y1BA 221LA 3OXGA 1L36A 258LA 1D2YA 1D6QA 5C6IA 4QGZA 1D0KA 5KXNA 1KY0A 2B70A 4XJHA 4GCCA 3TXGA 1QUGA 3SGQI 4N0JA 1C6GA 1RFHA 2QQEA 1QUSA 2MEAA 6LYZA 1L34A 122LA 1CT2I 5F14A 1AT5A 3T36A 1WGTA 1QIOA 4GCEA 4H9BA 235LA 1L0KA 5E4PA 4KL7A 4O34A 1KIRC 1IC5Y 4NGKA 4TSBA 7WGAA 1LKRA 1GFTA 1C63A 4P2EA 1LZAA 2BQFA 3M3UA 1LZ5A 4GBRB 4BAFA 1IOCA 189LA 188LA 2Z6BA 4AGAA 2BQDA 2CWGA 2ENNA 5ILCA 1L0JA 4RW2A 1LYDA 1CKDA 4LFPA 2ZYCA 1FYBA 1LPYA 228LA 1PPFI 2AUBA 2MEDA 1B0DA 1JTMA 4RDSA 1AZFA 1BB7A 1K7VA 4L9MA 4ZFPA 3LN2A 1L69A 4XJDA 5FEKA 261LA 4HJZA 3G3AB 1HMLA 1MLCE 4G49A 4J0LA 5KXOA 2MEIA 4WM1A 4NGYA 4GI3C 5B05A 1A4VA 1UUZC 1JPOA 1P36A 3G3WA 1TBNA 1HF4A 1HC0A 1PQIA 1L50A 5C6JA 1SWYA 5IDDA 1IX0A 3HBEX 4Z98A 1BWJA 1L25A 1LSDA 3DKEX 4DDAA 4I7NA 1L59A 1SGRI 2F2NA 1CKHA 2RBPA 2J87A 4LT2A 1UVFA 4PPOA 2BQEA 1L00A 1YAMA 147LA 1C10A 2BUSA 3F6ZA 4ARJA 3TMWA 1IP2A 262LA 4W57A 3GUOA 1IOQA 3F9LA 3P65A 1D3MA 2YBMA 227LA 3QAKA 2A7FA 5FHWA 4NHTA 1WQMA 5B59A 1ZV5L 4KPMA 1L79A 234LA 4OWHA 3B72A 4LZMA 1QUOA 3UEJA 1D9UA 1LZ9A 3AGIA 4I7SA 1L47A 2B6YA 181LA 2ZIKA 3E3DA 250LA 5IELA 1OUDA 130LA 2ORWA 1LMOA 175LA 1C6NA 1LZYA 2Z39A 3OK0A 2MEBA 169LA 2LCBA 1CX6A 4NHPA 1UIBA 1MELL 1LJIA 1CU2A 3VE5A 5APFA 3VDUA 5HI7A 1B5XA 4H9EA 3B4VC 1M8CA 3C7WA 3LYTA 1DYFA 4M4OA 1CU0A 5A3ZA 5DN4A 2QQCA 3A93A 1L96A 3TO7A 1DYEA 1IVMA 2JXDA 3WU7A 196LA 2LC9A 2ARPF 4IAPA 1LI3A 4I7RA 2N71A 4DDBA 1OMTA 1LZ1A 1KBEA 4LZTA 1L26A 2VB1A 1C6JA 1UICA 1T3PA 230LA 4LT3A 1QDTA 4H92A 1GB7A 3A95A 2ROWA 2WGCA 1G0KA 5FELA 1UIDA 4A7DA 3HDEA 1WQPA 219LA 2F32A 131LA 1NDGC 4W52A 1SGEI 193LA 4TTDA 139LA 1G7MC 4J7VA 3HT9A 3VWOA 1TIHA 153LA 1YKZX 4EMNA 1CKFA 2ZNWY 1GB5A 2OU0X 1GB3A 1UIFA 1REXA 3CSQA 5B06A 3WU9A 3RU0A 3HFMY 3LZMA 2Z2FA 4NHSA 4HV2A 1TBOA 3LYZA 2ENZA 4YXAC 260LA 3RU5A 1LMTA 3NY8A 1LLHA 1NBYC 2RIJA 1NHBA 4J1AA 4DDCA 1B5VA 4SGBI 2VRWB 3W6CA 1G1WA 2LHMA 4MSTA 1DI4A 2D6BA 1RJCB 1G0JA 2ZIJA 1JEFA 1XX6A 1LZEA 1GB2A 2ANXA 1Y1CA 4LYBA 3WW5A 1L16A 254LA 1L40A 5B07A 1CV0A 1C7PA 1JJ1A 3JR6A 1F6RA 1C60A 3TXIA 1SQ2L 4I7LA 3A34A 4TSCA 1D2WA 1IY5A 1W3SA 2MEEA 4NGLA 2YBJA 2W1LA 1LSMA 4G9SA 1G07A 3EMSA 4G4HA 1HJAI 1L23A 4OOOA 4YX7C 3UGDA 3B6LA 4WM6A 1TGSI 218LA 4DD7A 190LA 1VFBC 3TMVA 5HQ8A 1DI3A 2DQEY 1RE2A 1GB9A 1P2CC 152LA 2W1XA 1B7LA 1G0QA 1LJ3A 1OUGA 1GHLA 4PGJB 2KCXA 2UVOA 248LA 4WG7A 1IR7A 1XEKA 3RZ4A 3MEKA 2OTZX 3GUIA 2LEOA 1L15A 1NWGA 4NY5A 1L87A 4CFPA 1OUCA 4HTNA 1KXYA 4QY9A 3QWPA 4EPFA 4HSFA 4WM3A 4X3BA 2F30A 158LA 4HPIA 1L93A 9WGAA 2GKTI 1CKGA 252LA 2DQCY 4WO9A 1PQDA 1YQVY 2G4NA 5EBHA 1I6SA 160LA 1LZBA 4ARMA 3D3DA 1JKDA 1OMUA 1C6DA 3W6FA 3FC3A 1JTOL 2CWHA 2KMPA 4WLXA 1B7NA 4NSIA 1AN1I 3A8ZA 5DLAA 1L60A 3HTGA 1X4SA 236LA 2YBIA 1SX7A 123LA 4I8SA 4UXIA 3V2YA 5IHGA 2B7XA 1G0PA 253LA 4NIJA 1L41A 1L81A 172LA 103LA 1L12A 2L78A 4ETEA 1LJEA 4WG1A 4PK0A 1XSFA 3IWRA 1LGUA 1B6IA 3SP3A 1L71A 4OWEA 1XGPC 4E1RA 4B4EA 5F81A 4GCDA 4C3WA 1C62A 4B6DA 1GF4A 1QSAA 1FLWA 4I7PA 1VDTA 3RW8A 3BKVA 2E73A 223LA 3G3XA 2ZILA 1XGRC 3ZVQA 1L20A 1LGWA 3F8VA 5KXXA 1L83A 217LA 3DN4A 2GKVA 3GOXA 187LA 1KBFA 1WTHA 1SGYI 3WVXA 1LYFA 2OU2A 3WULA 3DN2A 4IASA 2B6TA 157LA 5KJ9A 3HH2C 1LYOA 3W6DA 2JA1A 1L46A 1HSXA 1L91A 4W54A 3TXFA 1C6EA 1L54A 4AXTA 1L77A 239LA 4TWSA 3P66A 3B0OA 4FDYA 3HUKA 246LA 3AGGG 1W4RA 2QARC 1ULNA 1L03A 1L95A 1IWWA 1L58A 1GF5A 6LYTA 4ETBA 1KXWA 5LYZA 1NQIA 1LZNA 4WL7A 1L27A 2HU1A 3WPLA 1CV1A 1NBZC 2CUUA 1G7LC 255LA 2BLYA 1L48A 1OYVI 4N9RA 4CHXA 1LYZA 4W56A 1C6QA 3K3TA 182LA 1GFRA 1WQRA 1B5ZA 1PQKA 4JCVE 4NWHA 3OE6A 1WVVA 1HEPA
chains in the Genus database with same CATH topology
3SB7A 1XGTC 1K28A 113LA 1K7UA 149LA 4H8XA 1B5UA 2NWDX 1EQ4A 3N9AA 4ML7A 1L57A 1DYAA 2X52A 1P64A 242LA 2XJWA 1OVKA 1T6HA 1L53A 1TLAA 3FI7A 4GLVA 2HTXA 3C81A 4N1EI 4W51A 1L09A 1C6IA 1L86A 1L39A 1UHAA 1L92A 1GBWA 1QTEA 1LSNA 3BKHA 4XJGA 4W94A 1CUQA 1LJHA 143LA 4N5RA 1DYCA 1L94A 1L14A 4NEBA 4XJIA 3WYHA 1QSQA 3N9CA 1CX7A 3NY9A 4RLMA 1CV3A 4WL6A 3ATNA 1QT4A 4XJBA 4LT1A 3LZTA 1G0GA 4NFVA 3GUJA 4ARPA 5I54A 107LA 3GUKA 1FKVA 225LA 1L73A 3LYOA 5D5CA 1LTMA 2YBNA 1B5WA 4H9IA 2NTHA 3C7ZA 151LA 2BPUA 1B7QA 2OTYX 1BVKC 111LA 1LSFA 1BB6A 1GE3A 5KXRA 1P2RA 3DMZA 4ETCA 4WMGA 3GULA 1LZDA 2DQJY 177LA 1L98A 3W6EA 2Z38A 5DL9A 5KKJA 5I53A 2RH1A 1L85A 1V7SA 3B0KA 1H6MA 3HUQA 176LA 199LA 3V2WA 1GXV2 208LA 1F0WA 4MR1A 2BAAA 4OW1A 5LAFA 4DWXA 4NWEA 210LA 2CGIA 2DBTA 1KNIA 1GWDA 1L01A 110LA 1C69A 2ZQ4A 3A90A 3EO5A 2RBNA 1TDYA 5LVHA 4NHQA 5HMVA 1JSEA 135LA 1KIPC 4YF2A 3QE8A 192LA 4YEOA 4Z46A 1P3NA 2BQNA 1UIAA 5KKIA 3AW6A 1XGQC 1L18A 1QT6A 1IWZA 4I7MA 1YANA 1A2YC 3CSZA 4TUNA 4HJVA 3A3QA 1L19A 4LDLA 2RB0X 3WPJA 1QT7A 5LIOA 4EJ4A 3TMUA 4M6DA 1C6CA 2HULA 3HTDA 1FKQA 3N9EA 4OWBA 2ANVA 1QT8A 4YXCA 3CDVA 4XADA 1XEIA 1XJUA 1P9ZA 4CGEA 1UIGA 1LW9A 132LA 5M1YA 5LVIA 170LA 1JJ0A 3CB7A 1LJFA 4W59A 1RCMA 4KT3A 3A3RX 1CV4A 4DKLA 1KW7A 1LSZA 1CUPA 1EPYA 1LI2A 1GE0A 1LMQA 4CFOA 125LA 1N4FA 1C6LA 1YROA 237LA 2GV0A 1B2KA 256LA 3ATOA 1C6KA 1LCNA 3DN0A 1L80A 1L74A 4NGVA 1L55A 1UBZA 3C8SA 4WOAA 1HEQA 1NHEA 1C6AA 1YILA 1KS3A 112LA 1JUGA 2DQDY 3J6KA 3LYMA 2B74A 3LHMA 1FDLY 1TEWA 200LA 3CT0A 3G3BB 4HV1A 1PZYA 4YEMA 1B7OA 2OE7X 159LA 137LA 1GFVA 1D3JA 1LMAA 3GUMA 1P5CA 1YL0X 3TXBA 1C65A 1TBYA 1BB3A 5LA5A 5LINA 1C6BA 2G4PA 1QTKA 4UWUA 3HBDA 4HP0A 2OEAX 5LYTA 1WQOA 4EKRA 1G7IC 1GF0A 2YSSC 5APCA 2WARA 1L06A 4LT0A 2F2QA 3ULRA 1B7SA 1HEWA 3ODUA 4ETDA 1L67A 1QUTA 3AZ6A 2RBOA 1IWYA 1LYIA 2W1YA 146LA 155LA 1C68A 1XEPA 1ALCA 1PS5A 4NSHA 8LYZA 4HJYA 4UWNA 1LYSA 1LSCA 1QT5A 1L31A 1L75A 3HU8A 1LMCA 3SB5A 4OWAA 2B75A 3A91A 1WGCA 1AM7A 3HDFA 3C8RA 2OU9A 4B49A 4Z41A 1GBYA 1OUIA 1CV5A 3SB6A 2PC2A 1P37A 2OE9X 1BHZA 171LA 1L82A 1L65A 2BQOA 4WP4A 2HU3A 1IOTA 1CNSA 1L30A 2I25L 1L70A 1LSGA 5I4YA 214LA 1H87A 1L21A 1LSPA 1L37A 5L9JA 5KXYA 4DD0A 1GB0A 3WUMA 2O79A 3C7YA 1E8LA 4DD2A 1GFKA 1D0MA 4H93A 4LFXA 1DQJC 2Z2EA 5F16A 1I20A 2RBSA 3SB8A 1BB5A 5FCPA 142LA 3A6CY 5A3EA 1B7MA 1LYYA 1L22A 4ARQA 1G7JC 207LA 4B1AA 4ARMB 1C46A 1IP7A 1SSWA 1JIYA 1L61A 1J1OY 5KXSA 1HENA 3WXUA 3KAMA 1F6SA 5HQ1A 1L38A 3EXDA 1OUAA 1ZVHL 4H91A 1L89A 4LYOA 3WH1A 2F47A 1GF3A 3A6BY 4PJ2C 4OOTA 238LA 167LA 1L62A 4G4CA 1L17A 1IP5A 2Z12A 2Z19A 245LA 1L49A 2A7DA 3CDRA 1BWIA 1LZ8A 1P9GA 2G4QA 1HEVA 4DT3A 1I1ZA 1OWZA 3TXKA 1B9OA 5APEA 1EQ5A 1IO5A 4ETAA 1JTPL 1P56A 3AYQA 2XBSA 1EL1A 1QUHA 4E3UA 1HELA 1L88A 3D9AC 1IP3A 3SBBC 1LHMA 1LZ4A 220LA 3ZVQB 1GFUA 1B5YA 140LA 1P2LA 4GCFA 3W6AA 1GE2A 4HTKA 109LA 2YBHA 2D4JA 1JISA 2H5ZA 4LDEA 114LA 1GFGA 5I14A 1GFEA 1LYHA 2BQGA 1QS9A 1VAUA 211LA 2FYCA 1XGUC 3C80A 244LA 3AZ4A 224LA 3M18B 1CV6A 2RSCA 257LA 4NSGA 3DN8A 3P68A 3A92A 3D4SA 102LA 3B0IA 1CU3A 4DD3A 1HNLA 2ZYPA 1LMPA 2LZ2A 4EKQA 2BQJA 1IP6A 2ZWBA 3HH6A 1IOSA 1UA6Y 1YIKA 133LA 1GAZA 1LHHA 2Z18A 1GBSA 4FJRA 191LA 4NHIA 1L44A 1YKYX 1L56A 2Q9DA 1WTMA 1JSFA 1OVHA 3CT1A 173LA 2D4KA 3QNGA 4H8YA 2XQOA 1PQMA 1J1PY 1VDPA 1GF8A 3WUNA 1ZWNA 4L41A 5F9XA 185LA 3FE0A 215LA 4EPIA 3W3EA 4LYZA 2IGCA 4WLDA 3C83A 1KXXA 2OE4X 4ET8A 1YAOA 5K7OA 3HTFA 2LYZA 1AKIA 4H1PA 1C6HA 2DQAA 4OO9A 1LZGA 4H9CA 2OU8A 1BVXA 3FI5A 4BS7A 1DXJA 2YBLA 2B73A 3WVYA 2HECA 3IJUA 1LZ6A 2ZNXY 3K2RA 2Y8PA 3GUNA 3HH3A 3CQLA 4RW1A 4XENA 232LA 3TXHA 4I7JA 5HLLA 2MECA 4AQNA 2DQFC 1BGIA 5L3HA 1C43A 1WKXA 1T8AA 5LYMA 3HBHA 2HEFA 1IIZA 174LA 1WVUA 1OQMA 168LA 4NGJA 1UC0A 1BWHA 1GE1A 4BADA 1DYDA 1VEDA 2XBRA 5LAGA 2RB1X 1LWKA 4IATA 2Z37A 2DQIY 1NDMC 2B6ZA 3DNAA 213LA 2Q9EA 1GB6A 4DD1A 2RAZX 3WU8A 3ZEKA 1LYEA 2B5ZA 164LA 2NTGA 1CJ9A 1D3NA 4PHIA 1L24A 3C8QA 4KXIA 1G1VA 1L07A 4U3XB 1L76A 4H9HA 5KXTA 241LA 1LJGA 1LHJA 1JKCA 4XN6A 3GXRA 4GN5C 154LA 1JQUA 1W6ZA 1VDQA 4EOFA 1LI6A 3AB6A 1CTWA 2W1MA 1HEOA 1LJNA 1D0LA 4B0DA 5KXZA 2F4GA 119LA 3IJVA 4LYCA 1LJKA 4ARLA 233LA 1L02A 1C61A 229LA 1LZSA 2N5ZA 115LA 1YAQA 1GFAA 1L66A 1GD6A 1L08A 1WQNA 2LZMA 2O7AA 1GB8A 1QTBA 129LA 4NSJA 5L3IA 4BAPA 3TXDA 3RUNA 2B72A 1GBZA 1L42A 3AW7A 1D9WA 3DMXA 1IWUA 5LZMA 9LYZA 144LA 2MEHA 4OWCA 4I0CA 141LA 4B4JA 1DYGA 2FBBA 259LA 1YKXX 4NGZA 5E9RA 186LA 3C82A 1L64A 5LXWA 4S0WA 3CDOA 2HUBA 212LA 1CJ8A 1L29A 2CDSA 4I7QA 2B6XA 2LB7A 1GDWA 5I4WA 1L13A 1T8GA 1DZBX 3AGHA 3WPKA 4GRVA 1HEMA 1SX2A 1ZURA 2A4TA 2FYDA 1L10A 5B1FA 1GAYA 1L43A 2EIZC 4WM5A 1LHKA 3WUAA 5FSTA 1W08A 4C5FA 184LA 1L04A 1REMA 1IWVA 2I26L 4WM2A 1ULKA 4WLTA 1L99A 1OVJA 1L32A 4ZIXA 1QSWA 1O23A 1VDSA 4YOPA 1INUA 1KY1A 5DM9A 1Q9BA 1LYJA 4DQ7A 3OE8A 5HNCA 5JENB 1ZMYL 2HEDA 2BQMA 3J4GA 5LVGA 2IHLA 4G4BA 1AT6A 5C6LA 3AZ7A 1D6PA 1IR9A 3HTBA 2HEAA 1NKHA 4N8ZA 1L63A 1CJ7A 1PQOA 3HH4A 3P64A 2X3TA 1CKCA 1G0MA 3TXEA 2C8OA 145LA 3WXTA 3PDSA 5APDA 5KXWA 1P46A 1IY3A 134LA 4XYYA 4YM8A 1JKAA 138LA 194LA 5HNLA 1C66A 1GBXA 4W96A 1C6MA 4NG1A 3GXKA 1QTCA 5II3A 2RAYX 4YENA 1L90A 1OV5A 3T6UA 1P7SA 1GFHA 163LA 3EBAB 3HU9A 4AMLA 4K5YA 3SB9A 118LA 1D3FA 4UWVA 161LA 4H94A 1TCYA 1HFZA 1CVKA 1GPQC 128LA 1L84A 4RLNA 1L28A 4HTQA 1LZTA 4GCBA 2LZTA 3CT5A 2ZQ3A 1IEEA 1GF6A 3OE0A 2MEGA 1JTTL 1C64A 1SLYA 3LZ2A 5KXMA 2BQHA 1ULMA 3FA0A 3DN3A 1L11A 1UCOA 1F10A 1G06A 2EKSC 222LA 5DN5A 4ARQB 4B4IA 3RT5X 197LA 4ZEEA 4PJZA 5FDJA 2DQHY 2EPEA 1DI5A 1REYA 3G3VA 1J1XY 1LKSA 2LYOA 1NF5A 4N1CC 4TX7A 5F9UA 5I4XA 3HT7A 5B1GA 1CU6A 1RFPA 4I7OA 1SWZA 247LA 3QY4A 1QTZA 3TMXA 1XFPL 3P4ZA 1DPXA 3SBAA 4NGWA 1L33A 1LZRA 1HFYA 1RI8B 2YVBA 4NG8A 166LA 5KXPA 2RBRA 2HEBA 1L52A 3A96A 4DQJA 3RNXA 1IC4Y 1ZYTA 1BB4A 1K7TA 1LPIA 1G0LA 1OUHA 1GEVA 1JJ3A 3DN1A 1HSWA 4R6CA 5LA8A 162LA 1FLUA 1P6YA 226LA 1G7HC 1DYBA 1YAPA 4QEQA 4DAJA 156LA 3TXJA 4MPIA 127LA 4GN3A 1C67A 1L45A 1IP4A 4MCKA 3CSRA 3A67Y 4E97A 5D5FA 2O4WA 2H9KA 3HT8A 1OUBA 2DQGY 4PRUA 3L64A 1LSBA 104LA 1KW5A 3GUPA 240LA 1CU5A 1HERA 4WLYA 1B7PA 1LAAA 231LA 3HWLA 1LJJA 3FADA 1QTDA 1OUJA 4J1BA 5J7CA 4NGOA 5HMJA 1DKKA 2H9JA 5ILFA 1LHLA 1LOZA 1C6FA 4DQ5A 1EQEA 2BQLA 2YDGA 1UACY 108LA 178LA 2HUKA 1C6TA 1Z55A 3HT6A 1L05A 4LDOA 1FBIX 2Q0MX 1T8FA 4EKPA 3L2XA 1LSYA 1UIHA 1QTVA 2CJLA 1GF9A 251LA 1SSYA 1LZCA 180LA 1JKBA 4QDNA 3HUAA 7LZMA 2HUMA 1GXXA 148LE 1IY4A 1LYGA 1TAYA 3CDQA 2IFFY 5KY1A 1B7RA 5KXLA 4DD9A 1WQQA 3PBLA 1GEZA 3RZEA 4LYMA 2BQAA 206LA 3OJPA 3DMVA 2D4IA 7LYZA 2CWIA 2HEEA 4W58A 3VW7A 205LA 3SN6R 1L72A 4NGIA 1C6PA 1IORA 1VATA 2XTHA 1NMMA 1JHLA 1KIQC 201LA 6LZMA 120LA 1HFXA 1IC7Y 1OV7A 1C08C 1GF7A 2RBQA 195LA 1QT3A 1DPWA 4ZPUA 2B6WA 1HHLA 4HPEA 5KXKA 4XJFA 4R0FA 1QDRA 1LWGA 2MEFA 165LA 1I56A 4H90A 1V7TA 4GLAA 4PRQA 1LJ4A 4Z3MA 4W53A 1OUFA 2D91A 3WMKA 4CJ2A 4EXMA 209LA 249LA 2BQBA 1XEJA 4I7TA 4II8A 1QQYA 1BQLY 1DKJA 5LVKA 1JTNA 2F4AA 216LA 1HMKA 1GDXA 1T97A 4IJ4A 3AZ5A 2BLXA 3WL2A 1LGXA 1OWYA 1OUEA 3DN6A 2BQKA 2I6ZA 243LA 1GE4A 1LMNA 1LHIA 183LA 2RB2X 2EQLA 1QTHA 1IWTA 1T6VL 4H9AA 1GFJA 150LA 4W55A 4DC4A 1XJTA 4WM4A 3UONA 1IP1A 3EMLA 2FBDA 3CDTA 3NYAA 4LGKA 1OP9B 1UIEA 1L35A 1QUDA 1L97A 2BQCA 4ET9A 1REZA 1L51A 1JITA 4ANRA 4D9ZA 1GBOA 3A94A 1FLQA 4DYGA 4WO6A 3HH5A 3OE9A 1FN5A 5T3FA 1CJ6A 3AJNA 2LYMA 1QSBA 2X0AA 3WW6A 1L68A 2QB0B 5LVJA 1WTNA 126LA 4H8ZA 1LSAA 4H9FA 1FLYA 4I7KA 2DKVA 1PQJA 2C8PA 1OYUA 1IWXA 2BQIA 1IR8A 4LYTA 3W6BA 5I5QA 198LA 4EKSA 5AMYA 1ZVYB 1JWRA 1YL1X 1QS5A 1C45A 4GN4A 3MGWA 4DJHA 1LSEA 221LA 1L36A 258LA 1D2YA 1D6QA 5C6IA 4QGZA 1D0KA 5KXNA 1KY0A 2B70A 4XJHA 4GCCA 3TXGA 1QUGA 4N0JA 1C6GA 1QUSA 2MEAA 6LYZA 1L34A 122LA 5F14A 1AT5A 3T36A 1WGTA 1QIOA 4GCEA 4H9BA 235LA 1L0KA 5E4PA 4KL7A 4O34A 1KIRC 1IC5Y 4NGKA 4TSBA 7WGAA 1LKRA 1GFTA 1C63A 4P2EA 1LZAA 2BQFA 3M3UA 1LZ5A 4GBRB 4BAFA 1IOCA 189LA 188LA 2Z6BA 4AGAA 2BQDA 2CWGA 5ILCA 1L0JA 4RW2A 1LYDA 1CKDA 4LFPA 2ZYCA 1LPYA 228LA 2AUBA 2MEDA 1B0DA 1JTMA 4RDSA 1AZFA 1BB7A 1K7VA 4ZFPA 3LN2A 1L69A 4XJDA 5FEKA 261LA 4HJZA 3G3AB 1HMLA 1MLCE 4G49A 4J0LA 5KXOA 2MEIA 4WM1A 4NGYA 5B05A 1A4VA 1UUZC 1JPOA 1P36A 3G3WA 1HF4A 1HC0A 1PQIA 1L50A 5C6JA 1SWYA 5IDDA 1IX0A 3HBEX 4Z98A 1BWJA 1L25A 1LSDA 3DKEX 4DDAA 4I7NA 1L59A 2F2NA 1CKHA 2RBPA 4LT2A 4PPOA 2BQEA 1L00A 1YAMA 147LA 1C10A 3F6ZA 4ARJA 3TMWA 1IP2A 262LA 4W57A 3GUOA 1IOQA 3F9LA 3P65A 1D3MA 2YBMA 227LA 3QAKA 2A7FA 5FHWA 4NHTA 1WQMA 5B59A 1ZV5L 4KPMA 1L79A 234LA 4OWHA 3B72A 4LZMA 1QUOA 1D9UA 1LZ9A 3AGIA 4I7SA 1L47A 2B6YA 181LA 2ZIKA 3E3DA 250LA 5IELA 1OUDA 130LA 1LMOA 175LA 1C6NA 1LZYA 2Z39A 3OK0A 2MEBA 169LA 2LCBA 1CX6A 4NHPA 1UIBA 1MELL 1LJIA 1CU2A 5APFA 1B5XA 4H9EA 3C7WA 3LYTA 1DYFA 4M4OA 1CU0A 5A3ZA 5DN4A 3A93A 1L96A 1DYEA 1IVMA 3WU7A 196LA 2LC9A 4IAPA 1LI3A 4I7RA 4DDBA 1LZ1A 4LZTA 1L26A 2VB1A 1C6JA 1UICA 1T3PA 230LA 4LT3A 1QDTA 4H92A 1GB7A 3A95A 2WGCA 1G0KA 5FELA 1UIDA 4A7DA 3HDEA 1WQPA 219LA 2F32A 131LA 1NDGC 4W52A 193LA 4TTDA 139LA 1G7MC 4J7VA 3HT9A 3VWOA 153LA 1YKZX 4EMNA 1CKFA 2ZNWY 1GB5A 2OU0X 1GB3A 1UIFA 1REXA 3CSQA 5B06A 3WU9A 3HFMY 3LZMA 2Z2FA 4NHSA 4HV2A 3LYZA 4YXAC 260LA 3RU5A 1LMTA 3NY8A 1LLHA 1NBYC 1NHBA 4J1AA 4DDCA 1B5VA 3W6CA 1G1WA 2LHMA 4MSTA 1DI4A 2D6BA 1RJCB 1G0JA 2ZIJA 1JEFA 1LZEA 1GB2A 2ANXA 4LYBA 3WW5A 1L16A 254LA 1L40A 5B07A 1CV0A 1C7PA 1JJ1A 3JR6A 1F6RA 1C60A 3TXIA 1SQ2L 4I7LA 3A34A 4TSCA 1D2WA 2MEEA 4NGLA 2YBJA 2W1LA 1LSMA 4G9SA 1G07A 3EMSA 4G4HA 1L23A 4OOOA 4YX7C 3B6LA 4WM6A 218LA 4DD7A 190LA 1VFBC 3TMVA 1DI3A 2DQEY 1RE2A 1GB9A 1P2CC 152LA 2W1XA 1B7LA 1G0QA 1LJ3A 1OUGA 1GHLA 4PGJB 2UVOA 248LA 4WG7A 1IR7A 1XEKA 3RZ4A 2OTZX 3GUIA 1L15A 1NWGA 4NY5A 1L87A 4CFPA 1OUCA 4HTNA 1KXYA 4QY9A 4EPFA 4HSFA 4WM3A 4X3BA 2F30A 158LA 4HPIA 1L93A 9WGAA 1CKGA 252LA 2DQCY 4WO9A 1PQDA 1YQVY 2G4NA 5EBHA 1I6SA 160LA 1LZBA 4ARMA 3D3DA 1JKDA 1C6DA 3W6FA 1JTOL 4WLXA 1B7NA 4NSIA 3A8ZA 5DLAA 1L60A 3HTGA 236LA 2YBIA 1SX7A 123LA 4I8SA 3V2YA 5IHGA 2B7XA 1G0PA 253LA 4NIJA 1L41A 1L81A 172LA 103LA 1L12A 2L78A 4ETEA 1LJEA 4WG1A 4PK0A 1XSFA 3IWRA 1LGUA 1B6IA 3SP3A 1L71A 4OWEA 1XGPC 4B4EA 5F81A 4GCDA 4C3WA 1C62A 1GF4A 1QSAA 1FLWA 4I7PA 1VDTA 3RW8A 3BKVA 223LA 3G3XA 2ZILA 1XGRC 3ZVQA 1L20A 1LGWA 3F8VA 5KXXA 1L83A 217LA 3DN4A 187LA 1WTHA 3WVXA 1LYFA 3WULA 3DN2A 4IASA 2B6TA 157LA 5KJ9A 1LYOA 3W6DA 1L46A 1HSXA 1L91A 4W54A 3TXFA 1C6EA 1L54A 4AXTA 1L77A 239LA 4TWSA 3P66A 3B0OA 4FDYA 3HUKA 246LA 3AGGG 2QARC 1ULNA 1L03A 1L95A 1IWWA 1L58A 1GF5A 6LYTA 4ETBA 1KXWA 5LYZA 1NQIA 1LZNA 4WL7A 1L27A 2HU1A 3WPLA 1CV1A 1NBZC 2CUUA 1G7LC 255LA 2BLYA 1L48A 4N9RA 4CHXA 1LYZA 4W56A 1C6QA 3K3TA 182LA 1GFRA 1WQRA 1B5ZA 1PQKA 4NWHA 3OE6A 1WVVA 1HEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KXM A;  1LHM A;  4ZFP A;  1LZ4 A;  3LN2 A;  4XJD A;  3ZVQ B;  1GFU A;  2BQH A;  5FEK A;  1XGT C;  1ULM A;  1B5Y A;  4HJZ A;  1K7U A;  3G3A B;  4GCF A;  1HML A;  3W6A A;  1UCO A;  1MLC E;  1B5U A;  4H8X A;  1GE2 A;  1F10 A;  4G49 A;  2NWD X;  1EQ4 A;  3N9A A;  4J0L A;  4ML7 A;  2EKS C;  2MEI A;  5KXO A;  2X52 A;  2XJW A;  4HTK A;  4WM1 A;  4NGY A;  5DN5 A;  5B05 A;  3FI7 A;  4GLV A;  2HTX A;  1A4V A;  4B4I A;  4N1E I;  1UUZ C;  3RT5 X;  2YBH A;  2D4J A;  1JPO A;  1JIS A;  1HF4 A;  1UHA A;  1HC0 A;  2H5Z A;  4ZEE A;  1GBW A;  1QTE A;  5FDJ A;  2DQH Y;  5C6J A;  1GFG A;  2EPE A;  1DI5 A;  1LSN A;  1REY A;  3BKH A;  1J1X Y;  1IX0 A;  1GFE A;  5IDD A;  4XJG A;  3HBE X;  2BQG A;  1VAU A;  1BWJ A;  4W94 A;  4Z98 A;  1LKS A;  1LSD A;  2LYO A;  1NF5 A;  4N1C C;  4DDA A;  4TX7 A;  1LJH A;  2FYC A;  5F9U A;  4N5R A;  5I4X A;  1XGU C;  5B1G A;  4NEB A;  4XJI A;  3AZ4 A;  3M18 B;  3WYH A;  2RSC A;  4NSG A;  2F2N A;  3N9C A;  3P68 A;  1RFP A;  1CKH A;  3QY4 A;  3TMX A;  3A92 A;  1XFP L;  4LT2 A;  3P4Z A;  4RLM A;  1DPX A;  4NGW A;  4PPO A;  3B0I A;  2BQE A;  3ATN A;  4WL6 A;  1LZR A;  1YAM A;  4DD3 A;  1HNL A;  1HFY A;  4XJB A;  1RI8 B;  2YVB A;  2ZYP A;  1C10 A;  4LT1 A;  4NG8 A;  3LZT A;  4NFV A;  3F6Z A;  5KXP A;  1LMP A;  3TMW A;  5I54 A;  1IP2 A;  1FKV A;  2HEB A;  2LZ2 A;  3LYO A;  2BQJ A;  5D5C A;  1IOQ A;  1LTM A;  2YBN A;  3P65 A;  1IP6 A;  1B5W A;  2YBM A;  2ZWB A;  4H9I A;  3A96 A;  2A7F A;  5FHW A;  4NHT A;  1WQM A;  1IOS A;  5B59 A;  3RNX A;  1ZV5 L;  1IC4 Y;  2BPU A;  1UA6 Y;  1YIK A;  4KPM A;  1B7Q A;  1BB4 A;  1K7T A;  133L A;  1GAZ A;  4OWH A;  3B72 A;  1LHH A;  2Z18 A;  1LPI A;  1GBS A;  4FJR A;  1BVK C;  1LSF A;  1OUH A;  1GEV A;  1JJ3 A;  1BB6 A;  1D9U A;  1GE3 A;  1HSW A;  1YKY X;  4NHI A;  4R6C A;  5LA8 A;  5KXR A;  1WTM A;  1FLU A;  1LZ9 A;  3AGI A;  4ETC A;  1JSF A;  4WMG A;  1G7H C;  1LZD A;  1YAP A;  3CT1 A;  4QEQ A;  2DQJ Y;  3E3D A;  2ZIK A;  3TXJ A;  4MPI A;  2D4K A;  1OUD A;  3QNG A;  5IEL A;  4H8Y A;  4GN3 A;  3W6E A;  2Z38 A;  5DL9 A;  5KKJ A;  1J1P Y;  1IP4 A;  4MCK A;  1VDP A;  1GF8 A;  3CSR A;  1LMO A;  3A67 Y;  5I53 A;  3WUN A;  4L41 A;  5F9X A;  3FE0 A;  5D5F A;  3W3E A;  1V7S A;  3B0K A;  1LZY A;  1H6M A;  2Z39 A;  3OK0 A;  2MEB A;  2H9K A;  4LYZ A;  4PRU A;  1OUB A;  2DQG Y;  4WLD A;  4NHP A;  1KXX A;  1GXV 2;  208L A;  1LSB A;  1UIB A;  1F0W A;  1MEL L;  1LJI A;  4MR1 A;  2BAA A;  4OW1 A;  4ET8 A;  5APF A;  1YAO A;  1B5X A;  4H9E A;  5K7O A;  5LAF A;  4DWX A;  4NWE A;  2LYZ A;  1AKI A;  4H1P A;  2CGI A;  2DBT A;  2DQA A;  1HER A;  3LYT A;  1LZG A;  1B7P A;  4WLY A;  1LAA A;  1GWD A;  4H9C A;  1LJJ A;  2ZQ4 A;  3A90 A;  3EO5 A;  1OUJ A;  1TDY A;  4J1B A;  1BVX A;  5LVH A;  4M4O A;  4NHQ A;  5A3Z A;  1JSE A;  5DN4 A;  4BS7 A;  5HMV A;  1DXJ A;  5J7C A;  4NGO A;  5HMJ A;  2YBL A;  1DKK A;  135L A;  2H9J A;  3A93 A;  5ILF A;  1LHL A;  1LOZ A;  1IVM A;  4HV1 A;  3WU7 A;  2HEC A;  1EQE A;  3WVY A;  1KIP C;  2BQL A;  3IJU A;  1LZ6 A;  2YDG A;  2ZNX Y;  3QE8 A;  4YF2 A;  2Y8P A;  1UAC Y;  3CQL A;  1Z55 A;  4YEO A;  4Z46 A;  4DDB A;  4RW1 A;  4XEN A;  1LZ1 A;  4LZT A;  1FBI X;  2Q0M X;  2VB1 A;  2BQN A;  1UIC A;  1T3P A;  1UIA A;  4LT3 A;  5KKI A;  1QDT A;  1XGQ C;  1LSY A;  3AW6 A;  4H92 A;  1UIH A;  3TXH A;  1GB7 A;  5HLL A;  3A95 A;  2CJL A;  2WGC A;  2MEC A;  5FEL A;  1IWZ A;  1GF9 A;  1UID A;  1YAN A;  1A2Y C;  1LZC A;  2DQF C;  4A7D A;  3CSZ A;  1BGI A;  4TUN A;  1WQP A;  4HJV A;  1C43 A;  1WVV A;  3A3Q A;  4QDN A;  1NDG C;  5L3H A;  1WKX A;  5LYM A;  3HBH A;  2HEF A;  1IIZ A;  1WVU A;  4NGJ A;  1OQM A;  1GXX A;  1UC0 A;  193L A;  1IY4 A;  4TTD A;  3WPJ A;  1TAY A;  1BWH A;  1GE1 A;  5LIO A;  4BAD A;  2IFF Y;  1G7M C;  4J7V A;  3VWO A;  1B7R A;  5KY1 A;  1YKZ X;  5KXL A;  4DD9 A;  4EMN A;  1CKF A;  153L A;  1VED A;  1WQQ A;  3TMU A;  2ZNW Y;  1GB5 A;  2XBR A;  4M6D A;  5LAG A;  1GEZ A;  1GB3 A;  1FKQ A;  1REX A;  1UIF A;  3CSQ A;  3N9E A;  4LYM A;  4OWB A;  5B06 A;  2BQA A;  3HFM Y;  3OJP A;  2Z2F A;  2D4I A;  4IAT A;  4NHS A;  4XAD A;  1XEI A;  2Z37 A;  4HV2 A;  3LYZ A;  1P9Z A;  2DQI Y;  1NDM C;  4CGE A;  3RU5 A;  1UIG A;  7LYZ A;  2CWI A;  132L A;  1LMT A;  5M1Y A;  5LVI A;  1NBY C;  1GB6 A;  4J1A A;  4DDC A;  2HEE A;  1JJ0 A;  4DD1 A;  3CB7 A;  1LJF A;  3WU8 A;  3ZEK A;  1RCM A;  1B5V A;  4KT3 A;  3A3R X;  4NGI A;  3W6C A;  2LHM A;  2B5Z A;  1IOR A;  1VAT A;  2XTH A;  4MST A;  1DI4 A;  2D6B A;  1CJ9 A;  1RJC B;  1NMM A;  4PHI A;  1JHL A;  1KIQ C;  1LSZ A;  4KXI A;  2ZIJ A;  1JEF A;  4U3X B;  1HFX A;  4H9H A;  1LZE A;  5KXT A;  1GB2 A;  1GE0 A;  1LMQ A;  4LYB A;  1LJG A;  3WW5 A;  4CFO A;  1LHJ A;  1IC7 Y;  1JKC A;  5B07 A;  1N4F A;  1GF7 A;  1C08 C;  1C7P A;  1YRO A;  4XN6 A;  1JJ1 A;  1DPW A;  3GXR A;  1F6R A;  2GV0 A;  4GN5 C;  3TXI A;  154L A;  1B2K A;  1HHL A;  1SQ2 L;  4HPE A;  3ATO A;  1W6Z A;  1VDQ A;  1LCN A;  5KXK A;  4EOF A;  3A34 A;  4XJF A;  4R0F A;  4TSC A;  1QDR A;  3AB6 A;  4NGV A;  2W1M A;  2MEE A;  1UBZ A;  1HEO A;  1LJN A;  1D0L A;  1HEQ A;  2YBJ A;  4NGL A;  2MEF A;  2W1L A;  4WOA A;  1LSM A;  4G9S A;  4B0D A;  3EMS A;  5KXZ A;  1I56 A;  2F4G A;  4G4H A;  4H90 A;  1NHE A;  1V7T A;  4OOO A;  1YIL A;  3IJV A;  4LYC A;  3B6L A;  4GLA A;  4WM6 A;  1LJK A;  4PRQ A;  4DD7 A;  1SLY A;  1LJ4 A;  4Z3M A;  1VFB C;  3TMV A;  1OUF A;  2D91 A;  1DI3 A;  1JUG A;  2DQE Y;  3WMK A;  2DQD Y;  1RE2 A;  3J6K A;  4CJ2 A;  1GB9 A;  3LYM A;  3LHM A;  1FDL Y;  1TEW A;  1P2C C;  3CT0 A;  2W1X A;  1B7L A;  1LJ3 A;  1OUG A;  1LZS A;  1PZY A;  1GHL A;  2N5Z A;  3G3B B;  1YAQ A;  1GFA A;  2BQB A;  4PGJ B;  1GD6 A;  4YEM A;  1XEJ A;  1WQN A;  4II8 A;  1B7O A;  2UVO A;  1QQY A;  4WG7 A;  1BQL Y;  1DKJ A;  1GB8 A;  5LVK A;  4NSJ A;  5L3I A;  1IR7 A;  1GFV A;  1XEK A;  2F4A A;  4BAP A;  3RZ4 A;  3TXD A;  1LMA A;  1HMK A;  1YL0 X;  1GDX A;  3TXB A;  4IJ4 A;  3AZ5 A;  2BLX A;  1NWG A;  1GBZ A;  3AW7 A;  4NY5 A;  1TBY A;  4CFP A;  1BB3 A;  1IWU A;  1OUC A;  3WL2 A;  5LA5 A;  4HTN A;  1KXY A;  9LYZ A;  5LIN A;  4QY9 A;  2G4P A;  1OUE A;  3WU9 A;  1QTK A;  2MEH A;  4HSF A;  4OWC A;  4I0C A;  4UWU A;  3HBD A;  2BQK A;  4HP0 A;  4WM3 A;  4B4J A;  2I6Z A;  2FBB A;  5LYT A;  1WQO A;  4X3B A;  2F30 A;  4HPI A;  1GE4 A;  1G7I C;  1LMN A;  1GF0 A;  1YKX X;  2YSS C;  4NGZ A;  1LHI A;  5E9R A;  1CKG A;  9WGA A;  5APC A;  2WAR A;  2DQC Y;  4LT0 A;  5LXW A;  3ULR A;  2EQL A;  1B7S A;  4WO9 A;  1IWT A;  1HEW A;  1T6V L;  4H9A A;  1GFJ A;  2HUB A;  4DC4 A;  4ETD A;  1YQV Y;  4WM4 A;  2G4N A;  1CJ8 A;  1QUT A;  3AZ6 A;  5EBH A;  1IWY A;  1IP1 A;  1LZB A;  2CDS A;  2W1Y A;  3D3D A;  1JKD A;  2FBD A;  2LB7 A;  1GDW A;  4LGK A;  5I4W A;  1ALC A;  1DZB X;  1PS5 A;  1JTO L;  1OP9 B;  1UIE A;  3LZ2 A;  4NSH A;  3W6F A;  8LYZ A;  4HJY A;  4UWN A;  4WLX A;  1B7N A;  4NSI A;  3AGH A;  1LYS A;  3A8Z A;  3WPK A;  1HEM A;  1LSC A;  5DLA A;  2FYD A;  5B1F A;  2YBI A;  2BQC A;  4ET9 A;  1GAY A;  1LMC A;  2EIZ C;  4I8S A;  4OWA A;  1REZ A;  4WM5 A;  1JIT A;  3A91 A;  1LHK A;  3WUA A;  1WGC A;  5FST A;  5IHG A;  1AM7 A;  4ANR A;  4D9Z A;  1W08 A;  4C5F A;  1GBO A;  3A94 A;  1REM A;  4B49 A;  1FLQ A;  4NIJ A;  4DYG A;  4Z41 A;  4WO6 A;  1IWV A;  1GBY A;  1OUI A;  2I26 L;  1FN5 A;  4ETE A;  4WM2 A;  1LJE A;  1CJ6 A;  3AJN A;  4WG1 A;  2LYM A;  4WLT A;  5T3F A;  1XSF A;  1ULK A;  2X0A A;  3WW6 A;  2PC2 A;  4ZIX A;  3IWR A;  1QSW A;  3SP3 A;  5LVJ A;  1WTN A;  4H8Z A;  1BHZ A;  1O23 A;  1VDS A;  4OWE A;  1XGP C;  4YOP A;  1INU A;  1LSA A;  2BQO A;  1IP3 A;  5DM9 A;  4WP4 A;  2HU3 A;  4B4E A;  5F81 A;  1IOT A;  1CNS A;  4H9F A;  2I25 L;  1FLY A;  1LSG A;  5I4Y A;  1Q9B A;  5HNC A;  5JEN B;  1H87 A;  1ZMY L;  1LSP A;  2DKV A;  2C8P A;  2HED A;  2BQM A;  4GCD A;  3J4G A;  4C3W A;  5L9J A;  5KXY A;  1GF4 A;  1IWX A;  1QSA A;  5LVG A;  1FLW A;  2BQI A;  2IHL A;  4DD0 A;  1IR8 A;  4LYT A;  1VDT A;  4G4B A;  3W6B A;  3RW8 A;  1GB0 A;  3BKV A;  3WUM A;  1AT6 A;  5I5Q A;  1E8L A;  4DD2 A;  1GFK A;  1D0M A;  2ZIL A;  5AMY A;  5C6L A;  1XGR C;  3AZ7 A;  1D6P A;  1IR9 A;  1ZVY B;  4H93 A;  1JWR A;  3ZVQ A;  1YL1 X;  4LFX A;  5KXX A;  1DQJ C;  1C45 A;  4GN4 A;  2HEA A;  1NKH A;  4N8Z A;  2Z2E A;  5F16 A;  1I20 A;  3MGW A;  1CJ7 A;  1BB5 A;  5FCP A;  3P64 A;  2X3T A;  3A6C Y;  5A3E A;  1CKC A;  1LSE A;  1B7M A;  1LYY A;  3TXE A;  2C8O A;  3WXT A;  3WVX A;  1G7J C;  207L A;  5APD A;  5KXW A;  4B1A A;  1IY3 A;  134L A;  3WUL A;  1D6Q A;  1C46 A;  4IAS A;  5KJ9 A;  1IP7 A;  4XYY A;  1JKA A;  1LYO A;  5C6I A;  3W6D A;  1JIY A;  4YM8 A;  4QGZ A;  194L A;  1D0K A;  5HNL A;  1GBX A;  5KXN A;  1J1O Y;  4XJH A;  5KXS A;  4W96 A;  4GCC A;  1HEN A;  4NG1 A;  3GXK A;  3TXG A;  3WXU A;  1HSX A;  3KAM A;  1F6S A;  5HQ1 A;  4N0J A;  5II3 A;  3EXD A;  3TXF A;  4YEN A;  1OUA A;  4AXT A;  3T6U A;  1QUS A;  4TWS A;  3P66 A;  3B0O A;  1ZVH L;  1GFH A;  2MEA A;  4FDY A;  4H91 A;  3EBA B;  4LYO A;  3WH1 A;  6LYZ A;  3AGG G;  5F14 A;  1AT5 A;  1GF3 A;  1ULN A;  3T36 A;  4AML A;  1WGT A;  1IWW A;  3A6B Y;  1QIO A;  4GCE A;  4H9B A;  4PJ2 C;  1GF5 A;  4OOT A;  6LYT A;  4ETB A;  5E4P A;  4KL7 A;  1KXW A;  5LYZ A;  4G4C A;  4O34 A;  1NQI A;  1KIR C;  1LZN A;  1IC5 Y;  1IP5 A;  2Z12 A;  4NGK A;  4TSB A;  4UWV A;  2HU1 A;  2Z19 A;  4WL7 A;  3WPL A;  2A7D A;  7WGA A;  1LKR A;  1GFT A;  1NBZ C;  4P2E A;  1LZA A;  2BQF A;  3M3U A;  4H94 A;  1TCY A;  1BWI A;  1LZ5 A;  4BAF A;  1IOC A;  1HFZ A;  1G7L C;  1LZ8 A;  1P9G A;  2BLY A;  1GPQ C;  2G4Q A;  1HEV A;  4AGA A;  4DT3 A;  2BQD A;  2CWG A;  4RLN A;  4HTQ A;  1I1Z A;  1LZT A;  3TXK A;  4GCB A;  4N9R A;  1B9O A;  2LZT A;  3CT5 A;  5APE A;  5ILC A;  1EQ5 A;  1LYZ A;  4CHX A;  4RW2 A;  1IO5 A;  3K3T A;  4ETA A;  1CKD A;  4LFP A;  1GFR A;  1JTP L;  1WQR A;  2ZQ3 A;  2ZYC A;  3AYQ A;  1B5Z A;  1IEE A;  2XBS A;  1EL1 A;  1GF6 A;  2AUB A;  2MED A;  4E3U A;  1B0D A;  2MEG A;  4RDS A;  1JTT L;  1HEL A;  4NWH A;  1AZF A;  1BB7 A;  3D9A C;  1JKB A;  1K7V A;  1HEP A; 
#chains in the Genus database with same CATH topology
 3SB7 A;  4E1P A;  1XGT C;  1K28 A;  113L A;  1K7U A;  149L A;  4H8X A;  1B5U A;  3PDN A;  2NWD X;  1EQ4 A;  3N9A A;  4ML7 A;  1L57 A;  1DYA A;  2X52 A;  1P64 A;  242L A;  2XJW A;  1OVK A;  1T6H A;  1L53 A;  1TLA A;  5CCM A;  3FI7 A;  4GLV A;  1YTP A;  2HTX A;  3C81 A;  4N1E I;  4W51 A;  1L09 A;  1C6I A;  1L86 A;  1L39 A;  1UHA A;  1L92 A;  1GBW A;  1QTE A;  1LSN A;  3BKH A;  4XJG A;  2LUY A;  4W94 A;  3UOE A;  1CUQ A;  1LJH A;  143L A;  4N5R A;  1DYC A;  1L94 A;  1L14 A;  4NEB A;  4XJI A;  3WYH A;  1QSQ A;  3N9C A;  1CX7 A;  3NY9 A;  4RLM A;  1CV3 A;  4WL6 A;  3ATN A;  1QT4 A;  4XJB A;  2B8T A;  4LT1 A;  3LZT A;  1G0G A;  4NFV A;  3GUJ A;  4ARP A;  5I54 A;  107L A;  3GUK A;  1FKV A;  2ODD A;  225L A;  1L73 A;  3LYO A;  5D5C A;  1LTM A;  2YBN A;  1B5W A;  4H9I A;  1V1I A;  2NTH A;  3C7Z A;  151L A;  2BPU A;  1HDL A;  1B7Q A;  3TJQ A;  2J9R A;  2OTY X;  5CCL A;  1BVK C;  111L A;  1LSF A;  1BB6 A;  1GE3 A;  3QAH A;  5KXR A;  1P2R A;  3DMZ A;  4ETC A;  4WMG A;  3GUL A;  3E2I A;  1LZD A;  2DQJ Y;  177L A;  1L98 A;  3W6E A;  2Z38 A;  5DL9 A;  5KKJ A;  5I53 A;  2RH1 A;  1L85 A;  1V7S A;  3B0K A;  1H6M A;  3HUQ A;  1Z2I A;  176L A;  199L A;  3V2W A;  1GXV 2;  1VDD A;  208L A;  1F0W A;  4MR1 A;  2BAA A;  4OW1 A;  5LAF A;  4DWX A;  4NWE A;  210L A;  2CGI A;  2DBT A;  3D00 A;  1KNI A;  1GWD A;  1L01 A;  110L A;  1C69 A;  2ZQ4 A;  3A90 A;  3EO5 A;  2KMO A;  2RBN A;  1TDY A;  5LVH A;  4NHQ A;  5HMV A;  1JSE A;  1CE3 A;  135L A;  1KIP C;  4YF2 A;  3QE8 A;  3SEK C;  192L A;  3TOB A;  4YEO A;  4Z46 A;  1P3N A;  1TUR A;  2BQN A;  1UIA A;  5KKI A;  3AW6 A;  1XGQ C;  1L18 A;  1KMA A;  1QT6 A;  1IWZ A;  4I7M A;  1YAN A;  1A2Y C;  3CSZ A;  4TUN A;  4HJV A;  3A3Q A;  1L19 A;  4LDL A;  2RB0 X;  3WPJ A;  1QT7 A;  5LIO A;  1TBQ R;  4EJ4 A;  5E3R A;  3TMU A;  4M6D A;  1C6C A;  2HUL A;  3HTD A;  1FKQ A;  3N9E A;  4OWB A;  2ANV A;  1MJA A;  1QT8 A;  4YXC A;  3CDV A;  4XAD A;  1XEI A;  1XJU A;  1P9Z A;  4CGE A;  1UIG A;  1V1H A;  1LW9 A;  132L A;  5FUY A;  5M1Y A;  5LVI A;  170L A;  1JJ0 A;  3CB7 A;  1LJF A;  4W59 A;  1RCM A;  4KT3 A;  3A3R X;  1CGI I;  1CV4 A;  4DKL A;  1KW7 A;  1LSZ A;  1CUP A;  2ELI A;  2N1A B;  1EPY A;  1LI2 A;  1GE0 A;  1LMQ A;  1FAQ A;  4CFO A;  1XBT A;  125L A;  1N4F A;  1C6L A;  1YRO A;  237L A;  2GV0 A;  1B2K A;  256L A;  3ATO A;  1C6K A;  1LCN A;  3DN0 A;  2YQP A;  1L80 A;  1L74 A;  4NGV A;  1L55 A;  1UBZ A;  3C8S A;  4WOA A;  1HEQ A;  2SGE I;  1NHE A;  1C6A A;  1YIL A;  1KS3 A;  112L A;  1JUG A;  2DQD Y;  3J6K A;  3LYM A;  2B74 A;  3LHM A;  1FDL Y;  1TEW A;  200L A;  3CT0 A;  3G3B B;  4HV1 A;  1PZY A;  4YEM A;  1PTQ A;  1B7O A;  2OE7 X;  159L A;  137L A;  1TBR R;  1SGP I;  3OVO A;  1GFV A;  1D3J A;  1LMA A;  3GUM A;  1P5C A;  1YL0 X;  3TXB A;  1C65 A;  1TBY A;  1BB3 A;  5LA5 A;  5LIN A;  1C6B A;  1LR8 A;  2G4P A;  1QTK A;  4UWU A;  4UXJ A;  3HBD A;  4HP0 A;  2OEA X;  5LYT A;  1WQO A;  4EKR A;  1G7I C;  1GF0 A;  2YSS C;  5APC A;  2WAR A;  1L06 A;  4LT0 A;  2F2Q A;  3ULR A;  1B7S A;  1HEW A;  3ODU A;  4ETD A;  1L67 A;  1QUT A;  3AZ6 A;  2RBO A;  1IWY A;  1LYI A;  2W1Y A;  146L A;  155L A;  1C68 A;  2NU4 I;  1XEP A;  1ALC A;  1PS5 A;  4NSH A;  8LYZ A;  4HJY A;  4UWN A;  3R5C A;  1LYS A;  1S20 A;  1LSC A;  1QT5 A;  1N13 A;  3QTL D;  1L31 A;  1L75 A;  3HU8 A;  1LMC A;  3SB5 A;  2GVI A;  4OWA A;  2B75 A;  3A91 A;  1WGC A;  1AM7 A;  3HDF A;  3C8R A;  2OU9 A;  4B49 A;  4Z41 A;  1GBY A;  1OUI A;  3CXL A;  1CV5 A;  3SB6 A;  2PC2 A;  1P37 A;  2OE9 X;  1BHZ A;  171L A;  1L82 A;  1L65 A;  2BQO A;  4WP4 A;  2HU3 A;  1IOT A;  1CNS A;  1L30 A;  2I25 L;  1L70 A;  1LSG A;  5I4Y A;  214L A;  1H87 A;  1L21 A;  1LSP A;  1L37 A;  5L9J A;  5KXY A;  4DD0 A;  1GB0 A;  3WUM A;  2O79 A;  3C7Y A;  1E8L A;  4DD2 A;  1GFK A;  1D0M A;  4H93 A;  4LFX A;  2OD1 A;  1DQJ C;  2Z2E A;  5F16 A;  1I20 A;  2RBS A;  3SB8 A;  1BB5 A;  5FCP A;  142L A;  3A6C Y;  5A3E A;  1B7M A;  1LYY A;  1L22 A;  4ARQ A;  3FSY A;  1G7J C;  1BMO A;  207L A;  4B1A A;  4ARM B;  1C46 A;  4HGU A;  1IP7 A;  1SSW A;  1JIY A;  1L61 A;  1J1O Y;  5KXS A;  4DNC A;  1HEN A;  3WXU A;  3KAM A;  1F6S A;  5HQ1 A;  1L38 A;  3EXD A;  2N52 A;  1OUA A;  1ZVH L;  4H91 A;  1L89 A;  4LYO A;  3WH1 A;  2F47 A;  1GF3 A;  1R0R I;  3A6B Y;  4PJ2 C;  2NU0 I;  4OOT A;  1SGQ I;  238L A;  167L A;  2V1C A;  1L62 A;  4G4C A;  1L17 A;  2N17 A;  1IP5 A;  2Z12 A;  2Z19 A;  245L A;  1L49 A;  2A7D A;  3CDR A;  1BWI A;  1LZ8 A;  1P9G A;  2G4Q A;  1HEV A;  4DT3 A;  1I1Z A;  1MJB A;  1OWZ A;  3TXK A;  1B9O A;  5APE A;  2F3C I;  1EQ5 A;  2B0U C;  1IO5 A;  4ETA A;  2V53 A;  1JTP L;  1P56 A;  1CGJ I;  3AYQ A;  2XBS A;  1BUS A;  1EL1 A;  1QUH A;  4E3U A;  1HEL A;  1L88 A;  3D9A C;  1IP3 A;  3SBB C;  1LHM A;  1LZ4 A;  220L A;  3ZVQ B;  1GFU A;  1B5Y A;  140L A;  1P2L A;  1UVG A;  4GCF A;  3W6A A;  1GE2 A;  1M8B A;  4HTK A;  109L A;  2YBH A;  2D4J A;  1JIS A;  2H5Z A;  4LDE A;  114L A;  1GFG A;  5I14 A;  1GFE A;  1LYH A;  2BQG A;  1QS9 A;  1VAU A;  211L A;  2QQD A;  2FYC A;  1XGU C;  3C80 A;  244L A;  3AZ4 A;  224L A;  3M18 B;  1CV6 A;  2RSC A;  257L A;  4NSG A;  2V1C C;  3DN8 A;  3P68 A;  5FUX A;  3A92 A;  3D4S A;  102L A;  3B0I A;  1CU3 A;  4DD3 A;  1HNL A;  2ZYP A;  1PCE A;  4OVO A;  1LMP A;  2LZ2 A;  4EKQ A;  2BQJ A;  1IP6 A;  2ZWB A;  3HH6 A;  1IOS A;  5J8F A;  1UA6 Y;  1YIK A;  2NU2 I;  133L A;  1GAZ A;  1LHH A;  2Z18 A;  1GBS A;  4FJR A;  191L A;  4NHI A;  1L44 A;  1YKY X;  1L56 A;  2Q9D A;  1WTM A;  3OXL A;  1JSF A;  1OVH A;  2CJS C;  3CT1 A;  173L A;  2D4K A;  3QNG A;  4H8Y A;  2XQO A;  1FY7 A;  1PQM A;  1J1P Y;  1VDP A;  1GF8 A;  3WUN A;  1ZWN A;  4L41 A;  5F9X A;  185L A;  3FE0 A;  215L A;  4EPI A;  3W3E A;  1DS3 I;  4LYZ A;  2IGC A;  4WLD A;  3C83 A;  1KXX A;  1H0Z A;  2OE4 X;  4ET8 A;  1YAO A;  2ERW A;  5K7O A;  3HTF A;  2LYZ A;  1AKI A;  4H1P A;  1C6H A;  2DQA A;  4OO9 A;  1LZG A;  4H9C A;  2OU8 A;  1BVX A;  3FI5 A;  4BS7 A;  1DXJ A;  2YBL A;  2B73 A;  3WVY A;  2HEC A;  3IJU A;  1IW4 A;  1LZ6 A;  2ZNX Y;  3K2R A;  2Y8P A;  3GUN A;  5J8C A;  3HH3 A;  1SGN I;  3CQL A;  4RW1 A;  4XEN A;  232L A;  5EX0 A;  3TXH A;  4I7J A;  2SGF I;  5HLL A;  2MEC A;  4AQN A;  2UZ3 A;  2DQF C;  1BGI A;  2GKR I;  5L3H A;  1C43 A;  1WKX A;  1T8A A;  5LYM A;  3HBH A;  2HEF A;  1IIZ A;  174L A;  1WVU A;  1OQM A;  168L A;  4NGJ A;  1UC0 A;  1BWH A;  1GE1 A;  4BAD A;  2CWF A;  5JHW C;  1DYD A;  1VED A;  2XBR A;  5LAG A;  1PJU A;  2RB1 X;  1LWK A;  4IAT A;  2Z37 A;  2DQI Y;  1NDM C;  2B6Z A;  3DNA A;  213L A;  2Q9E A;  1GB6 A;  4DD1 A;  2RAZ X;  3WU8 A;  3ZEK A;  1LYE A;  2B5Z A;  164L A;  2NTG A;  1CJ9 A;  1D3N A;  4PHI A;  1OVO A;  3TOA A;  1L24 A;  3C8Q A;  4KXI A;  1G1V A;  1L07 A;  4U3X B;  1L76 A;  4H9H A;  5KXT A;  241L A;  1LJG A;  1LHJ A;  1JKC A;  4XN6 A;  3GXR A;  4GN5 C;  154L A;  1JQU A;  1W6Z A;  1VDQ A;  2WVJ A;  4EOF A;  1LI6 A;  3AB6 A;  1CTW A;  2W1M A;  2JZM A;  3R5D A;  1HEO A;  1LJN A;  1D0L A;  1R79 A;  4B0D A;  5KXZ A;  2F4G A;  3R5A A;  119L A;  3IJV A;  4LYC A;  1XA6 A;  2JYY A;  1LJK A;  4ARL A;  233L A;  3KY9 A;  1L02 A;  1C61 A;  229L A;  1LZS A;  2N5Z A;  115L A;  1YAQ A;  1GFA A;  1L66 A;  1GD6 A;  1L08 A;  4A24 A;  1WQN A;  2LZM A;  2O7A A;  1GB8 A;  1QTB A;  129L A;  4NSJ A;  5L3I A;  1IY6 A;  4BAP A;  3TXD A;  3RUN A;  2B72 A;  3OL0 A;  1GBZ A;  1L42 A;  3AW7 A;  1D9W A;  3DMX A;  1IWU A;  5LZM A;  9LYZ A;  144L A;  2MEH A;  4OWC A;  4I0C A;  141L A;  2M5X A;  4B4J A;  1DYG A;  2FBB A;  259L A;  1YKX X;  4NGZ A;  5E9R A;  186L A;  3C82 A;  1L64 A;  5LXW A;  4S0W A;  3CDO A;  3UEY A;  2HUB A;  212L A;  1CJ8 A;  1L29 A;  2CDS A;  4I7Q A;  2B6X A;  2LB7 A;  1GDW A;  5I4W A;  1L13 A;  1T8G A;  1DZB X;  3AGH A;  3WPK A;  4GRV A;  1HEM A;  1SX2 A;  1ZUR A;  2A4T A;  2FYD A;  2RC4 A;  1L10 A;  5B1F A;  2P6A C;  1GAY A;  1L43 A;  2EIZ C;  4WM5 A;  1LHK A;  3WUA A;  5FST A;  1W08 A;  4C5F A;  184L A;  1L04 A;  1REM A;  2KMR A;  1IWV A;  2ORV A;  2Y0M A;  2I26 L;  4WM2 A;  1ULK A;  1X74 A;  4WLT A;  1L99 A;  1OVJ A;  1L32 A;  4ZIX A;  1QSW A;  1O23 A;  1VDS A;  4YOP A;  1INU A;  1KY1 A;  5DM9 A;  1LR7 A;  1Q9B A;  1LYJ A;  4DQ7 A;  3OE8 A;  5HNC A;  5JEN B;  1ZMY L;  2HED A;  2BQM A;  3J4G A;  5LVG A;  2IHL A;  2DIP A;  1MJ9 A;  4G4B A;  1AT6 A;  5C6L A;  3AZ7 A;  1LR9 A;  1D6P A;  1IR9 A;  3HTB A;  2HEA A;  1NKH A;  4N8Z A;  1L63 A;  1FAR A;  1CJ7 A;  1PQO A;  3HH4 A;  3P64 A;  2X3T A;  1CKC A;  1G0M A;  3TXE A;  2C8O A;  1U5K A;  145L A;  3WXT A;  3PDS A;  5APD A;  2L8E A;  5KXW A;  1P46 A;  1IY3 A;  134L A;  4XYY A;  4YM8 A;  1JKA A;  138L A;  1PTR A;  194L A;  3TO9 A;  5HNL A;  1C66 A;  1GBX A;  4W96 A;  1C6M A;  3FSX A;  4NG1 A;  3GXK A;  1NUB A;  1QTC A;  5II3 A;  2RAY X;  4YEN A;  1L90 A;  2NU1 I;  1OV5 A;  3T6U A;  1P7S A;  1GFH A;  163L A;  3EBA B;  3HU9 A;  4AML A;  4K5Y A;  2L7X A;  3SB9 A;  118L A;  1D3F A;  4UWV A;  161L A;  4H94 A;  1TCY A;  1HFZ A;  1CVK A;  1GPQ C;  128L A;  1L84 A;  4RLN A;  1L28 A;  4HTQ A;  1LZT A;  4GCB A;  2LZT A;  3CT5 A;  2ZQ3 A;  2DB6 A;  1IEE A;  1GF6 A;  3OE0 A;  2MEG A;  1CT0 I;  1JTT L;  1C64 A;  1CHO I;  2E5R A;  1SLY A;  3LZ2 A;  5KXM A;  5FUW A;  2BQH A;  1ULM A;  3FA0 A;  3DN3 A;  1L11 A;  1UCO A;  1F10 A;  1G06 A;  2EKS C;  2SGP I;  222L A;  5DN5 A;  4ARQ B;  4B4I A;  3RT5 X;  197L A;  4ZEE A;  4PJZ A;  5FDJ A;  2DQH Y;  2EPE A;  1DI5 A;  1REY A;  3G3V A;  1J1X Y;  1UUC A;  1LKS A;  2LYO A;  1NF5 A;  4N1C C;  3R5B A;  4TX7 A;  5F9U A;  5I4X A;  3HT7 A;  2JW6 A;  5B1G A;  1CU6 A;  1RFP A;  4I7O A;  1SWZ A;  247L A;  3QY4 A;  1QTZ A;  3TMX A;  1XFP L;  3P4Z A;  1DPX A;  3SBA A;  4NGW A;  1L33 A;  1LZR A;  2GIV A;  1HFY A;  1RI8 B;  2YVB A;  4NG8 A;  166L A;  5KXP A;  2RBR A;  2PQ8 A;  2HEB A;  1L52 A;  5DAE A;  3A96 A;  4DQJ A;  1CSO I;  3RNX A;  1IC4 Y;  1ZYT A;  1BB4 A;  1K7T A;  1LPI A;  1G0L A;  1OUH A;  1GEV A;  1JJ3 A;  3DN1 A;  1HSW A;  4R6C A;  5LA8 A;  162L A;  1FLU A;  1P6Y A;  226L A;  1G7H C;  1DYB A;  1YAP A;  4QEQ A;  4DAJ A;  156L A;  3TXJ A;  4MPI A;  127L A;  4GN3 A;  2QPO A;  1C67 A;  1L45 A;  1IP4 A;  4MCK A;  3CSR A;  3A67 Y;  4E97 A;  5D5F A;  2O4W A;  1NXU A;  1TUS A;  2H9K A;  3HT8 A;  1OUB A;  2DQG Y;  4PRU A;  2SGQ I;  3L64 A;  3OXF A;  1LSB A;  1SGD I;  104L A;  1KW5 A;  3GUP A;  240L A;  3UGL A;  1CU5 A;  1CT4 I;  1HER A;  4WLY A;  1B7P A;  1LAA A;  231L A;  3HWL A;  1LJJ A;  3FAD A;  1QTD A;  1OUJ A;  4J1B A;  5J7C A;  4NGO A;  5HMJ A;  1DKK A;  2H9J A;  5ILF A;  1LHL A;  1LOZ A;  1C6F A;  4DQ5 A;  3UFF A;  1EQE A;  2BQL A;  2YDG A;  1UAC Y;  108L A;  178L A;  1MT1 A;  2HUK A;  1C6T A;  1Z55 A;  3HT6 A;  1L05 A;  4LDO A;  1FBI X;  2Q0M X;  1T8F A;  4EKP A;  3L2X A;  1WTJ A;  1LSY A;  1UIH A;  1QTV A;  2CJL A;  1Z7K B;  1GF9 A;  251L A;  1SSY A;  1LZC A;  180L A;  2WCY A;  1JKB A;  4QDN A;  3HUA A;  7LZM A;  2HUM A;  1GXX A;  148L E;  1IY4 A;  1LYG A;  1TAY A;  3CDQ A;  2IFF Y;  5KY1 A;  1B7R A;  5KXL A;  4DD9 A;  1WQQ A;  3PBL A;  1GEZ A;  3RZE A;  4FKD A;  1DS2 I;  4LYM A;  2BQA A;  206L A;  3OJP A;  3DMV A;  2D4I A;  7LYZ A;  2CWI A;  1YU6 C;  2NU3 I;  2HEE A;  2XRC A;  4W58 A;  3VW7 A;  205L A;  5E3P A;  3SN6 R;  1L72 A;  4NGI A;  1C6P A;  5EX3 A;  1IOR A;  1VAT A;  2XTH A;  1NMM A;  1JHL A;  1KIQ C;  201L A;  6LZM A;  120L A;  1HFX A;  2A20 A;  1HPT A;  1IC7 Y;  1OV7 A;  1C08 C;  1GF7 A;  2RBQ A;  1Y8F A;  195L A;  1QT3 A;  1DPW A;  3BJI A;  4ZPU A;  2B6W A;  1HHL A;  4HPE A;  2K9H A;  5KXK A;  4XJF A;  4R0F A;  1QDR A;  1LWG A;  2MEF A;  165L A;  1I56 A;  4H90 A;  2YUU A;  1V7T A;  3E59 A;  3VDP A;  4GLA A;  4PRQ A;  1LJ4 A;  4Z3M A;  4W53 A;  1OUF A;  2D91 A;  3WMK A;  4CJ2 A;  4EXM A;  209L A;  249L A;  2BQB A;  2FNF X;  1XEJ A;  4I7T A;  4II8 A;  1QQY A;  1BQL Y;  1DKJ A;  5LVK A;  1JTN A;  2F4A A;  216L A;  1HMK A;  1GDX A;  1T97 A;  4IJ4 A;  2SGD I;  3AZ5 A;  2BLX A;  3WL2 A;  1LGX A;  1OWY A;  1OUE A;  3UGI A;  3DN6 A;  2BQK A;  2I6Z A;  243L A;  2OZU A;  1GE4 A;  1LMN A;  1LHI A;  183L A;  2RB2 X;  2EQL A;  1QTH A;  1IWT A;  1T6V L;  4H9A A;  1GFJ A;  150L A;  4W55 A;  4DC4 A;  1XJT A;  4WM4 A;  4UXH A;  3UON A;  1IP1 A;  3EML A;  2FBD A;  3CDT A;  3NYA A;  4LGK A;  1OP9 B;  1UIE A;  1L35 A;  1QUD A;  1L97 A;  2BQC A;  4ET9 A;  2KMQ A;  1REZ A;  1L51 A;  1JIT A;  4ANR A;  4D9Z A;  1GBO A;  3A94 A;  1FLQ A;  4DYG A;  4WO6 A;  3HH5 A;  2OVO A;  3OE9 A;  1FN5 A;  5T3F A;  2QQ0 A;  1CJ6 A;  3AJN A;  2LYM A;  1QSB A;  2X0A A;  3WW6 A;  1L68 A;  2W0T A;  2QB0 B;  5LVJ A;  1WTN A;  3TO6 A;  126L A;  4H8Z A;  1LSA A;  4H9F A;  1FLY A;  4I7K A;  2DKV A;  1PQJ A;  2C8P A;  5FUV A;  1OYU A;  1IWX A;  2BQI A;  1IR8 A;  4LYT A;  3W6B A;  5I5Q A;  198L A;  4EKS A;  5AMY A;  1ZVY B;  1JWR A;  1YL1 X;  1QS5 A;  1C45 A;  4GN4 A;  3SGB I;  3MGW A;  5E3Q A;  1TOT A;  4DJH A;  1LSE A;  1Y1B A;  221L A;  3OXG A;  1L36 A;  258L A;  1D2Y A;  1D6Q A;  5C6I A;  4QGZ A;  1D0K A;  5KXN A;  1KY0 A;  2B70 A;  4XJH A;  4GCC A;  3TXG A;  1QUG A;  3SGQ I;  4N0J A;  1C6G A;  1RFH A;  2QQE A;  1QUS A;  2MEA A;  6LYZ A;  1L34 A;  122L A;  1CT2 I;  5F14 A;  1AT5 A;  3T36 A;  1WGT A;  1QIO A;  4GCE A;  4H9B A;  235L A;  1L0K A;  5E4P A;  4KL7 A;  4O34 A;  1KIR C;  1IC5 Y;  4NGK A;  4TSB A;  7WGA A;  1LKR A;  1GFT A;  1C63 A;  4P2E A;  1LZA A;  2BQF A;  3M3U A;  1LZ5 A;  4GBR B;  4BAF A;  1IOC A;  189L A;  188L A;  2Z6B A;  4AGA A;  2BQD A;  2CWG A;  2ENN A;  5ILC A;  1L0J A;  4RW2 A;  1LYD A;  1CKD A;  4LFP A;  2ZYC A;  1FYB A;  1LPY A;  228L A;  1PPF I;  2AUB A;  2MED A;  1B0D A;  1JTM A;  4RDS A;  1AZF A;  1BB7 A;  1K7V A;  4L9M A;  4ZFP A;  3LN2 A;  1L69 A;  4XJD A;  5FEK A;  261L A;  4HJZ A;  3G3A B;  1HML A;  1MLC E;  4G49 A;  4J0L A;  5KXO A;  2MEI A;  4WM1 A;  4NGY A;  4GI3 C;  5B05 A;  1A4V A;  1UUZ C;  1JPO A;  1P36 A;  3G3W A;  1TBN A;  1HF4 A;  1HC0 A;  1PQI A;  1L50 A;  5C6J A;  1SWY A;  5IDD A;  1IX0 A;  3HBE X;  4Z98 A;  1BWJ A;  1L25 A;  1LSD A;  3DKE X;  4DDA A;  4I7N A;  1L59 A;  1SGR I;  2F2N A;  1CKH A;  2RBP A;  2J87 A;  4LT2 A;  1UVF A;  4PPO A;  2BQE A;  1L00 A;  1YAM A;  147L A;  1C10 A;  2BUS A;  3F6Z A;  4ARJ A;  3TMW A;  1IP2 A;  262L A;  4W57 A;  3GUO A;  1IOQ A;  3F9L A;  3P65 A;  1D3M A;  2YBM A;  227L A;  3QAK A;  2A7F A;  5FHW A;  4NHT A;  1WQM A;  5B59 A;  1ZV5 L;  4KPM A;  1L79 A;  234L A;  4OWH A;  3B72 A;  4LZM A;  1QUO A;  3UEJ A;  1D9U A;  1LZ9 A;  3AGI A;  4I7S A;  1L47 A;  2B6Y A;  181L A;  2ZIK A;  3E3D A;  250L A;  5IEL A;  1OUD A;  130L A;  2ORW A;  1LMO A;  175L A;  1C6N A;  1LZY A;  2Z39 A;  3OK0 A;  2MEB A;  169L A;  2LCB A;  1CX6 A;  4NHP A;  1UIB A;  1MEL L;  1LJI A;  1CU2 A;  3VE5 A;  5APF A;  3VDU A;  5HI7 A;  1B5X A;  4H9E A;  3B4V C;  1M8C A;  3C7W A;  3LYT A;  1DYF A;  4M4O A;  1CU0 A;  5A3Z A;  5DN4 A;  2QQC A;  3A93 A;  1L96 A;  3TO7 A;  1DYE A;  1IVM A;  2JXD A;  3WU7 A;  196L A;  2LC9 A;  2ARP F;  4IAP A;  1LI3 A;  4I7R A;  2N71 A;  4DDB A;  1OMT A;  1LZ1 A;  1KBE A;  4LZT A;  1L26 A;  2VB1 A;  1C6J A;  1UIC A;  1T3P A;  230L A;  4LT3 A;  1QDT A;  4H92 A;  1GB7 A;  3A95 A;  2ROW A;  2WGC A;  1G0K A;  5FEL A;  1UID A;  4A7D A;  3HDE A;  1WQP A;  219L A;  2F32 A;  131L A;  1NDG C;  4W52 A;  1SGE I;  193L A;  4TTD A;  139L A;  1G7M C;  4J7V A;  3HT9 A;  3VWO A;  1TIH A;  153L A;  1YKZ X;  4EMN A;  1CKF A;  2ZNW Y;  1GB5 A;  2OU0 X;  1GB3 A;  1UIF A;  1REX A;  3CSQ A;  5B06 A;  3WU9 A;  3RU0 A;  3HFM Y;  3LZM A;  2Z2F A;  4NHS A;  4HV2 A;  1TBO A;  3LYZ A;  2ENZ A;  4YXA C;  260L A;  3RU5 A;  1LMT A;  3NY8 A;  1LLH A;  1NBY C;  2RIJ A;  1NHB A;  4J1A A;  4DDC A;  1B5V A;  4SGB I;  2VRW B;  3W6C A;  1G1W A;  2LHM A;  4MST A;  1DI4 A;  2D6B A;  1RJC B;  1G0J A;  2ZIJ A;  1JEF A;  1XX6 A;  1LZE A;  1GB2 A;  2ANX A;  1Y1C A;  4LYB A;  3WW5 A;  1L16 A;  254L A;  1L40 A;  5B07 A;  1CV0 A;  1C7P A;  1JJ1 A;  3JR6 A;  1F6R A;  1C60 A;  3TXI A;  1SQ2 L;  4I7L A;  3A34 A;  4TSC A;  1D2W A;  1IY5 A;  1W3S A;  2MEE A;  4NGL A;  2YBJ A;  2W1L A;  1LSM A;  4G9S A;  1G07 A;  3EMS A;  4G4H A;  1HJA I;  1L23 A;  4OOO A;  4YX7 C;  3UGD A;  3B6L A;  4WM6 A;  1TGS I;  218L A;  4DD7 A;  190L A;  1VFB C;  3TMV A;  5HQ8 A;  1DI3 A;  2DQE Y;  1RE2 A;  1GB9 A;  1P2C C;  152L A;  2W1X A;  1B7L A;  1G0Q A;  1LJ3 A;  1OUG A;  1GHL A;  4PGJ B;  2KCX A;  2UVO A;  248L A;  4WG7 A;  1IR7 A;  1XEK A;  3RZ4 A;  3MEK A;  2OTZ X;  3GUI A;  2LEO A;  1L15 A;  1NWG A;  4NY5 A;  1L87 A;  4CFP A;  1OUC A;  4HTN A;  1KXY A;  4QY9 A;  3QWP A;  4EPF A;  4HSF A;  4WM3 A;  4X3B A;  2F30 A;  158L A;  4HPI A;  1L93 A;  9WGA A;  2GKT I;  1CKG A;  252L A;  2DQC Y;  4WO9 A;  1PQD A;  1YQV Y;  2G4N A;  5EBH A;  1I6S A;  160L A;  1LZB A;  4ARM A;  3D3D A;  1JKD A;  1OMU A;  1C6D A;  3W6F A;  3FC3 A;  1JTO L;  2CWH A;  2KMP A;  4WLX A;  1B7N A;  4NSI A;  1AN1 I;  3A8Z A;  5DLA A;  1L60 A;  3HTG A;  1X4S A;  236L A;  2YBI A;  1SX7 A;  123L A;  4I8S A;  4UXI A;  3V2Y A;  5IHG A;  2B7X A;  1G0P A;  253L A;  4NIJ A;  1L41 A;  1L81 A;  172L A;  103L A;  1L12 A;  2L78 A;  4ETE A;  1LJE A;  4WG1 A;  4PK0 A;  1XSF A;  3IWR A;  1LGU A;  1B6I A;  3SP3 A;  1L71 A;  4OWE A;  1XGP C;  4E1R A;  4B4E A;  5F81 A;  4GCD A;  4C3W A;  1C62 A;  4B6D A;  1GF4 A;  1QSA A;  1FLW A;  4I7P A;  1VDT A;  3RW8 A;  3BKV A;  2E73 A;  223L A;  3G3X A;  2ZIL A;  1XGR C;  3ZVQ A;  1L20 A;  1LGW A;  3F8V A;  5KXX A;  1L83 A;  217L A;  3DN4 A;  2GKV A;  3GOX A;  187L A;  1KBF A;  1WTH A;  1SGY I;  3WVX A;  1LYF A;  2OU2 A;  3WUL A;  3DN2 A;  4IAS A;  2B6T A;  157L A;  5KJ9 A;  3HH2 C;  1LYO A;  3W6D A;  2JA1 A;  1L46 A;  1HSX A;  1L91 A;  4W54 A;  3TXF A;  1C6E A;  1L54 A;  4AXT A;  1L77 A;  239L A;  4TWS A;  3P66 A;  3B0O A;  4FDY A;  3HUK A;  246L A;  3AGG G;  1W4R A;  2QAR C;  1ULN A;  1L03 A;  1L95 A;  1IWW A;  1L58 A;  1GF5 A;  6LYT A;  4ETB A;  1KXW A;  5LYZ A;  1NQI A;  1LZN A;  4WL7 A;  1L27 A;  2HU1 A;  3WPL A;  1CV1 A;  1NBZ C;  2CUU A;  1G7L C;  255L A;  2BLY A;  1L48 A;  1OYV I;  4N9R A;  4CHX A;  1LYZ A;  4W56 A;  1C6Q A;  3K3T A;  182L A;  1GFR A;  1WQR A;  1B5Z A;  1PQK A;  4JCV E;  4NWH A;  3OE6 A;  1WVV A;  1HEP A; 
#chains in the Genus database with same CATH homology
 3SB7 A;  1XGT C;  1K28 A;  113L A;  1K7U A;  149L A;  4H8X A;  1B5U A;  2NWD X;  1EQ4 A;  3N9A A;  4ML7 A;  1L57 A;  1DYA A;  2X52 A;  1P64 A;  242L A;  2XJW A;  1OVK A;  1T6H A;  1L53 A;  1TLA A;  3FI7 A;  4GLV A;  2HTX A;  3C81 A;  4N1E I;  4W51 A;  1L09 A;  1C6I A;  1L86 A;  1L39 A;  1UHA A;  1L92 A;  1GBW A;  1QTE A;  1LSN A;  3BKH A;  4XJG A;  4W94 A;  1CUQ A;  1LJH A;  143L A;  4N5R A;  1DYC A;  1L94 A;  1L14 A;  4NEB A;  4XJI A;  3WYH A;  1QSQ A;  3N9C A;  1CX7 A;  3NY9 A;  4RLM A;  1CV3 A;  4WL6 A;  3ATN A;  1QT4 A;  4XJB A;  4LT1 A;  3LZT A;  1G0G A;  4NFV A;  3GUJ A;  4ARP A;  5I54 A;  107L A;  3GUK A;  1FKV A;  225L A;  1L73 A;  3LYO A;  5D5C A;  1LTM A;  2YBN A;  1B5W A;  4H9I A;  2NTH A;  3C7Z A;  151L A;  2BPU A;  1B7Q A;  2OTY X;  1BVK C;  111L A;  1LSF A;  1BB6 A;  1GE3 A;  5KXR A;  1P2R A;  3DMZ A;  4ETC A;  4WMG A;  3GUL A;  1LZD A;  2DQJ Y;  177L A;  1L98 A;  3W6E A;  2Z38 A;  5DL9 A;  5KKJ A;  5I53 A;  2RH1 A;  1L85 A;  1V7S A;  3B0K A;  1H6M A;  3HUQ A;  176L A;  199L A;  3V2W A;  1GXV 2;  208L A;  1F0W A;  4MR1 A;  2BAA A;  4OW1 A;  5LAF A;  4DWX A;  4NWE A;  210L A;  2CGI A;  2DBT A;  1KNI A;  1GWD A;  1L01 A;  110L A;  1C69 A;  2ZQ4 A;  3A90 A;  3EO5 A;  2RBN A;  1TDY A;  5LVH A;  4NHQ A;  5HMV A;  1JSE A;  135L A;  1KIP C;  4YF2 A;  3QE8 A;  192L A;  4YEO A;  4Z46 A;  1P3N A;  2BQN A;  1UIA A;  5KKI A;  3AW6 A;  1XGQ C;  1L18 A;  1QT6 A;  1IWZ A;  4I7M A;  1YAN A;  1A2Y C;  3CSZ A;  4TUN A;  4HJV A;  3A3Q A;  1L19 A;  4LDL A;  2RB0 X;  3WPJ A;  1QT7 A;  5LIO A;  4EJ4 A;  3TMU A;  4M6D A;  1C6C A;  2HUL A;  3HTD A;  1FKQ A;  3N9E A;  4OWB A;  2ANV A;  1QT8 A;  4YXC A;  3CDV A;  4XAD A;  1XEI A;  1XJU A;  1P9Z A;  4CGE A;  1UIG A;  1LW9 A;  132L A;  5M1Y A;  5LVI A;  170L A;  1JJ0 A;  3CB7 A;  1LJF A;  4W59 A;  1RCM A;  4KT3 A;  3A3R X;  1CV4 A;  4DKL A;  1KW7 A;  1LSZ A;  1CUP A;  1EPY A;  1LI2 A;  1GE0 A;  1LMQ A;  4CFO A;  125L A;  1N4F A;  1C6L A;  1YRO A;  237L A;  2GV0 A;  1B2K A;  256L A;  3ATO A;  1C6K A;  1LCN A;  3DN0 A;  1L80 A;  1L74 A;  4NGV A;  1L55 A;  1UBZ A;  3C8S A;  4WOA A;  1HEQ A;  1NHE A;  1C6A A;  1YIL A;  1KS3 A;  112L A;  1JUG A;  2DQD Y;  3J6K A;  3LYM A;  2B74 A;  3LHM A;  1FDL Y;  1TEW A;  200L A;  3CT0 A;  3G3B B;  4HV1 A;  1PZY A;  4YEM A;  1B7O A;  2OE7 X;  159L A;  137L A;  1GFV A;  1D3J A;  1LMA A;  3GUM A;  1P5C A;  1YL0 X;  3TXB A;  1C65 A;  1TBY A;  1BB3 A;  5LA5 A;  5LIN A;  1C6B A;  2G4P A;  1QTK A;  4UWU A;  3HBD A;  4HP0 A;  2OEA X;  5LYT A;  1WQO A;  4EKR A;  1G7I C;  1GF0 A;  2YSS C;  5APC A;  2WAR A;  1L06 A;  4LT0 A;  2F2Q A;  3ULR A;  1B7S A;  1HEW A;  3ODU A;  4ETD A;  1L67 A;  1QUT A;  3AZ6 A;  2RBO A;  1IWY A;  1LYI A;  2W1Y A;  146L A;  155L A;  1C68 A;  1XEP A;  1ALC A;  1PS5 A;  4NSH A;  8LYZ A;  4HJY A;  4UWN A;  1LYS A;  1LSC A;  1QT5 A;  1L31 A;  1L75 A;  3HU8 A;  1LMC A;  3SB5 A;  4OWA A;  2B75 A;  3A91 A;  1WGC A;  1AM7 A;  3HDF A;  3C8R A;  2OU9 A;  4B49 A;  4Z41 A;  1GBY A;  1OUI A;  1CV5 A;  3SB6 A;  2PC2 A;  1P37 A;  2OE9 X;  1BHZ A;  171L A;  1L82 A;  1L65 A;  2BQO A;  4WP4 A;  2HU3 A;  1IOT A;  1CNS A;  1L30 A;  2I25 L;  1L70 A;  1LSG A;  5I4Y A;  214L A;  1H87 A;  1L21 A;  1LSP A;  1L37 A;  5L9J A;  5KXY A;  4DD0 A;  1GB0 A;  3WUM A;  2O79 A;  3C7Y A;  1E8L A;  4DD2 A;  1GFK A;  1D0M A;  4H93 A;  4LFX A;  1DQJ C;  2Z2E A;  5F16 A;  1I20 A;  2RBS A;  3SB8 A;  1BB5 A;  5FCP A;  142L A;  3A6C Y;  5A3E A;  1B7M A;  1LYY A;  1L22 A;  4ARQ A;  1G7J C;  207L A;  4B1A A;  4ARM B;  1C46 A;  1IP7 A;  1SSW A;  1JIY A;  1L61 A;  1J1O Y;  5KXS A;  1HEN A;  3WXU A;  3KAM A;  1F6S A;  5HQ1 A;  1L38 A;  3EXD A;  1OUA A;  1ZVH L;  4H91 A;  1L89 A;  4LYO A;  3WH1 A;  2F47 A;  1GF3 A;  3A6B Y;  4PJ2 C;  4OOT A;  238L A;  167L A;  1L62 A;  4G4C A;  1L17 A;  1IP5 A;  2Z12 A;  2Z19 A;  245L A;  1L49 A;  2A7D A;  3CDR A;  1BWI A;  1LZ8 A;  1P9G A;  2G4Q A;  1HEV A;  4DT3 A;  1I1Z A;  1OWZ A;  3TXK A;  1B9O A;  5APE A;  1EQ5 A;  1IO5 A;  4ETA A;  1JTP L;  1P56 A;  3AYQ A;  2XBS A;  1EL1 A;  1QUH A;  4E3U A;  1HEL A;  1L88 A;  3D9A C;  1IP3 A;  3SBB C;  1LHM A;  1LZ4 A;  220L A;  3ZVQ B;  1GFU A;  1B5Y A;  140L A;  1P2L A;  4GCF A;  3W6A A;  1GE2 A;  4HTK A;  109L A;  2YBH A;  2D4J A;  1JIS A;  2H5Z A;  4LDE A;  114L A;  1GFG A;  5I14 A;  1GFE A;  1LYH A;  2BQG A;  1QS9 A;  1VAU A;  211L A;  2FYC A;  1XGU C;  3C80 A;  244L A;  3AZ4 A;  224L A;  3M18 B;  1CV6 A;  2RSC A;  257L A;  4NSG A;  3DN8 A;  3P68 A;  3A92 A;  3D4S A;  102L A;  3B0I A;  1CU3 A;  4DD3 A;  1HNL A;  2ZYP A;  1LMP A;  2LZ2 A;  4EKQ A;  2BQJ A;  1IP6 A;  2ZWB A;  3HH6 A;  1IOS A;  1UA6 Y;  1YIK A;  133L A;  1GAZ A;  1LHH A;  2Z18 A;  1GBS A;  4FJR A;  191L A;  4NHI A;  1L44 A;  1YKY X;  1L56 A;  2Q9D A;  1WTM A;  1JSF A;  1OVH A;  3CT1 A;  173L A;  2D4K A;  3QNG A;  4H8Y A;  2XQO A;  1PQM A;  1J1P Y;  1VDP A;  1GF8 A;  3WUN A;  1ZWN A;  4L41 A;  5F9X A;  185L A;  3FE0 A;  215L A;  4EPI A;  3W3E A;  4LYZ A;  2IGC A;  4WLD A;  3C83 A;  1KXX A;  2OE4 X;  4ET8 A;  1YAO A;  5K7O A;  3HTF A;  2LYZ A;  1AKI A;  4H1P A;  1C6H A;  2DQA A;  4OO9 A;  1LZG A;  4H9C A;  2OU8 A;  1BVX A;  3FI5 A;  4BS7 A;  1DXJ A;  2YBL A;  2B73 A;  3WVY A;  2HEC A;  3IJU A;  1LZ6 A;  2ZNX Y;  3K2R A;  2Y8P A;  3GUN A;  3HH3 A;  3CQL A;  4RW1 A;  4XEN A;  232L A;  3TXH A;  4I7J A;  5HLL A;  2MEC A;  4AQN A;  2DQF C;  1BGI A;  5L3H A;  1C43 A;  1WKX A;  1T8A A;  5LYM A;  3HBH A;  2HEF A;  1IIZ A;  174L A;  1WVU A;  1OQM A;  168L A;  4NGJ A;  1UC0 A;  1BWH A;  1GE1 A;  4BAD A;  1DYD A;  1VED A;  2XBR A;  5LAG A;  2RB1 X;  1LWK A;  4IAT A;  2Z37 A;  2DQI Y;  1NDM C;  2B6Z A;  3DNA A;  213L A;  2Q9E A;  1GB6 A;  4DD1 A;  2RAZ X;  3WU8 A;  3ZEK A;  1LYE A;  2B5Z A;  164L A;  2NTG A;  1CJ9 A;  1D3N A;  4PHI A;  1L24 A;  3C8Q A;  4KXI A;  1G1V A;  1L07 A;  4U3X B;  1L76 A;  4H9H A;  5KXT A;  241L A;  1LJG A;  1LHJ A;  1JKC A;  4XN6 A;  3GXR A;  4GN5 C;  154L A;  1JQU A;  1W6Z A;  1VDQ A;  4EOF A;  1LI6 A;  3AB6 A;  1CTW A;  2W1M A;  1HEO A;  1LJN A;  1D0L A;  4B0D A;  5KXZ A;  2F4G A;  119L A;  3IJV A;  4LYC A;  1LJK A;  4ARL A;  233L A;  1L02 A;  1C61 A;  229L A;  1LZS A;  2N5Z A;  115L A;  1YAQ A;  1GFA A;  1L66 A;  1GD6 A;  1L08 A;  1WQN A;  2LZM A;  2O7A A;  1GB8 A;  1QTB A;  129L A;  4NSJ A;  5L3I A;  4BAP A;  3TXD A;  3RUN A;  2B72 A;  1GBZ A;  1L42 A;  3AW7 A;  1D9W A;  3DMX A;  1IWU A;  5LZM A;  9LYZ A;  144L A;  2MEH A;  4OWC A;  4I0C A;  141L A;  4B4J A;  1DYG A;  2FBB A;  259L A;  1YKX X;  4NGZ A;  5E9R A;  186L A;  3C82 A;  1L64 A;  5LXW A;  4S0W A;  3CDO A;  2HUB A;  212L A;  1CJ8 A;  1L29 A;  2CDS A;  4I7Q A;  2B6X A;  2LB7 A;  1GDW A;  5I4W A;  1L13 A;  1T8G A;  1DZB X;  3AGH A;  3WPK A;  4GRV A;  1HEM A;  1SX2 A;  1ZUR A;  2A4T A;  2FYD A;  1L10 A;  5B1F A;  1GAY A;  1L43 A;  2EIZ C;  4WM5 A;  1LHK A;  3WUA A;  5FST A;  1W08 A;  4C5F A;  184L A;  1L04 A;  1REM A;  1IWV A;  2I26 L;  4WM2 A;  1ULK A;  4WLT A;  1L99 A;  1OVJ A;  1L32 A;  4ZIX A;  1QSW A;  1O23 A;  1VDS A;  4YOP A;  1INU A;  1KY1 A;  5DM9 A;  1Q9B A;  1LYJ A;  4DQ7 A;  3OE8 A;  5HNC A;  5JEN B;  1ZMY L;  2HED A;  2BQM A;  3J4G A;  5LVG A;  2IHL A;  4G4B A;  1AT6 A;  5C6L A;  3AZ7 A;  1D6P A;  1IR9 A;  3HTB A;  2HEA A;  1NKH A;  4N8Z A;  1L63 A;  1CJ7 A;  1PQO A;  3HH4 A;  3P64 A;  2X3T A;  1CKC A;  1G0M A;  3TXE A;  2C8O A;  145L A;  3WXT A;  3PDS A;  5APD A;  5KXW A;  1P46 A;  1IY3 A;  134L A;  4XYY A;  4YM8 A;  1JKA A;  138L A;  194L A;  5HNL A;  1C66 A;  1GBX A;  4W96 A;  1C6M A;  4NG1 A;  3GXK A;  1QTC A;  5II3 A;  2RAY X;  4YEN A;  1L90 A;  1OV5 A;  3T6U A;  1P7S A;  1GFH A;  163L A;  3EBA B;  3HU9 A;  4AML A;  4K5Y A;  3SB9 A;  118L A;  1D3F A;  4UWV A;  161L A;  4H94 A;  1TCY A;  1HFZ A;  1CVK A;  1GPQ C;  128L A;  1L84 A;  4RLN A;  1L28 A;  4HTQ A;  1LZT A;  4GCB A;  2LZT A;  3CT5 A;  2ZQ3 A;  1IEE A;  1GF6 A;  3OE0 A;  2MEG A;  1JTT L;  1C64 A;  1SLY A;  3LZ2 A;  5KXM A;  2BQH A;  1ULM A;  3FA0 A;  3DN3 A;  1L11 A;  1UCO A;  1F10 A;  1G06 A;  2EKS C;  222L A;  5DN5 A;  4ARQ B;  4B4I A;  3RT5 X;  197L A;  4ZEE A;  4PJZ A;  5FDJ A;  2DQH Y;  2EPE A;  1DI5 A;  1REY A;  3G3V A;  1J1X Y;  1LKS A;  2LYO A;  1NF5 A;  4N1C C;  4TX7 A;  5F9U A;  5I4X A;  3HT7 A;  5B1G A;  1CU6 A;  1RFP A;  4I7O A;  1SWZ A;  247L A;  3QY4 A;  1QTZ A;  3TMX A;  1XFP L;  3P4Z A;  1DPX A;  3SBA A;  4NGW A;  1L33 A;  1LZR A;  1HFY A;  1RI8 B;  2YVB A;  4NG8 A;  166L A;  5KXP A;  2RBR A;  2HEB A;  1L52 A;  3A96 A;  4DQJ A;  3RNX A;  1IC4 Y;  1ZYT A;  1BB4 A;  1K7T A;  1LPI A;  1G0L A;  1OUH A;  1GEV A;  1JJ3 A;  3DN1 A;  1HSW A;  4R6C A;  5LA8 A;  162L A;  1FLU A;  1P6Y A;  226L A;  1G7H C;  1DYB A;  1YAP A;  4QEQ A;  4DAJ A;  156L A;  3TXJ A;  4MPI A;  127L A;  4GN3 A;  1C67 A;  1L45 A;  1IP4 A;  4MCK A;  3CSR A;  3A67 Y;  4E97 A;  5D5F A;  2O4W A;  2H9K A;  3HT8 A;  1OUB A;  2DQG Y;  4PRU A;  3L64 A;  1LSB A;  104L A;  1KW5 A;  3GUP A;  240L A;  1CU5 A;  1HER A;  4WLY A;  1B7P A;  1LAA A;  231L A;  3HWL A;  1LJJ A;  3FAD A;  1QTD A;  1OUJ A;  4J1B A;  5J7C A;  4NGO A;  5HMJ A;  1DKK A;  2H9J A;  5ILF A;  1LHL A;  1LOZ A;  1C6F A;  4DQ5 A;  1EQE A;  2BQL A;  2YDG A;  1UAC Y;  108L A;  178L A;  2HUK A;  1C6T A;  1Z55 A;  3HT6 A;  1L05 A;  4LDO A;  1FBI X;  2Q0M X;  1T8F A;  4EKP A;  3L2X A;  1LSY A;  1UIH A;  1QTV A;  2CJL A;  1GF9 A;  251L A;  1SSY A;  1LZC A;  180L A;  1JKB A;  4QDN A;  3HUA A;  7LZM A;  2HUM A;  1GXX A;  148L E;  1IY4 A;  1LYG A;  1TAY A;  3CDQ A;  2IFF Y;  5KY1 A;  1B7R A;  5KXL A;  4DD9 A;  1WQQ A;  3PBL A;  1GEZ A;  3RZE A;  4LYM A;  2BQA A;  206L A;  3OJP A;  3DMV A;  2D4I A;  7LYZ A;  2CWI A;  2HEE A;  4W58 A;  3VW7 A;  205L A;  3SN6 R;  1L72 A;  4NGI A;  1C6P A;  1IOR A;  1VAT A;  2XTH A;  1NMM A;  1JHL A;  1KIQ C;  201L A;  6LZM A;  120L A;  1HFX A;  1IC7 Y;  1OV7 A;  1C08 C;  1GF7 A;  2RBQ A;  195L A;  1QT3 A;  1DPW A;  4ZPU A;  2B6W A;  1HHL A;  4HPE A;  5KXK A;  4XJF A;  4R0F A;  1QDR A;  1LWG A;  2MEF A;  165L A;  1I56 A;  4H90 A;  1V7T A;  4GLA A;  4PRQ A;  1LJ4 A;  4Z3M A;  4W53 A;  1OUF A;  2D91 A;  3WMK A;  4CJ2 A;  4EXM A;  209L A;  249L A;  2BQB A;  1XEJ A;  4I7T A;  4II8 A;  1QQY A;  1BQL Y;  1DKJ A;  5LVK A;  1JTN A;  2F4A A;  216L A;  1HMK A;  1GDX A;  1T97 A;  4IJ4 A;  3AZ5 A;  2BLX A;  3WL2 A;  1LGX A;  1OWY A;  1OUE A;  3DN6 A;  2BQK A;  2I6Z A;  243L A;  1GE4 A;  1LMN A;  1LHI A;  183L A;  2RB2 X;  2EQL A;  1QTH A;  1IWT A;  1T6V L;  4H9A A;  1GFJ A;  150L A;  4W55 A;  4DC4 A;  1XJT A;  4WM4 A;  3UON A;  1IP1 A;  3EML A;  2FBD A;  3CDT A;  3NYA A;  4LGK A;  1OP9 B;  1UIE A;  1L35 A;  1QUD A;  1L97 A;  2BQC A;  4ET9 A;  1REZ A;  1L51 A;  1JIT A;  4ANR A;  4D9Z A;  1GBO A;  3A94 A;  1FLQ A;  4DYG A;  4WO6 A;  3HH5 A;  3OE9 A;  1FN5 A;  5T3F A;  1CJ6 A;  3AJN A;  2LYM A;  1QSB A;  2X0A A;  3WW6 A;  1L68 A;  2QB0 B;  5LVJ A;  1WTN A;  126L A;  4H8Z A;  1LSA A;  4H9F A;  1FLY A;  4I7K A;  2DKV A;  1PQJ A;  2C8P A;  1OYU A;  1IWX A;  2BQI A;  1IR8 A;  4LYT A;  3W6B A;  5I5Q A;  198L A;  4EKS A;  5AMY A;  1ZVY B;  1JWR A;  1YL1 X;  1QS5 A;  1C45 A;  4GN4 A;  3MGW A;  4DJH A;  1LSE A;  221L A;  1L36 A;  258L A;  1D2Y A;  1D6Q A;  5C6I A;  4QGZ A;  1D0K A;  5KXN A;  1KY0 A;  2B70 A;  4XJH A;  4GCC A;  3TXG A;  1QUG A;  4N0J A;  1C6G A;  1QUS A;  2MEA A;  6LYZ A;  1L34 A;  122L A;  5F14 A;  1AT5 A;  3T36 A;  1WGT A;  1QIO A;  4GCE A;  4H9B A;  235L A;  1L0K A;  5E4P A;  4KL7 A;  4O34 A;  1KIR C;  1IC5 Y;  4NGK A;  4TSB A;  7WGA A;  1LKR A;  1GFT A;  1C63 A;  4P2E A;  1LZA A;  2BQF A;  3M3U A;  1LZ5 A;  4GBR B;  4BAF A;  1IOC A;  189L A;  188L A;  2Z6B A;  4AGA A;  2BQD A;  2CWG A;  5ILC A;  1L0J A;  4RW2 A;  1LYD A;  1CKD A;  4LFP A;  2ZYC A;  1LPY A;  228L A;  2AUB A;  2MED A;  1B0D A;  1JTM A;  4RDS A;  1AZF A;  1BB7 A;  1K7V A;  4ZFP A;  3LN2 A;  1L69 A;  4XJD A;  5FEK A;  261L A;  4HJZ A;  3G3A B;  1HML A;  1MLC E;  4G49 A;  4J0L A;  5KXO A;  2MEI A;  4WM1 A;  4NGY A;  5B05 A;  1A4V A;  1UUZ C;  1JPO A;  1P36 A;  3G3W A;  1HF4 A;  1HC0 A;  1PQI A;  1L50 A;  5C6J A;  1SWY A;  5IDD A;  1IX0 A;  3HBE X;  4Z98 A;  1BWJ A;  1L25 A;  1LSD A;  3DKE X;  4DDA A;  4I7N A;  1L59 A;  2F2N A;  1CKH A;  2RBP A;  4LT2 A;  4PPO A;  2BQE A;  1L00 A;  1YAM A;  147L A;  1C10 A;  3F6Z A;  4ARJ A;  3TMW A;  1IP2 A;  262L A;  4W57 A;  3GUO A;  1IOQ A;  3F9L A;  3P65 A;  1D3M A;  2YBM A;  227L A;  3QAK A;  2A7F A;  5FHW A;  4NHT A;  1WQM A;  5B59 A;  1ZV5 L;  4KPM A;  1L79 A;  234L A;  4OWH A;  3B72 A;  4LZM A;  1QUO A;  1D9U A;  1LZ9 A;  3AGI A;  4I7S A;  1L47 A;  2B6Y A;  181L A;  2ZIK A;  3E3D A;  250L A;  5IEL A;  1OUD A;  130L A;  1LMO A;  175L A;  1C6N A;  1LZY A;  2Z39 A;  3OK0 A;  2MEB A;  169L A;  2LCB A;  1CX6 A;  4NHP A;  1UIB A;  1MEL L;  1LJI A;  1CU2 A;  5APF A;  1B5X A;  4H9E A;  3C7W A;  3LYT A;  1DYF A;  4M4O A;  1CU0 A;  5A3Z A;  5DN4 A;  3A93 A;  1L96 A;  1DYE A;  1IVM A;  3WU7 A;  196L A;  2LC9 A;  4IAP A;  1LI3 A;  4I7R A;  4DDB A;  1LZ1 A;  4LZT A;  1L26 A;  2VB1 A;  1C6J A;  1UIC A;  1T3P A;  230L A;  4LT3 A;  1QDT A;  4H92 A;  1GB7 A;  3A95 A;  2WGC A;  1G0K A;  5FEL A;  1UID A;  4A7D A;  3HDE A;  1WQP A;  219L A;  2F32 A;  131L A;  1NDG C;  4W52 A;  193L A;  4TTD A;  139L A;  1G7M C;  4J7V A;  3HT9 A;  3VWO A;  153L A;  1YKZ X;  4EMN A;  1CKF A;  2ZNW Y;  1GB5 A;  2OU0 X;  1GB3 A;  1UIF A;  1REX A;  3CSQ A;  5B06 A;  3WU9 A;  3HFM Y;  3LZM A;  2Z2F A;  4NHS A;  4HV2 A;  3LYZ A;  4YXA C;  260L A;  3RU5 A;  1LMT A;  3NY8 A;  1LLH A;  1NBY C;  1NHB A;  4J1A A;  4DDC A;  1B5V A;  3W6C A;  1G1W A;  2LHM A;  4MST A;  1DI4 A;  2D6B A;  1RJC B;  1G0J A;  2ZIJ A;  1JEF A;  1LZE A;  1GB2 A;  2ANX A;  4LYB A;  3WW5 A;  1L16 A;  254L A;  1L40 A;  5B07 A;  1CV0 A;  1C7P A;  1JJ1 A;  3JR6 A;  1F6R A;  1C60 A;  3TXI A;  1SQ2 L;  4I7L A;  3A34 A;  4TSC A;  1D2W A;  2MEE A;  4NGL A;  2YBJ A;  2W1L A;  1LSM A;  4G9S A;  1G07 A;  3EMS A;  4G4H A;  1L23 A;  4OOO A;  4YX7 C;  3B6L A;  4WM6 A;  218L A;  4DD7 A;  190L A;  1VFB C;  3TMV A;  1DI3 A;  2DQE Y;  1RE2 A;  1GB9 A;  1P2C C;  152L A;  2W1X A;  1B7L A;  1G0Q A;  1LJ3 A;  1OUG A;  1GHL A;  4PGJ B;  2UVO A;  248L A;  4WG7 A;  1IR7 A;  1XEK A;  3RZ4 A;  2OTZ X;  3GUI A;  1L15 A;  1NWG A;  4NY5 A;  1L87 A;  4CFP A;  1OUC A;  4HTN A;  1KXY A;  4QY9 A;  4EPF A;  4HSF A;  4WM3 A;  4X3B A;  2F30 A;  158L A;  4HPI A;  1L93 A;  9WGA A;  1CKG A;  252L A;  2DQC Y;  4WO9 A;  1PQD A;  1YQV Y;  2G4N A;  5EBH A;  1I6S A;  160L A;  1LZB A;  4ARM A;  3D3D A;  1JKD A;  1C6D A;  3W6F A;  1JTO L;  4WLX A;  1B7N A;  4NSI A;  3A8Z A;  5DLA A;  1L60 A;  3HTG A;  236L A;  2YBI A;  1SX7 A;  123L A;  4I8S A;  3V2Y A;  5IHG A;  2B7X A;  1G0P A;  253L A;  4NIJ A;  1L41 A;  1L81 A;  172L A;  103L A;  1L12 A;  2L78 A;  4ETE A;  1LJE A;  4WG1 A;  4PK0 A;  1XSF A;  3IWR A;  1LGU A;  1B6I A;  3SP3 A;  1L71 A;  4OWE A;  1XGP C;  4B4E A;  5F81 A;  4GCD A;  4C3W A;  1C62 A;  1GF4 A;  1QSA A;  1FLW A;  4I7P A;  1VDT A;  3RW8 A;  3BKV A;  223L A;  3G3X A;  2ZIL A;  1XGR C;  3ZVQ A;  1L20 A;  1LGW A;  3F8V A;  5KXX A;  1L83 A;  217L A;  3DN4 A;  187L A;  1WTH A;  3WVX A;  1LYF A;  3WUL A;  3DN2 A;  4IAS A;  2B6T A;  157L A;  5KJ9 A;  1LYO A;  3W6D A;  1L46 A;  1HSX A;  1L91 A;  4W54 A;  3TXF A;  1C6E A;  1L54 A;  4AXT A;  1L77 A;  239L A;  4TWS A;  3P66 A;  3B0O A;  4FDY A;  3HUK A;  246L A;  3AGG G;  2QAR C;  1ULN A;  1L03 A;  1L95 A;  1IWW A;  1L58 A;  1GF5 A;  6LYT A;  4ETB A;  1KXW A;  5LYZ A;  1NQI A;  1LZN A;  4WL7 A;  1L27 A;  2HU1 A;  3WPL A;  1CV1 A;  1NBZ C;  2CUU A;  1G7L C;  255L A;  2BLY A;  1L48 A;  4N9R A;  4CHX A;  1LYZ A;  4W56 A;  1C6Q A;  3K3T A;  182L A;  1GFR A;  1WQR A;  1B5Z A;  1PQK A;  4NWH A;  3OE6 A;  1WVV A;  1HEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...