2DKVA

Crystal structure of class i chitinase from oryza sativa l. japonica
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
298
structure length
286
Chain Sequence
EQCGAQAGGARCPNCLCCSRWGWCGTTSDFCGDGCQSQCSGCDGVGSIVPRDLFERLLLHRNDGACPARGFYTYEAFLAAAAAFPAFGGTGNTETRKREVAAFLGQTSHETTGGWPTAPDGPFSWGYCFKQEQNPPSDYCQPSPEWPCAPGRKYYGRGPIQLSFNFNYGPAGRAIGVDLLSNPDLVATDATVSFKTALWFWMTPQGNKPSSHDVITGRWAPSPADAAAGRAPGYGVITNIVNGGLECGHGPDDRVANRIGFYQRYCGAFGIGTGGNLDCYNQRPFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chitinase
publication title Structure of full-length class I chitinase from rice revealed by X-ray crystallography and small-angle X-ray scattering
doi rcsb
source organism Oryza sativa japonica group
molecule tags Hydrolase
total genus 99
structure length 286
sequence length 298
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2006-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00182 Glyco_hydro_19 Chitinase class I
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 2dkvA02
3.30.20.10 Alpha Beta 2-Layer Sandwich Endochitinase; domain 2 Endochitinase, domain 2 2dkvA03
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 2dkvA01
4DDCA 1IP3A 1B5ZA 1GF5A 4LYMA 2DQAA 2BQJA 2Z2EA 1GB6A 1W6ZA 1GE0A 3BKVA 4PGJB 5FHWA 1B7OA 4GN5C 1GF6A 1B5YA 2XBRA 4KXIA 1HSWA 4H91A 4GCCA 1OQMA 4XJGA 4NGYA 2BQHA 5KJ9A 4YF2A 2F30A 2CGIA 5B1GA 4Z98A 1LYSA 4ETBA 4H90A 1A4VA 1GB8A 2BQDA 2LYMA 4LGKA 1LSFA 1E8LA 5K7OA 4UWVA 4DDBA 1VATA 2CJLA 1OUIA 2X52A 1KIRC 1EQ4A 1IC4Y 3IJUA 4B4JA 2Z38A 2BQFA 2C8OA 1CKGA 2PC2A 2YBHA 8LYZA 4WOAA 4NGOA 4LT2A 4ET9A 5J7CA 5LINA 1QTEA 1LSPA 2IHLA 2LYZA 4NEBA 1XGPC 2HEEA 4H9BA 4NHPA 1G7IC 3N9CA 1OUAA 3D9AC 1JJ3A 1H6MA 3WUAA 1HEQA 5DN4A 3A96A 3AGIA 5HQ1A 2YBIA 1CKFA 4LYZA 1LYOA 1CJ6A 1B5VA 1NWGA 1FLWA 3OK0A 2DQIY 1C10A 1AM7A 4RDSA 1FN5A 1LJFA 1CKHA 2BQMA 1BWJA 4G4BA 1F6RA 3TXHA 3RT5X 153LA 1F6SA 1GFEA 5LAFA 1B7MA 1KXYA 7WGAA 4WL6A 5LVKA 1JIYA 1GF7A 3J6KA 1BVKC 1I56A 1P9GA 1VDTA 1FKQA 2FYCA 5EBHA 3W6DA 1D9UA 1JEFA 1VEDA 2W1YA 1LZSA 5E9RA 5KXWA 4ETAA 5D5FA 1YAMA 1XGQC 1GFVA 3FI7A 5HMJA 5HNLA 1OUFA 1GEVA 5APDA 2NWDX 3P68A 1WQRA 4KPMA 3ATOA 5I5QA 1AT6A 1ZMYL 3B6LA 2YBMA 1UA6Y 1WGCA 1BB7A 2F4GA 1BB3A 4BS7A 3CSQA 4YENA 1HFYA 1IOTA 5A3EA 5KXTA 3TXBA 5FSTA 1FLUA 4NY5A 3TMUA 1JKCA 3F6ZA 4B4IA 1GXXA 1H87A 4O34A 1K7TA 2YDGA 1KXXA 4H9IA 1XEJA 1QDTA 3P64A 1O23A 1RFPA 4YEOA 3QY4A 3QNGA 3W6BA 1QDRA 2CDSA 3LHMA 1GFHA 1IVMA 4U3XB 2CWIA 4BAPA 1BB6A 5LVIA 2HECA 1LHHA 4DYGA 1LSNA 1K7UA 9WGAA 1DZBX 4I8SA 1AZFA 1Q9BA 2ZIJA 3A6CY 5B59A 2MEAA 5F16A 3A8ZA 1JISA 4LYCA 5FCPA 3W6AA 1LJGA 4OOOA 1HF4A 3HBHA 5IHGA 5KXXA 1TAYA 1REZA 1YANA 1GB9A 1PS5A 4E3UA 1HEPA 4GN4A 5I4XA 5KKJA 2LB7A 3EMSA 1QSAA 2EQLA 3J4GA 3T36A 3WXUA 2DQHY 1GF9A 5LA5A 2H5ZA 4H9EA 1GF8A 1NF5A 1GPQC 1LMPA 4NSHA 3GXKA 1G7JC 4FDYA 5LIOA 3CSZA 5B05A 3HBEX 2MEIA 1LJEA 1GFTA 4DD0A 3AYQA 5M1YA 1IOCA 1J1XY 2D4IA 5DL9A 4R6CA 1TCYA 4XYYA 3TXDA 3WVXA 5FELA 4B1AA 4WLDA 4YOPA 4G49A 5A3ZA 3RU5A 1B5UA 1WQQA 1GDWA 4FJRA 5APCA 1LHKA 1UCOA 1LHJA 2ZNWY 1G7LC 1YKYX 3B0OA 1LMCA 2EPEA 4NIJA 4LFXA 5L3HA 1B7QA 4LT3A 4TTDA 1BVXA 3G3AB 3RNXA 2ZYCA 1IWUA 1QSWA 1VDSA 2XBSA 4GCBA 4Z46A 4HJZA 1IX0A 4ML7A 3TXFA 1JITA 2LZ2A 132LA 4J1BA 1XGRC 1UIFA 1MELL 1EL1A 1TDYA 3ZVQA 1ZVYB 3QE8A 5LYZA 1LSYA 1WQNA 1GEZA 4NHQA 3LZ2A 5LVJA 2D4JA 1BB5A 1XGTC 1TEWA 1LJ3A 1NHEA 2BLYA 1LJNA 4CHXA 3M18B 3W6CA 1ULMA 1LYYA 1OUDA 2BQBA 4WG1A 3GXRA 1JSEA 2H9JA 4NWEA 3CT1A 1MLCE 3A95A 5B1FA 1XEKA 1J1OY 1LJHA 2I6ZA 5KXMA 1UBZA 1LSZA 1NQIA 5I4WA 1OUGA 1DPXA 1WGTA 4WLYA 4NGVA 4EOFA 1REYA 4NG1A 1LHLA 5L3IA 7LYZA 4HTKA 4PHIA 1YAOA 4OWAA 2A7DA 2FBDA 1HMLA 5FEKA 1LZEA 4GCEA 4YM8A 2GV0A 1B5XA 1I1ZA 2N5ZA 2XJWA 1JSFA 1JKBA 2LHMA 5LVHA 2MEHA 4DC4A 4DD3A 5F9XA 1SQ2L 2BQEA 2D6BA 1LPIA 1ULKA 1WQMA 4WP4A 2YBNA 1UHAA 2ZILA 5LXWA 1HSXA 3WL2A 2LYOA 1B7SA 4WLTA 4X3BA 6LYTA 2H9KA 5I54A 2XTHA 1LTMA 2HTXA 1RJCB 1QTKA 1IWTA 1IC7Y 2D4KA 4TUNA 4WLXA 5C6LA 1FDLY 1OUJA 1PZYA 3A92A 1IR7A 3A67Y 4NHTA 1CJ8A 4H94A 1LZAA 2BQNA 1BHZA 1AKIA 4NHIA 1W08A 4B4EA 2BLXA 5B06A 1JJ0A 207LA 2HEAA 2Z39A 1IORA 1GFKA 1JTPL 1UIDA 1GB7A 1ALCA 1JJ1A 1JKAA 3TXGA 4DD2A 4AMLA 5LA8A 1B0DA 4H9CA 4NGIA 3CT5A 4W96A 1GBYA 2HUBA 5FDJA 1NBZC 4LYOA 2CWGA 1IWZA 1XEIA 5AMYA 1LZRA 2F2NA 4ETDA 1DI4A 1LOZA 2MEFA 1IP1A 3WULA 1GBWA 3EO5A 5IELA 1FLQA 3WYHA 4HV1A 2MEDA 3W3EA 4H8ZA 3AGHA 1GAZA 4NFVA 5KKIA 3AZ7A 4B0DA 2DQCY 4GCFA 4TX7A 4Z3MA 1GE3A 1GAYA 4GCDA 1Z55A 2HEDA 4LT1A 1HENA 2X0AA 1N4FA 4OW1A 1HFZA 1SLYA 2VB1A 1LSMA 4H9HA 4WM6A 5C6JA 4WM3A 2C8PA 2G4PA 4UWUA 1KIQC 4H9FA 2Z2FA 4TSBA 2DKVA 5KXPA 2DQEY 4WM5A 1UICA 1LJKA 4J1AA 1NDGC 1B2KA 4NSJA 5KXNA 2I25L 2YVBA 4OWBA 1GHLA 4HJYA 2BQCA 4WO6A 1GF4A 4AXTA 4WMGA 2EKSC 4H9AA 1RI8B 1HFXA 208LA 4II8A 3WH1A 135LA 4NSGA 1D0LA 3A91A 1C7PA 2ZWBA 4G4CA 1XGUC 3IJVA 1V7SA 4WG7A 1P9ZA 4LZTA 4BAFA 1YKXX 1GXV2 1NMMA 2ZIKA 1GB5A 2B5ZA 1LSGA 1LKRA 4H93A 3A34A 4IJ4A 4LFPA 4TWSA 5JENB 1LMOA 5LYTA 2BAAA 4ET8A 1LMAA 1UC0A 1UIEA 5DM9A 3W6EA 3FE0A 4ZIXA 1IWWA 1HC0A 1P2CC 1LHIA 4OOTA 4KL7A 5C6IA 4PPOA 3T6UA 1LHMA 3MGWA 1A2YC 1KXWA 4OWHA 4N0JA 1IWXA 1ZV5L 1RE2A 4NWHA 4XJHA 3VWOA 2W1MA 4R0FA 1GDXA 4CGEA 3KAMA 2FBBA 3P65A 4N5RA 1BGIA 1GE4A 4ZFPA 2I26L 3LYMA 1YILA 1CNSA 2FYDA 1IY3A 4NHSA 5E4PA 6LYZA 4YEMA 5F14A 4C3WA 4NGJA 1JUGA 3B0KA 5KXLA 1OUCA 1LZBA 2HEBA 2WARA 1B7PA 3M3UA 4UWNA 4WM2A 1LAAA 1LJ4A 2Z37A 4RW2A 1GFJA 1QQYA 1IR8A 3HFMY 1IP5A 4W94A 3WPJA 1LZDA 1GBSA 1FLYA 4RLNA 4PRUA 1GFUA 2DQJY 1D0KA 1G7MC 3W6FA 4MSTA 4HPIA 3A94A 4WM1A 1KIPC 4BADA 1GF0A 4ETCA 3AZ6A 1HERA 3D3DA 4H8XA 1CJ9A 4HV2A 1GFRA 1YAQA 4IASA 4DT3A 4N1CC 5ILCA 1B7LA 1GFAA 1IOSA 2BQIA 1DQJC 4DD7A 9LYZA 2W1XA 1HNLA 3CSRA 4ETEA 1UIGA 5T3FA 3WW5A 1GWDA 4KT3A 1C46A 1IP6A 4OWCA 3ULRA 1XSFA 2W1LA 1LJJA 3WW6A 4LYBA 1GB3A 1LYZA 3EXDA 2Y8PA 3LN2A 4L41A 3A3QA 5KXYA 2Z19A 3WVYA 5I4YA 3WMKA 194LA 1LZ4A 2RSCA 5KY1A 3AW6A 1VFBC 1UIBA 4WL7A 1WVVA 1J1PY 3E3DA 3HBDA 5DLAA 1XFPL 4N9RA 1YROA 1DPWA 1DXJA 1CJ7A 3AZ4A 4RLMA 5LYMA 4QEQA 1RCMA 3ATNA 1GBXA 1IEEA 1B9OA 1D0MA 1UACY 3BKHA 4XENA 5KXZA 5KXKA 1YIKA 1JHLA 1GE2A 1WTMA 2DQFC 3A93A 3CT0A 5ILFA 134LA 1IY4A 1LJIA 1VDQA 4N1EI 2BQAA 1UIAA 4RW1A 1GD6A 3ZVQB 2BQKA 1NKHA 133LA 5HLLA 4DDAA 1DKKA 3A3RX 4HTNA 2MECA 3N9AA 2YBJA 3TMWA 2BQOA 4ZEEA 4M6DA 5DN5A 3AGGG 1WQOA 2G4QA 1YL1X 1JKDA 1FKVA 4GLVA 4P2EA 2A7FA 1GB0A 1LZ8A 4LT0A 4H1PA 1WVUA 3RZ4A 2EIZC 4M4OA 1LZNA 3OJPA 4WO9A 2WGCA 1IOQA 2Z12A 3WUNA 3CQLA 1F10A 1T6VL 3AJNA 1LSAA 4HP0A 1HEVA 1OUBA 4IATA 2DQDY 4DWXA 1OUEA 5F81A 1IWYA 1GB2A 1IC5Y 4NGZA 1UUZC 3IWRA 4TSCA 3SP3A 4AGAA 5LAGA 1C43A 4XADA 1IO5A 1JTTL 1LZ5A 2BPUA 5APEA 5HMVA 5KXOA 2HU1A 4A7DA 3A90A 3G3BB 4GLAA 4HTQA 1V7TA 1EQEA 2ZQ4A 4NGWA 1LSBA 3ZEKA 1CKDA 3K3TA 1IR9A 3WU8A 3LYTA 1B7RA 2D91A 1LMQA 1NBYC 4DD9A 2X3TA 3P4ZA 4PRQA 2BQGA 1BWHA 2YBLA 5HNCA 1QUTA 1WTNA 3RW8A 4C5FA 1GBOA 1DKJA 4XN6A 5LVGA 1LZ1A 2HU3A 5F9UA 3TXEA 4B49A 1TBYA 1JPOA 4NG8A 3B0IA 1BQLY 2AUBA 4G9SA 4GN3A 1YAPA 1ULNA 1C08C 1LKSA 1YKZX 3WU7A 1K7VA 1GFGA 2MEGA 4LYTA 1ZVHL 1HELA 4MPIA 5KXSA 3LYOA 1GE1A 1JWRA 4MR1A 2MEEA 2DQGY 4G4HA 2LZTA 154LA 1WKXA 1D6PA 1LSEA 1VDPA 3AB6A 1VAUA 1IWVA 1D6QA 1LZYA 1OUHA 1DI3A 2ZYPA 1BB4A 3TXKA 3WXTA 193LA 1HEOA 1HHLA 1LZGA 1UIHA 3EBAB 3WUMA 1LZTA 1WQPA 2G4NA 2Z18A 5B07A 3N9EA 1FBIX 4QGZA 1GF3A 1DI5A 4Z41A 4EMNA 2DBTA 4PJ2C 5I53A 1NDMC 4N8ZA 1CKCA 1INUA 3A6BY 1IP2A 4NGLA 3CB7A 4QDNA 4QY9A 2Q0MX 5IDDA 4NGKA 1T3PA 4H92A 4J7VA 4H8YA 4HSFA 4DD1A 1G7HC 4NSIA 1GBZA 1IP7A 4OWEA 4XJDA 4XJBA 1B7NA 1HEMA 5L9JA 1BWIA 2ZQ3A 1HEWA 3TMVA 1LSDA 1LZCA 1LZ9A 4CFOA 2ZNXY 5II3A 1C45A 1AT5A 2MEBA 4HPEA 4CJ2A 4MCKA 5KXRA 1LCNA 4ANRA 4HJVA 1IP4A 2BQLA 2F4AA 4XJIA 3B72A 3WU9A 1I20A 4J0LA 2HEFA 5D5CA 3AW7A 3TXIA 1F0WA 1QUSA 1EQ5A 4WM4A 1YL0X 1JTOL 3P66A 1REMA 4D9ZA 1OP9B 1IIZA 2YSSC 5APFA 3LYZA 3LZTA 4I0CA 3TXJA 1YQVY 3WPKA 1LMNA 1REXA 3AZ5A 1LSCA 4XJFA 3WPLA 1B5WA 1LZ6A 1LMTA 4CFPA 1QIOA 2UVOA 1HMKA 3TMXA 2IFFY
chains in the Genus database with same CATH superfamily
3TO7A 213LA 4DDCA 1W6ZA 4PGJB 2GKVA 4KXIA 4H91A 1OQMA 1L64A 3C8QA 2ARPF 1C61A 2F30A 1ZWNA 4H90A 1GB8A 2BQDA 2LYMA 2ENZA 4UWVA 1VATA 251LA 2Z38A 2PC2A 4WOAA 4I7LA 4LT2A 4ET9A 5J7CA 3OXGA 1QTEA 2RBNA 1L57A 1OUAA 1H6MA 1FYBA 4EXMA 1BUSA 4LYZA 151LA 3OK0A 2DQIY 3FSYA 1LJFA 164LA 1BWJA 3TXHA 3RT5X 4E1RA 1JIYA 1I56A 1P9GA 1XBTA 2W1YA 1LZSA 138LA 4ETAA 5D5FA 4EKSA 186LA 2NWDX 4KPMA 5I5QA 2ODDA 3SBAA 1BB7A 2F4GA 4BS7A 1L80A 3CSQA 1Z7KB 1UVFA 1C6LA 5FSTA 3F6ZA 1NHBA 1GXXA 245LA 3SGBI 2B6TA 2QQ0A 2YDGA 1L91A 3P64A 4YEOA 5FUYA 3W6BA 1IVMA 2CWIA 4BAPA 242LA 3QAKA 1DZBX 2KMPA 1Q9BA 2ZIJA 2MEAA 4LYCA 2XRCA 4OOOA 253LA 1GB9A 2ORVA 115LA 5J8CA 4E3UA 1TBOA 5I4XA 1L75A 3EMSA 1QSAA 3UFFA 3DNAA 1GF8A 1C6AA 4FDYA 5LIOA 3CSZA 2A4TA 1L86A 113LA 4W52A 1GFTA 5M1YA 2LZMA 1J1XY 1L52A 1L89A 3VE5A 4G49A 5A3ZA 1WQQA 1L63A 119LA 1LHKA 4S0WA 4LFXA 1B7QA 5I14A 3G3AB 1PQKA 1QSWA 2XBSA 4Z46A 1L05A 4HJZA 1JITA 1KS3A 3QE8A 5LYZA 1C68A 1UUCA 2BLYA 4YXAC 1LJNA 140LA 4CHXA 3M18B 3W6CA 2BQBA 4WG1A 1JSEA 2H9JA 1MLCE 3A95A 3QAHA 1LJHA 5KXMA 3TOAA 1L22A 1C6HA 1REYA 4HGUA 1CX6A 2V53A 4PHIA 1D3MA 1DYCA 2OD1A 5FEKA 128LA 3PDNA 1LZEA 1SWYA 2XJWA 5LVHA 2LHMA 1TGSI 3HTGA 1L87A 2MEHA 1SGYI 5F9XA 1PQIA 1L44A 2BQEA 2D6BA 1ULKA 224LA 1UHAA 1R0RI 5LXWA 3DN0A 3WL2A 4WLTA 4AQNA 3SGQI 1L45A 2XTHA 170LA 1IWTA 1OV5A 1L83A 3E59A 4H94A 1LZAA 4NHIA 1BHZA 1AKIA 4EKQA 2Z39A 1JTPL 1GFKA 4EKPA 1L29A 1JKAA 4DD2A 1SGEI 4NGIA 3CT5A 4DKLA 2CWGA 5AMYA 1LZRA 1DI4A 1LYJA 1L70A 2MEDA 4HV1A 4H8ZA 1GAZA 4NFVA 5KKIA 2DQCY 1LW9A 4TX7A 1GE3A 1SLYA 1LSMA 110LA 4H9HA 4WM3A 1KIQC 1L74A 2Z2FA 4TSBA 2DKVA 2DQEY 3TOBA 1UICA 228LA 5KXNA 2I25L 4OWBA 4HJYA 2BQCA 4WO6A 1GF4A 4AXTA 1P36A 3WH1A 118LA 2V1CA 2ZWBA 1P9ZA 3UEJA 4LDLA 2ZIKA 1GB5A 4H93A 1LKRA 1SX2A 4IJ4A 5LYTA 2BAAA 2JYYA 3VDPA 1UIEA 3UONA 1C65A 2M5XA 3CDTA 1HC0A 1OWZA 1Y1CA 1P7SA 2XQOA 3MGWA 1KXWA 3VWOA 1ZV5L 4XJHA 2Z6BA 4EJ4A 1GDXA 4N5RA 1QTDA 3KY9A 4ZFPA 3OXLA 1IY3A 5KXLA 1JUGA 3M3UA 1B7PA 3UGIA 262LA 1L81A 2Z37A 1GFJA 3WPJA 3OE6A 225LA 1KBEA 1G7MC 1QTHA 4WM1A 2ENNA 3AZ6A 4H8XA 5HQ8A 180LA 1SGNI 1T8GA 5FUVA 5ILCA 1DQJC 1CU3A 4ETEA 2J87A 5T3FA 3WW5A 3OL0A 1KMAA 4KT3A 1C46A 4OWCA 3ULRA 1XSFA 220LA 1V1IA 1LJJA 3EXDA 4L41A 5KXYA 1JQUA 3WVYA 5I4YA 1LZ4A 139LA 2LEOA 3UOEA 1SWZA 1J1PY 3E3DA 1XFPL 3GUJA 3AZ4A 1DPWA 1DXJA 2OU9A 1L76A 1P56A 3DKEX 1B9OA 1D0MA 3BKHA 4XENA 2RB1X 239LA 144LA 1LJIA 2OE9X 1UIAA 254LA 1NKHA 216LA 3HT8A 3HH5A 2SGFI 1DKKA 3EMLA 2B8TA 3HWLA 2A20A 3GUNA 3JR6A 5DN5A 4PK0A 3AGGG 3OXFA 2OU0X 222LA 4P2EA 1C6JA 1QUOA 1MJAA 4M4OA 2WGCA 1IOQA 2B7XA 1F10A 1OUBA 1L42A 143LA 4EPFA 3C7WA 182LA 4ARPA 1C43A 4XADA 2BPUA 1JTTL 205LA 4HTQA 1LSBA 2QQDA 3K3TA 1XA6A 2D91A 1NBYC 4DD9A 2X3TA 1ZURA 4PRQA 1XEPA 1BWHA 3DMXA 3RW8A 2B70A 5LVGA 1L72A 5HI7A 1TBYA 4NG8A 1ULNA 1LYIA 1LKSA 2KMRA 1K7VA 2RC4A 2B6YA 5KXSA 1C6IA 1TOTA 1JWRA 3DN3A 4MR1A 1WKXA 2B6ZA 1DYAA 4E1PA 1D6QA 3TXKA 2ZYPA 1UIHA 1SGDI 1TBQR 122LA 2NTGA 111LA 1FBIX 150LA 1DI5A 2PQ8A 5I53A 1CKCA 1INUA 2F3CI 4QDNA 4H92A 4J7VA 4HSFA 1G7HC 3TMVA 1LSDA 1LZCA 2MEBA 1AT5A 4HPEA 4MCKA 4I7RA 2BQLA 1KW5A 4DQ5A 1I20A 1PQDA 3AW7A 1L40A 3SB9A 4DQJA 1YL0X 1CGII 3LYZA 1LMTA 4CFPA 1QIOA 1GHLA 1PTQA 4GRVA 2GKRI 1IP3A 4LYMA 112LA 3BKVA 5FHWA 2O4WA 4GN5C 3QWPA 4Z98A 1G0PA 2N71A 1OUIA 2X52A 1IC4Y 1PCEA 1NUBA 1CUPA 1D2YA 1C6NA 1G7IC 3N9CA 1JJ3A 1HEQA 2KMOA 1MJ9A 2YBIA 158LA 1CJ6A 1NWGA 1L08A 256LA 1AM7A 3R5DA 4RDSA 1FN5A 7WGAA 1F6SA 5LAFA 5LVKA 1BVKC 1G0LA 1V1HA 165LA 1VDTA 2FYCA 137LA 5KXWA 1XGQC 1FY7A 1OUFA 2JA1A 3ATOA 1AT6A 1L06A 1Y1BA 5EX0A 1L17A 1IOTA 2ELIA 5A3EA 1L55A 3TMUA 3HH3A 4B4IA 1H87A 1P5CA 1L92A 4H9IA 1O23A 1RFPA 4ARJA 3QY4A 3QNGA 2CDSA 3LHMA 3HUKA 3OVOA 3LZMA 9WGAA 4I8SA 1AZFA 5B59A 5F16A 1JISA 3W6AA 1HF4A 3HBHA 1TBRR 1L50A 1HEPA 5KKJA 5EX3A 3WXUA 1GF9A 4FKDA 1NF5A 1GPQC 4NSHA 1L27A 3V2YA 5B05A 5CCLA 4DD0A 3WVXA 1L31A 4W54A 4XYYA 2VRWB 1C6TA 3C7YA 1C6DA 3RU5A 255LA 3B0OA 4NIJA 1DS2I 1QT8A 4LT3A 3R5AA 2RB2X 261LA 1IX0A 247LA 3TJQA 1R79A 1MELL 5LVJA 1BB5A 3HH4A 1ULMA 3OE0A 175LA 5B1FA 1XEKA 1LSZA 1NQIA 5I4WA 260LA 1DPXA 4WLYA 4NG1A 1W4RA 5L3IA 1OV7A 1HMLA 2GV0A 1B5XA 1I1ZA 1JKBA 103LA 1X4SA 7LZMA 2OZUA 166LA 1C6QA 4GI3C 2ZILA 1HSXA 5J8FA 2Q9DA 1L84A 6LYTA 2W0TA 2D4KA 4TUNA 1L65A 4IAPA 1CU2A 4NHTA 1D3NA 1L73A 199LA 1OVJA 1W08A 1CT0I 1JJ0A 207LA 3RU0A 1UIDA 1GB7A 1TLAA 1B0DA 4H9CA 2HUBA 1L09A 2F2NA 1IP1A 1OMTA 3AZ7A 4B0DA 3TO6A 1GAYA 4GCDA 1JTNA 4LT1A 1HENA 2X0AA 167LA 2B75A 1L67A 4DQ7A 250LA 2OTZX 185LA 1UVGA 2YVBA 4WMGA 1RI8B 1HFXA 208LA 4NSGA 1D0LA 2QARC 1P2RA 4G4CA 195LA 3IJVA 126LA 1V7SA 5E3QA 1NMMA 5JENB 1CU0A 2RBSA 4W59A 3W6EA 1P2CC 171LA 4OOTA 1W3SA 4OWHA 157LA 4N0JA 1IWXA 1RE2A 2W1MA 4R0FA 2CJSC 1L53A 2FBBA 1L02A 102LA 1BGIA 2I26L 3LYMA 2FYDA 104LA 4YEMA 2OVOA 2LC9A 3B0KA 131LA 1OUCA 2WARA 4UWNA 181LA 1L77A 1C66A 3ODUA 1QQYA 2RB0X 1L07A 1GFUA 240LA 1CHOI 1CV4A 4HPIA 3D00A 4ETCA 215LA 1HERA 3D3DA 4HV2A 1YAQA 3HDEA 3HTBA 4DT3A 4N1CC 2F2QA 2Y0MA 1LGXA 1HDLA 230LA 1XJUA 1L61A 1M8CA 3WW6A 241LA 3OE8A 4W56A 3A3QA 2Z19A 5KY1A 3AW6A 1VFBC 2O79A 3FA0A 3HUQA 5CCMA 3HBDA 2GKTI 1G06A 1CJ7A 5LYMA 1LR9A 4QEQA 1L19A 1B6IA 4ARLA 109LA 1GE2A 1X74A 188LA 1WTMA 134LA 1VDQA 4N1EI 4RW1A 3B4VC 3FC3A 223LA 4HTNA 1L60A 3N9AA 3TMWA 2BQOA 155LA 2JW6A 4K5YA 1T97A 1OVHA 4LT0A 236LA 3SB6A 2ROWA 3BJIA 1DYGA 1L93A 4WO9A 3WUNA 125LA 3CQLA 4B6DA 4HP0A 1HEVA 2DQDY 4DWXA 1OUEA 5F81A 2GVIA 1IC5Y 2NU1I 1LGUA 4AGAA 176LA 1L97A 5KXOA 5HMVA 5APEA 4A7DA 1EPYA 4NGWA 3LYTA 2B6XA 3SBBC 3P4ZA 184LA 1WTNA 1GBOA 1DKJA 1L0JA 2HU3A 5F9UA 3TXEA 1L39A 2AUBA 3VW7A 1C08C 1CTWA 3WU7A 1GFGA 2MEGA 3LYOA 3G3VA 2DQGY 3HU8A 4SGBI 149LA 2LZTA 154LA 1VDPA 1VAUA 1AN1I 2HUMA 193LA 1HEOA 1L36A 1LZGA 1L03A 3EBAB 1LZTA 5B07A 168LA 4QGZA 1GF3A 3C8RA 4EMNA 4PJ2C 173LA 1NDMC 2DIPA 4NGLA 1QTBA 1SGPI 4OVOA 1IP7A 1B7NA 3DN4A 2OU8A 1BWIA 4W58A 1C6MA 1YTPA 5II3A 4L9MA 4CJ2A 1CE3A 2QQEA 4XJIA 3WU9A 2HEFA 2OU2A 4WM4A 3P66A 1REMA 1OP9B 1IIZA 1LYGA 3LZTA 1YQVY 1HJAI 1LSCA 3WPLA 3SB8A 1LZ6A 3TMXA 2IFFY 1GF5A 2DQAA 2Z2EA 1GB6A 2RBQA 1GE0A 5E3PA 1B7OA 1CSOI 1B5YA 1HSWA 4GCCA 1L98A 4XJGA 2BQHA 4EKRA 2CGIA 5B1GA 4ETBA 2LUYA 1A4VA 1LSFA 5K7OA 1MT1A 2CJLA 1KIRC 1EQ4A 3IJUA 8LYZA 2Q9EA 5LINA 2YQPA 2FNFX 1CV3A 1TIHA 1C60A 2HEEA 4NHPA 1LR7A 3DN2A 2SGPI 3A96A 1CKFA 2WCYA 1B5VA 1FLWA 2CWFA 2BQMA 4G4BA 1GFEA 1B7MA 1KXYA 1L71A 1SX7A 4WL6A 3GUOA 1SSYA 3HTFA 4ZPUA 5EBHA 1I6SA 1VEDA 1JEFA 1G0JA 1KNIA 1YAMA 1MJBA 5HNLA 2V1CC 226LA 3P68A 1ZYTA 1ZMYL 2YBMA 1UA6Y 1WGCA 1TBNA 1FARA 1BB3A 234LA 4YENA 4E97A 5KXTA 3TXBA 4NY5A 2NU0I 1JKCA 1L01A 1L94A 4O34A 1K7TA 1L16A 1GFHA 4U3XB 3FADA 1G0KA 1LYHA 238LA 1LSNA 1K7UA 1L62A 1CU6A 3A8ZA 1CGJI 1TAYA 1REZA 1YANA 1KY1A 1OYUA 1L26A 1PS5A 2LB7A 3J4GA 1L00A 3T36A 2DQHY 4LDEA 2N17A 2H5ZA 4H9EA 1LMPA 3GXKA 1OVOA 1L85A 2MEIA 5DL9A 2D4IA 3TXDA 1CV6A 1G1WA 2NU4I 4WLDA 1QS5A 1B5UA 3FI5A 1UCOA 1LHJA 2ZNWY 1YKYX 1LMCA 187LA 4TTDA 1BVXA 3RNXA 153LA 2ZYCA 1IWUA 1VDSA 108LA 1C62A 145LA 2LZ2A 1BMOA 1UIFA 1P2LA 3QTLD 1WQNA 190LA 4NHQA 2D4JA 1XGTC 1TEWA 1LWKA 1DYFA 3GXRA 4NWEA 3CT1A 2F47A 1QTZA 2B0UC 1UBZA 1WGTA 4NGVA 1L54A 1LWGA 4HTKA 4OWAA 2A7DA 2FBDA 212LA 197LA 4YM8A 1JSFA 4YXCA 147LA 4DC4A 4DD3A 1WQMA 4WP4A 1B7SA 4X3BA 1G0QA 2H9KA 1G0MA 5I54A 2HTXA 1RJCB 1QTKA 1L15A 4WLXA 5C6LA 1FDLY 1PZYA 1IR7A 4ARQB 3CDVA 4W51A 120LA 1G1VA 1P46A 1CT2I 2CWHA 2BLXA 3C83A 2HEAA 1IORA 4DNCA 1ALCA 3TXGA 1QTVA 4YX7C 3HH6A 4W96A 1QT4A 2NTHA 5FDJA 4LYOA 2HULA 161LA 4ETDA 1PQMA 3WULA 1L11A 1DS3I 1L47A 3W3EA 3AGHA 1QT3A 4I7KA 1XX6A 4Z3MA 2QB0B 1Z55A 2HEDA 3V2WA 1N4FA 1HFZA 2VB1A 5C6JA 1L18A 4UWUA 2OE7X 1SSWA 4WM5A 2ANVA 1CX7A 1L24A 1LJKA 248LA 4NSJA 1NDGC 1B2KA 2RH1A 2EKSC 1L90A 4H9AA 4II8A 135LA 1L38A 1C7PA 4LZTA 4BAFA 1GXV2 4TWSA 1LMOA 1L48A 114LA 1LMAA 1UC0A 5DM9A 4ZIXA 3UEYA 5C6IA 4PPOA 4DAJA 1CU5A 3T6UA 1LHMA 1A2YC 1DYBA 4I7JA 1L58A 3KAMA 1KY0A 3P65A 1GE4A 3CDOA 4AMLA 5F14A 130LA 1VDDA 1LZBA 2HEBA 3NY9A 2KCXA 1LAAA 1IR8A 4W94A 1LZDA 1GBSA 1FLYA 3L2XA 1T8AA 4PRUA 3W6FA 191LA 1D0KA 1RFHA 2ANXA 3A94A 1QSQA 1KIPC 1XJTA 1GF0A 1GFRA 1GFAA 1IOSA 2BQIA 9LYZA 129LA 3GUMA 1LYFA 1G0GA 4I7TA 1LI6A 1QSBA 2GIVA 231LA 2W1LA 4I7MA 1GB3A 259LA 194LA 2RSCA 2L78A 1CV1A 1QUHA 4RLMA 1RCMA 1KBFA 1GBXA 5KXZA 1YIKA 1JHLA 3A93A 1IY4A 2BQAA 3ZVQB 5HLLA 133LA 1QT5A 3UGDA 4DDAA 1D3JA 2YBJA 4M6DA 2NU2I 1WQOA 217LA 1YL1X 1JKDA 4GLVA 1C6CA 1L13A 3DN6A 1GB0A 4ARMA 4H1PA 1QT7A 1OVKA 3RZ4A 2B74A 1L43A 2EIZC 196LA 1LR8A 1L46A 2Z12A 1TUSA 1L28A 3AJNA 4IATA 169LA 123LA 218LA 3SP3A 2ORWA 1HPTA 257LA 233LA 1QS9A 3G3BB 2ZQ4A 1CKDA 1IR9A 1B7RA 232LA 3C81A 2BQGA 2YBLA 2E5RA 1LZ1A 1L32A 4B49A 1LI3A 1L21A 1BQLY 3B0IA 4G9SA 4GN3A 1YAPA 1HELA 3R5CA 2E73A 2QPOA 1D6PA 1LSEA 3AB6A 1IWVA 1BB4A 1JTMA 1HHLA 3C7ZA 252LA 1C6KA 3WUMA 1WQPA 2Z18A 3N9EA 4Z41A 3CDQA 3A6BY 3C8SA 3CB7A 1L23A 4H8YA 4DD1A 1GBZA 5L9JA 2ZQ3A 1L56A 1LZ9A 2J9RA 1C45A 4ANRA 1IP4A 1C63A 3B72A 1F0WA 2JXDA 1EQ5A 127LA 3HH2C 4ARQA 3DN1A 2YSSC 1REXA 3AZ5A 1LYDA 4UXHA 2UVOA 4W53A 2CUUA 5JHWC 174LA 1B5ZA 2BQJA 219LA 1GF6A 2XBRA 1WTJA 4NGYA 5KJ9A 4YF2A 1LYSA 2SGDI 4LGKA 1E8LA 4DDBA 1QUGA 2HUKA 4B4JA 2BQFA 2C8OA 1CKGA 2YBHA 3C82A 4NGOA 1LSPA 2IHLA 2LYZA 4NEBA 1XGPC 1CV0A 4H9BA 1OMUA 3D9AC 3HT7A 1L20A 3WUAA 5DN4A 3AGIA 5HQ1A 1LYOA 3R5BA 1H0ZA 1CV5A 1C10A 3NY8A 1CKHA 1C67A 192LA 1F6RA 1GF7A 3J6KA 1FKQA 3W6DA 1D9UA 4LDOA 5E9RA 1L96A 3FI7A 1GFVA 5HMJA 1GEVA 5APDA 142LA 1WQRA 1C6BA 3B6LA 4A24A 1HFYA 1IY5A 1DYEA 178LA 1Y8FA 1FLUA 229LA 2F32A 1T8FA 1KXXA 1XEJA 1QDTA 1SGQI 1PQOA 1QDRA 244LA 1KW7A 1BB6A 5LVIA 2HECA 1LHHA 4DYGA 152LA 3A6CY 3HU9A 5FCPA 1LJGA 1L37A 5KXXA 5IHGA 1QT6A 2OTYX 4GN4A 177LA 2EQLA 2SGQI 5LA5A 1L69A 3MEKA 4I7NA 1G7JC 1CUQA 3SB7A 1L30A 1IY6A 3HBEX 1LJEA 1L68A 3GULA 3AYQA 1IOCA 172LA 4R6CA 1TCYA 3RUNA 2UZ3A 5FELA 4B1AA 1L0KA 1U5KA 1PPFI 4YOPA 3SB5A 1GDWA 4FJRA 5APCA 1QUDA 1G7LC 1L34A 189LA 2EPEA 5L3HA 3TO9A 4GCBA 221LA 4ML7A 3TXFA 132LA 4J1BA 1XGRC 1EL1A 1TDYA 3ZVQA 1ZVYB 4UXIA 1LSYA 1M8BA 1GEZA 160LA 3LZ2A 1LJ3A 1NHEA 2O7AA 2DB6A 1OYVI 1LYYA 1OUDA 1FAQA 1J1OY 2I6ZA 1OUGA 210LA 4EOFA 1LHLA 246LA 7LYZA 3CXLA 1YAOA 4GCEA 2N5ZA 183LA 243LA 1SQ2L 1LPIA 156LA 1L10A 1WTHA 2YBNA 206LA 258LA 2LYOA 2OE4X 6LZMA 3CDRA 1LTMA 214LA 1IC7Y 107LA 2L7XA 1OUJA 3A92A 5FUXA 3A67Y 1CJ8A 1LI2A 3HT6A 163LA 2BQNA 3OE9A 1PTRA 4JCVE 159LA 209LA 4B4EA 5B06A 1D3FA 3GUPA 1JJ1A 5LA8A 1P64A 1GBYA 3VDUA 1NBZC 2OEAX 1IWZA 1XEIA 1LOZA 2QQCA 1L59A 2MEFA 1GBWA 1C6GA 3EO5A 5IELA 3L64A 1FLQA 3WYHA 235LA 1L99A 2L8EA 2JZMA 4GCFA 1D2WA 227LA 4OW1A 1P3NA 211LA 4WM6A 1L49A 2C8PA 2G4PA 2ERWA 1LYEA 4H9FA 5KXPA 2RIJA 3NYAA 2B6WA 3D4SA 4J1AA 4ARMB 3A91A 1XGUC 4WG7A 1YKXX 200LA 2B5ZA 1LSGA 3A34A 4LFPA 4ET8A 1P37A 2N52A 2B73A 3FE0A 141LA 1IWWA 1L79A 1LHIA 4KL7A 5DAEA 1CVKA 3GUIA 3DN8A 4I7QA 3SN6R 4NWHA 4CGEA 3HDFA 1L95A 4I7SA 1L35A 1YILA 1CNSA 6LYZA 4NHSA 5E4PA 4C3WA 4NGJA 2K9HA 201LA 1LPYA 4WM2A 1LJ4A 4RW2A 3HFMY 1IP5A 3G3XA 4RLNA 1K28A 2DQJY 2RAYX 4MSTA 4BADA 4UXJA 1CJ9A 1NXUA 1L66A 3G3WA 4IASA 1C6EA 1QTCA 4I7OA 1B7LA 1D9WA 3PBLA 4DD7A 2W1XA 1HNLA 3CSRA 1UIGA 1C6PA 2P6AC 3HUAA 1GWDA 1IP6A 4LYBA 1LYZA 4EPIA 2Y8PA 2B72A 3LN2A 4I7PA 2RBPA 3WMKA 3DMVA 3E2IA 1LLHA 1UIBA 4WL7A 1WVVA 5DLAA 4N9RA 5FUWA 1DYDA 1YROA 5E3RA 3ATNA 1IEEA 1UACY 5KXKA 2YUUA 2DQFC 5ILFA 3CT0A 1GD6A 2BQKA 1L12A 1L41A 2BUSA 1SGRI 3A3RX 2MECA 2SGEI 3HTDA 4ZEEA 1C6FA 2G4QA 1TURA 4W55A 1FKVA 2A7FA 1C64A 1LZ8A 1N13A 4DJHA 4OO9A 1WVUA 2NU3I 148LE 1LZNA 1IW4A 3OJPA 1L04A 1T6HA 1T6VL 1LSAA 162LA 3SEKC 2RAZX 1L88A 1IWYA 237LA 1GB2A 4NGZA 1UUZC 5LZMA 3IWRA 4TSCA 5LAGA 2RBRA 1IO5A 1LZ5A 3HT9A 3F8VA 2HU1A 3A90A 4GLAA 1V7TA 1EQEA 3ZEKA 3WU8A 1LMQA 1G07A 5HNCA 1LGWA 1QUTA 1L82A 4PJZA 4C5FA 3F9LA 2WVJA 3C80A 4XN6A 3FSXA 1OWYA 4GBRB 1JPOA 1L33A 1YKZX 4LYTA 1S20A 1PQJA 1ZVHL 4MPIA 3GOXA 3PDSA 1GE1A 2MEEA 4G4HA 1LZYA 1OUHA 1DI3A 3WXTA 2LCBA 3DMZA 4LZMA 2G4NA 1L51A 2DBTA 3UGLA 2N1AB 4N8ZA 1C69A 1L14A 1IP2A 4QY9A 2Q0MX 5IDDA 4NGKA 1T3PA 2RBOA 4W57A 4NSIA 4XJDA 4XJBA 4OWEA 1HEMA 3K2RA 3RZEA 1HEWA 2KMQA 4CFOA 2ZNXY 1CT4I 5KXRA 1LCNA 1P6YA 4HJVA 2IGCA 2F4AA 4J0LA 5D5CA 3TXIA 1QUSA 1JTOL 3GUKA 4D9ZA 5APFA 4I0CA 3TXJA 3WPKA 1L25A 1LMNA 1Z2IA 4XJFA 1B5WA 249LA 1YU6C 198LA 1HMKA 1PJUA 146LA
chains in the Genus database with same CATH topology
213LA 4DDCA 1W6ZA 4PGJB 4KXIA 4H91A 1OQMA 1L64A 3C8QA 1C61A 2F30A 1ZWNA 4H90A 1GB8A 2BQDA 2LYMA 4UWVA 1VATA 251LA 2Z38A 2PC2A 4WOAA 4I7LA 4LT2A 4ET9A 5J7CA 1QTEA 2RBNA 1L57A 1OUAA 1H6MA 4EXMA 4LYZA 151LA 3OK0A 2DQIY 1LJFA 164LA 1BWJA 3TXHA 3RT5X 1JIYA 1I56A 1P9GA 2W1YA 1LZSA 138LA 4ETAA 5D5FA 4EKSA 186LA 2NWDX 4KPMA 5I5QA 3SBAA 1BB7A 2F4GA 4BS7A 1L80A 3CSQA 1C6LA 5FSTA 3F6ZA 1NHBA 1GXXA 245LA 2B6TA 2YDGA 1L91A 3P64A 4YEOA 3W6BA 1IVMA 2CWIA 4BAPA 242LA 3QAKA 1DZBX 1Q9BA 2ZIJA 2MEAA 4LYCA 4OOOA 253LA 1GB9A 115LA 4E3UA 5I4XA 1L75A 3EMSA 1QSAA 3DNAA 1GF8A 1C6AA 4FDYA 5LIOA 3CSZA 2A4TA 1L86A 113LA 4W52A 1GFTA 5M1YA 2LZMA 1J1XY 1L52A 1L89A 4G49A 5A3ZA 1WQQA 1L63A 119LA 1LHKA 4S0WA 4LFXA 1B7QA 5I14A 3G3AB 1PQKA 1QSWA 2XBSA 4Z46A 1L05A 4HJZA 1JITA 1KS3A 3QE8A 5LYZA 1C68A 2BLYA 4YXAC 1LJNA 140LA 4CHXA 3M18B 3W6CA 2BQBA 4WG1A 1JSEA 2H9JA 1MLCE 3A95A 1LJHA 5KXMA 1L22A 1C6HA 1REYA 1CX6A 4PHIA 1D3MA 1DYCA 5FEKA 128LA 1LZEA 1SWYA 2XJWA 5LVHA 2LHMA 3HTGA 1L87A 2MEHA 5F9XA 1PQIA 1L44A 2BQEA 2D6BA 1ULKA 224LA 1UHAA 5LXWA 3DN0A 3WL2A 4WLTA 4AQNA 1L45A 2XTHA 170LA 1IWTA 1OV5A 1L83A 4H94A 1LZAA 4NHIA 1BHZA 1AKIA 4EKQA 2Z39A 1JTPL 1GFKA 4EKPA 1L29A 1JKAA 4DD2A 4NGIA 3CT5A 4DKLA 2CWGA 5AMYA 1LZRA 1DI4A 1LYJA 1L70A 2MEDA 4HV1A 4H8ZA 1GAZA 4NFVA 5KKIA 2DQCY 1LW9A 4TX7A 1GE3A 1SLYA 1LSMA 110LA 4H9HA 4WM3A 1KIQC 1L74A 2Z2FA 4TSBA 2DKVA 2DQEY 1UICA 228LA 5KXNA 2I25L 4OWBA 4HJYA 2BQCA 4WO6A 1GF4A 4AXTA 1P36A 3WH1A 118LA 2ZWBA 1P9ZA 4LDLA 2ZIKA 1GB5A 4H93A 1LKRA 1SX2A 4IJ4A 5LYTA 2BAAA 1UIEA 3UONA 1C65A 3CDTA 1HC0A 1OWZA 1P7SA 2XQOA 3MGWA 1KXWA 3VWOA 1ZV5L 4XJHA 2Z6BA 4EJ4A 1GDXA 4N5RA 1QTDA 4ZFPA 1IY3A 5KXLA 1JUGA 3M3UA 1B7PA 262LA 1L81A 2Z37A 1GFJA 3WPJA 3OE6A 225LA 1G7MC 1QTHA 4WM1A 3AZ6A 4H8XA 180LA 1T8GA 5ILCA 1DQJC 1CU3A 4ETEA 5T3FA 3WW5A 4KT3A 1C46A 4OWCA 3ULRA 1XSFA 220LA 1LJJA 3EXDA 4L41A 5KXYA 1JQUA 3WVYA 5I4YA 1LZ4A 139LA 1SWZA 1J1PY 3E3DA 1XFPL 3GUJA 3AZ4A 1DPWA 1DXJA 2OU9A 1L76A 1P56A 3DKEX 1B9OA 1D0MA 3BKHA 4XENA 2RB1X 239LA 144LA 1LJIA 2OE9X 1UIAA 254LA 1NKHA 216LA 3HT8A 3HH5A 1DKKA 3EMLA 3HWLA 3GUNA 3JR6A 5DN5A 4PK0A 3AGGG 2OU0X 222LA 4P2EA 1C6JA 1QUOA 4M4OA 2WGCA 1IOQA 2B7XA 1F10A 1OUBA 1L42A 143LA 4EPFA 3C7WA 182LA 4ARPA 1C43A 4XADA 2BPUA 1JTTL 205LA 4HTQA 1LSBA 3K3TA 2D91A 1NBYC 4DD9A 2X3TA 1ZURA 4PRQA 1XEPA 1BWHA 3DMXA 3RW8A 2B70A 5LVGA 1L72A 1TBYA 4NG8A 1ULNA 1LYIA 1LKSA 1K7VA 2B6YA 5KXSA 1C6IA 1JWRA 3DN3A 4MR1A 1WKXA 2B6ZA 1DYAA 1D6QA 3TXKA 2ZYPA 1UIHA 122LA 2NTGA 111LA 1FBIX 150LA 1DI5A 5I53A 1CKCA 1INUA 4QDNA 4H92A 4J7VA 4HSFA 1G7HC 3TMVA 1LSDA 1LZCA 2MEBA 1AT5A 4HPEA 4MCKA 4I7RA 2BQLA 1KW5A 4DQ5A 1I20A 1PQDA 3AW7A 1L40A 3SB9A 4DQJA 1YL0X 3LYZA 1LMTA 4CFPA 1QIOA 1GHLA 4GRVA 1IP3A 4LYMA 112LA 3BKVA 5FHWA 2O4WA 4GN5C 4Z98A 1G0PA 1OUIA 2X52A 1IC4Y 1CUPA 1D2YA 1C6NA 1G7IC 3N9CA 1JJ3A 1HEQA 2YBIA 158LA 1CJ6A 1NWGA 1L08A 256LA 1AM7A 4RDSA 1FN5A 7WGAA 1F6SA 5LAFA 5LVKA 1BVKC 1G0LA 165LA 1VDTA 2FYCA 137LA 5KXWA 1XGQC 1OUFA 3ATOA 1AT6A 1L06A 1L17A 1IOTA 5A3EA 1L55A 3TMUA 3HH3A 4B4IA 1H87A 1P5CA 1L92A 4H9IA 1O23A 1RFPA 4ARJA 3QY4A 3QNGA 2CDSA 3LHMA 3HUKA 3LZMA 9WGAA 4I8SA 1AZFA 5B59A 5F16A 1JISA 3W6AA 1HF4A 3HBHA 1L50A 1HEPA 5KKJA 3WXUA 1GF9A 1NF5A 1GPQC 4NSHA 1L27A 3V2YA 5B05A 4DD0A 3WVXA 1L31A 4W54A 4XYYA 1C6TA 3C7YA 1C6DA 3RU5A 255LA 3B0OA 4NIJA 1QT8A 4LT3A 2RB2X 261LA 1IX0A 247LA 1MELL 5LVJA 1BB5A 3HH4A 1ULMA 3OE0A 175LA 5B1FA 1XEKA 1LSZA 1NQIA 5I4WA 260LA 1DPXA 4WLYA 4NG1A 5L3IA 1OV7A 1HMLA 2GV0A 1B5XA 1I1ZA 1JKBA 103LA 7LZMA 166LA 1C6QA 2ZILA 1HSXA 2Q9DA 1L84A 6LYTA 2D4KA 4TUNA 1L65A 4IAPA 1CU2A 4NHTA 1D3NA 1L73A 199LA 1OVJA 1W08A 1JJ0A 207LA 1UIDA 1GB7A 1TLAA 1B0DA 4H9CA 2HUBA 1L09A 2F2NA 1IP1A 3AZ7A 4B0DA 1GAYA 4GCDA 1JTNA 4LT1A 1HENA 2X0AA 167LA 2B75A 1L67A 4DQ7A 250LA 2OTZX 185LA 2YVBA 4WMGA 1RI8B 1HFXA 208LA 4NSGA 1D0LA 2QARC 1P2RA 4G4CA 195LA 3IJVA 126LA 1V7SA 1NMMA 5JENB 1CU0A 2RBSA 4W59A 3W6EA 1P2CC 171LA 4OOTA 4OWHA 157LA 4N0JA 1IWXA 1RE2A 2W1MA 4R0FA 1L53A 2FBBA 1L02A 102LA 1BGIA 2I26L 3LYMA 2FYDA 104LA 4YEMA 2LC9A 3B0KA 131LA 1OUCA 2WARA 4UWNA 181LA 1L77A 1C66A 3ODUA 1QQYA 2RB0X 1L07A 1GFUA 240LA 1CV4A 4HPIA 4ETCA 215LA 1HERA 3D3DA 4HV2A 1YAQA 3HDEA 3HTBA 4DT3A 4N1CC 2F2QA 1LGXA 230LA 1XJUA 1L61A 3WW6A 241LA 3OE8A 4W56A 3A3QA 2Z19A 5KY1A 3AW6A 1VFBC 2O79A 3FA0A 3HUQA 3HBDA 1G06A 1CJ7A 5LYMA 4QEQA 1L19A 1B6IA 4ARLA 109LA 1GE2A 188LA 1WTMA 134LA 1VDQA 4N1EI 4RW1A 223LA 4HTNA 1L60A 3N9AA 3TMWA 2BQOA 155LA 4K5YA 1T97A 1OVHA 4LT0A 236LA 3SB6A 1DYGA 1L93A 4WO9A 3WUNA 125LA 3CQLA 4HP0A 1HEVA 2DQDY 4DWXA 1OUEA 5F81A 1IC5Y 1LGUA 4AGAA 176LA 1L97A 5KXOA 5HMVA 5APEA 4A7DA 1EPYA 4NGWA 3LYTA 2B6XA 3SBBC 3P4ZA 184LA 1WTNA 1GBOA 1DKJA 1L0JA 2HU3A 5F9UA 3TXEA 1L39A 2AUBA 3VW7A 1C08C 1CTWA 3WU7A 1GFGA 2MEGA 3LYOA 3G3VA 2DQGY 3HU8A 149LA 2LZTA 154LA 1VDPA 1VAUA 2HUMA 193LA 1HEOA 1L36A 1LZGA 1L03A 3EBAB 1LZTA 5B07A 168LA 4QGZA 1GF3A 3C8RA 4EMNA 4PJ2C 173LA 1NDMC 4NGLA 1QTBA 1IP7A 1B7NA 3DN4A 2OU8A 1BWIA 4W58A 1C6MA 5II3A 4CJ2A 4XJIA 3WU9A 2HEFA 4WM4A 3P66A 1REMA 1OP9B 1IIZA 1LYGA 3LZTA 1YQVY 1LSCA 3WPLA 3SB8A 1LZ6A 3TMXA 2IFFY 1GF5A 2DQAA 2Z2EA 1GB6A 2RBQA 1GE0A 1B7OA 1B5YA 1HSWA 4GCCA 1L98A 4XJGA 2BQHA 4EKRA 2CGIA 5B1GA 4ETBA 1A4VA 1LSFA 5K7OA 2CJLA 1KIRC 1EQ4A 3IJUA 8LYZA 2Q9EA 5LINA 1CV3A 1C60A 2HEEA 4NHPA 3DN2A 3A96A 1CKFA 1B5VA 1FLWA 2BQMA 4G4BA 1GFEA 1B7MA 1KXYA 1L71A 1SX7A 4WL6A 3GUOA 1SSYA 3HTFA 4ZPUA 5EBHA 1I6SA 1VEDA 1JEFA 1G0JA 1KNIA 1YAMA 5HNLA 226LA 3P68A 1ZYTA 1ZMYL 2YBMA 1UA6Y 1WGCA 1BB3A 234LA 4YENA 4E97A 5KXTA 3TXBA 4NY5A 1JKCA 1L01A 1L94A 4O34A 1K7TA 1L16A 1GFHA 4U3XB 3FADA 1G0KA 1LYHA 238LA 1LSNA 1K7UA 1L62A 1CU6A 3A8ZA 1TAYA 1REZA 1YANA 1KY1A 1OYUA 1L26A 1PS5A 2LB7A 3J4GA 1L00A 3T36A 2DQHY 4LDEA 2H5ZA 4H9EA 1LMPA 3GXKA 1L85A 2MEIA 5DL9A 2D4IA 3TXDA 1CV6A 1G1WA 4WLDA 1QS5A 1B5UA 3FI5A 1UCOA 1LHJA 2ZNWY 1YKYX 1LMCA 187LA 4TTDA 1BVXA 3RNXA 153LA 2ZYCA 1IWUA 1VDSA 108LA 1C62A 145LA 2LZ2A 1UIFA 1P2LA 1WQNA 190LA 4NHQA 2D4JA 1XGTC 1TEWA 1LWKA 1DYFA 3GXRA 4NWEA 3CT1A 2F47A 1QTZA 1UBZA 1WGTA 4NGVA 1L54A 1LWGA 4HTKA 4OWAA 2A7DA 2FBDA 212LA 197LA 4YM8A 1JSFA 4YXCA 147LA 4DC4A 4DD3A 1WQMA 4WP4A 1B7SA 4X3BA 1G0QA 2H9KA 1G0MA 5I54A 2HTXA 1RJCB 1QTKA 1L15A 4WLXA 5C6LA 1FDLY 1PZYA 1IR7A 4ARQB 3CDVA 4W51A 120LA 1G1VA 1P46A 2BLXA 3C83A 2HEAA 1IORA 1ALCA 3TXGA 1QTVA 4YX7C 3HH6A 4W96A 1QT4A 2NTHA 5FDJA 4LYOA 2HULA 161LA 4ETDA 1PQMA 3WULA 1L11A 1L47A 3W3EA 3AGHA 1QT3A 4I7KA 4Z3MA 2QB0B 1Z55A 2HEDA 3V2WA 1N4FA 1HFZA 2VB1A 5C6JA 1L18A 4UWUA 2OE7X 1SSWA 4WM5A 2ANVA 1CX7A 1L24A 1LJKA 248LA 4NSJA 1NDGC 1B2KA 2RH1A 2EKSC 1L90A 4H9AA 4II8A 135LA 1L38A 1C7PA 4LZTA 4BAFA 1GXV2 4TWSA 1LMOA 1L48A 114LA 1LMAA 1UC0A 5DM9A 4ZIXA 5C6IA 4PPOA 4DAJA 1CU5A 3T6UA 1LHMA 1A2YC 1DYBA 4I7JA 1L58A 3KAMA 1KY0A 3P65A 1GE4A 3CDOA 4AMLA 5F14A 130LA 1LZBA 2HEBA 3NY9A 1LAAA 1IR8A 4W94A 1LZDA 1GBSA 1FLYA 3L2XA 1T8AA 4PRUA 3W6FA 191LA 1D0KA 2ANXA 3A94A 1QSQA 1KIPC 1XJTA 1GF0A 1GFRA 1GFAA 1IOSA 2BQIA 9LYZA 129LA 3GUMA 1LYFA 1G0GA 4I7TA 1LI6A 1QSBA 231LA 2W1LA 4I7MA 1GB3A 259LA 194LA 2RSCA 2L78A 1CV1A 1QUHA 4RLMA 1RCMA 1GBXA 5KXZA 1YIKA 1JHLA 3A93A 1IY4A 2BQAA 3ZVQB 5HLLA 133LA 1QT5A 4DDAA 1D3JA 2YBJA 4M6DA 1WQOA 217LA 1YL1X 1JKDA 4GLVA 1C6CA 1L13A 3DN6A 1GB0A 4ARMA 4H1PA 1QT7A 1OVKA 3RZ4A 2B74A 1L43A 2EIZC 196LA 1L46A 2Z12A 1L28A 3AJNA 4IATA 169LA 123LA 218LA 3SP3A 257LA 233LA 1QS9A 3G3BB 2ZQ4A 1CKDA 1IR9A 1B7RA 232LA 3C81A 2BQGA 2YBLA 1LZ1A 1L32A 4B49A 1LI3A 1L21A 1BQLY 3B0IA 4G9SA 4GN3A 1YAPA 1HELA 1D6PA 1LSEA 3AB6A 1IWVA 1BB4A 1JTMA 1HHLA 3C7ZA 252LA 1C6KA 3WUMA 1WQPA 2Z18A 3N9EA 4Z41A 3CDQA 3A6BY 3C8SA 3CB7A 1L23A 4H8YA 4DD1A 1GBZA 5L9JA 2ZQ3A 1L56A 1LZ9A 1C45A 4ANRA 1IP4A 1C63A 3B72A 1F0WA 1EQ5A 127LA 4ARQA 3DN1A 2YSSC 1REXA 3AZ5A 1LYDA 2UVOA 4W53A 2CUUA 174LA 1B5ZA 2BQJA 219LA 1GF6A 2XBRA 4NGYA 5KJ9A 4YF2A 1LYSA 4LGKA 1E8LA 4DDBA 1QUGA 2HUKA 4B4JA 2BQFA 2C8OA 1CKGA 2YBHA 3C82A 4NGOA 1LSPA 2IHLA 2LYZA 4NEBA 1XGPC 1CV0A 4H9BA 3D9AC 3HT7A 1L20A 3WUAA 5DN4A 3AGIA 5HQ1A 1LYOA 1CV5A 1C10A 3NY8A 1CKHA 1C67A 192LA 1F6RA 1GF7A 3J6KA 1FKQA 3W6DA 1D9UA 4LDOA 5E9RA 1L96A 3FI7A 1GFVA 5HMJA 1GEVA 5APDA 142LA 1WQRA 1C6BA 3B6LA 1HFYA 1DYEA 178LA 1FLUA 229LA 2F32A 1T8FA 1KXXA 1XEJA 1QDTA 1PQOA 1QDRA 244LA 1KW7A 1BB6A 5LVIA 2HECA 1LHHA 4DYGA 152LA 3A6CY 3HU9A 5FCPA 1LJGA 1L37A 5KXXA 5IHGA 1QT6A 2OTYX 4GN4A 177LA 2EQLA 5LA5A 1L69A 4I7NA 1G7JC 1CUQA 3SB7A 1L30A 3HBEX 1LJEA 1L68A 3GULA 3AYQA 1IOCA 172LA 4R6CA 1TCYA 3RUNA 5FELA 4B1AA 1L0KA 4YOPA 3SB5A 1GDWA 4FJRA 5APCA 1QUDA 1G7LC 1L34A 189LA 2EPEA 5L3HA 4GCBA 221LA 4ML7A 3TXFA 132LA 4J1BA 1XGRC 1EL1A 1TDYA 3ZVQA 1ZVYB 1LSYA 1GEZA 160LA 3LZ2A 1LJ3A 1NHEA 2O7AA 1LYYA 1OUDA 1J1OY 2I6ZA 1OUGA 210LA 4EOFA 1LHLA 246LA 7LYZA 1YAOA 4GCEA 2N5ZA 183LA 243LA 1SQ2L 1LPIA 156LA 1L10A 1WTHA 2YBNA 206LA 258LA 2LYOA 2OE4X 6LZMA 3CDRA 1LTMA 214LA 1IC7Y 107LA 1OUJA 3A92A 3A67Y 1CJ8A 1LI2A 3HT6A 163LA 2BQNA 3OE9A 159LA 209LA 4B4EA 5B06A 1D3FA 3GUPA 1JJ1A 5LA8A 1P64A 1GBYA 1NBZC 2OEAX 1IWZA 1XEIA 1LOZA 1L59A 2MEFA 1GBWA 1C6GA 3EO5A 5IELA 3L64A 1FLQA 3WYHA 235LA 1L99A 4GCFA 1D2WA 227LA 4OW1A 1P3NA 211LA 4WM6A 1L49A 2C8PA 2G4PA 1LYEA 4H9FA 5KXPA 3NYAA 2B6WA 3D4SA 4J1AA 4ARMB 3A91A 1XGUC 4WG7A 1YKXX 200LA 2B5ZA 1LSGA 3A34A 4LFPA 4ET8A 1P37A 2B73A 3FE0A 141LA 1IWWA 1L79A 1LHIA 4KL7A 1CVKA 3GUIA 3DN8A 4I7QA 3SN6R 4NWHA 4CGEA 3HDFA 1L95A 4I7SA 1L35A 1YILA 1CNSA 6LYZA 4NHSA 5E4PA 4C3WA 4NGJA 201LA 1LPYA 4WM2A 1LJ4A 4RW2A 3HFMY 1IP5A 3G3XA 4RLNA 1K28A 2DQJY 2RAYX 4MSTA 4BADA 1CJ9A 1L66A 3G3WA 4IASA 1C6EA 1QTCA 4I7OA 1B7LA 1D9WA 3PBLA 4DD7A 2W1XA 1HNLA 3CSRA 1UIGA 1C6PA 3HUAA 1GWDA 1IP6A 4LYBA 1LYZA 4EPIA 2Y8PA 2B72A 3LN2A 4I7PA 2RBPA 3WMKA 3DMVA 1LLHA 1UIBA 4WL7A 1WVVA 5DLAA 4N9RA 1DYDA 1YROA 3ATNA 1IEEA 1UACY 5KXKA 2DQFC 5ILFA 3CT0A 1GD6A 2BQKA 1L12A 1L41A 3A3RX 2MECA 3HTDA 4ZEEA 1C6FA 2G4QA 4W55A 1FKVA 2A7FA 1C64A 1LZ8A 4DJHA 4OO9A 1WVUA 148LE 1LZNA 3OJPA 1L04A 1T6HA 1T6VL 1LSAA 162LA 2RAZX 1L88A 1IWYA 237LA 1GB2A 4NGZA 1UUZC 5LZMA 3IWRA 4TSCA 5LAGA 2RBRA 1IO5A 1LZ5A 3HT9A 3F8VA 2HU1A 3A90A 4GLAA 1V7TA 1EQEA 3ZEKA 3WU8A 1LMQA 1G07A 5HNCA 1LGWA 1QUTA 1L82A 4PJZA 4C5FA 3F9LA 3C80A 4XN6A 1OWYA 4GBRB 1JPOA 1L33A 1YKZX 4LYTA 1PQJA 1ZVHL 4MPIA 3PDSA 1GE1A 2MEEA 4G4HA 1LZYA 1OUHA 1DI3A 3WXTA 2LCBA 3DMZA 4LZMA 2G4NA 1L51A 2DBTA 4N8ZA 1C69A 1L14A 1IP2A 4QY9A 2Q0MX 5IDDA 4NGKA 1T3PA 2RBOA 4W57A 4NSIA 4XJDA 4XJBA 4OWEA 1HEMA 3K2RA 3RZEA 1HEWA 4CFOA 2ZNXY 5KXRA 1LCNA 1P6YA 4HJVA 2IGCA 2F4AA 4J0LA 5D5CA 3TXIA 1QUSA 1JTOL 3GUKA 4D9ZA 5APFA 4I0CA 3TXJA 3WPKA 1L25A 1LMNA 4XJFA 1B5WA 249LA 198LA 1HMKA 146LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DDC A;  1IP3 A;  1B5Z A;  1GF5 A;  4LYM A;  2DQA A;  2BQJ A;  2Z2E A;  1GB6 A;  1W6Z A;  1GE0 A;  3BKV A;  4PGJ B;  5FHW A;  1B7O A;  4GN5 C;  1GF6 A;  1B5Y A;  2XBR A;  4KXI A;  1HSW A;  4H91 A;  4GCC A;  1OQM A;  4XJG A;  4NGY A;  2BQH A;  5KJ9 A;  4YF2 A;  2F30 A;  2CGI A;  5B1G A;  4Z98 A;  1LYS A;  4ETB A;  4H90 A;  1A4V A;  1GB8 A;  2BQD A;  2LYM A;  4LGK A;  1LSF A;  1E8L A;  5K7O A;  4UWV A;  4DDB A;  1VAT A;  2CJL A;  1OUI A;  2X52 A;  1KIR C;  1EQ4 A;  1IC4 Y;  3IJU A;  4B4J A;  2Z38 A;  2BQF A;  2C8O A;  1CKG A;  2PC2 A;  2YBH A;  8LYZ A;  4WOA A;  4NGO A;  4LT2 A;  4ET9 A;  5J7C A;  5LIN A;  1QTE A;  1LSP A;  2IHL A;  2LYZ A;  4NEB A;  1XGP C;  2HEE A;  4H9B A;  4NHP A;  1G7I C;  3N9C A;  1OUA A;  3D9A C;  1JJ3 A;  1H6M A;  3WUA A;  1HEQ A;  5DN4 A;  3A96 A;  3AGI A;  5HQ1 A;  2YBI A;  1CKF A;  4LYZ A;  1LYO A;  1CJ6 A;  1B5V A;  1NWG A;  1FLW A;  3OK0 A;  2DQI Y;  1C10 A;  1AM7 A;  4RDS A;  1FN5 A;  1LJF A;  1CKH A;  2BQM A;  1BWJ A;  4G4B A;  1F6R A;  3TXH A;  3RT5 X;  153L A;  1F6S A;  1GFE A;  5LAF A;  1B7M A;  1KXY A;  7WGA A;  4WL6 A;  5LVK A;  1JIY A;  1GF7 A;  3J6K A;  1BVK C;  1I56 A;  1P9G A;  1VDT A;  1FKQ A;  2FYC A;  5EBH A;  3W6D A;  1D9U A;  1JEF A;  1VED A;  2W1Y A;  1LZS A;  5E9R A;  5KXW A;  4ETA A;  5D5F A;  1YAM A;  1XGQ C;  1GFV A;  3FI7 A;  5HMJ A;  5HNL A;  1OUF A;  1GEV A;  5APD A;  2NWD X;  3P68 A;  1WQR A;  4KPM A;  3ATO A;  5I5Q A;  1AT6 A;  1ZMY L;  3B6L A;  2YBM A;  1UA6 Y;  1WGC A;  1BB7 A;  2F4G A;  1BB3 A;  4BS7 A;  3CSQ A;  4YEN A;  1HFY A;  1IOT A;  5A3E A;  5KXT A;  3TXB A;  5FST A;  1FLU A;  4NY5 A;  3TMU A;  1JKC A;  3F6Z A;  4B4I A;  1GXX A;  1H87 A;  4O34 A;  1K7T A;  2YDG A;  1KXX A;  4H9I A;  1XEJ A;  1QDT A;  3P64 A;  1O23 A;  1RFP A;  4YEO A;  3QY4 A;  3QNG A;  3W6B A;  1QDR A;  2CDS A;  3LHM A;  1GFH A;  1IVM A;  4U3X B;  2CWI A;  4BAP A;  1BB6 A;  5LVI A;  2HEC A;  1LHH A;  4DYG A;  1LSN A;  1K7U A;  9WGA A;  1DZB X;  4I8S A;  1AZF A;  1Q9B A;  2ZIJ A;  3A6C Y;  5B59 A;  2MEA A;  5F16 A;  3A8Z A;  1JIS A;  4LYC A;  5FCP A;  3W6A A;  1LJG A;  4OOO A;  1HF4 A;  3HBH A;  5IHG A;  5KXX A;  1TAY A;  1REZ A;  1YAN A;  1GB9 A;  1PS5 A;  4E3U A;  1HEP A;  4GN4 A;  5I4X A;  5KKJ A;  2LB7 A;  3EMS A;  1QSA A;  2EQL A;  3J4G A;  3T36 A;  3WXU A;  2DQH Y;  1GF9 A;  5LA5 A;  2H5Z A;  4H9E A;  1GF8 A;  1NF5 A;  1GPQ C;  1LMP A;  4NSH A;  3GXK A;  1G7J C;  4FDY A;  5LIO A;  3CSZ A;  5B05 A;  3HBE X;  2MEI A;  1LJE A;  1GFT A;  4DD0 A;  3AYQ A;  5M1Y A;  1IOC A;  1J1X Y;  2D4I A;  5DL9 A;  4R6C A;  1TCY A;  4XYY A;  3TXD A;  3WVX A;  5FEL A;  4B1A A;  4WLD A;  4YOP A;  4G49 A;  5A3Z A;  3RU5 A;  1B5U A;  1WQQ A;  1GDW A;  4FJR A;  5APC A;  1LHK A;  1UCO A;  1LHJ A;  2ZNW Y;  1G7L C;  1YKY X;  3B0O A;  1LMC A;  2EPE A;  4NIJ A;  4LFX A;  5L3H A;  1B7Q A;  4LT3 A;  4TTD A;  1BVX A;  3G3A B;  3RNX A;  2ZYC A;  1IWU A;  1QSW A;  1VDS A;  2XBS A;  4GCB A;  4Z46 A;  4HJZ A;  1IX0 A;  4ML7 A;  3TXF A;  1JIT A;  2LZ2 A;  132L A;  4J1B A;  1XGR C;  1UIF A;  1MEL L;  1EL1 A;  1TDY A;  3ZVQ A;  1ZVY B;  3QE8 A;  5LYZ A;  1LSY A;  1WQN A;  1GEZ A;  4NHQ A;  3LZ2 A;  5LVJ A;  2D4J A;  1BB5 A;  1XGT C;  1TEW A;  1LJ3 A;  1NHE A;  2BLY A;  1LJN A;  4CHX A;  3M18 B;  3W6C A;  1ULM A;  1LYY A;  1OUD A;  2BQB A;  4WG1 A;  3GXR A;  1JSE A;  2H9J A;  4NWE A;  3CT1 A;  1MLC E;  3A95 A;  5B1F A;  1XEK A;  1J1O Y;  1LJH A;  2I6Z A;  5KXM A;  1UBZ A;  1LSZ A;  1NQI A;  5I4W A;  1OUG A;  1DPX A;  1WGT A;  4WLY A;  4NGV A;  4EOF A;  1REY A;  4NG1 A;  1LHL A;  5L3I A;  7LYZ A;  4HTK A;  4PHI A;  1YAO A;  4OWA A;  2A7D A;  2FBD A;  1HML A;  5FEK A;  1LZE A;  4GCE A;  4YM8 A;  2GV0 A;  1B5X A;  1I1Z A;  2N5Z A;  2XJW A;  1JSF A;  1JKB A;  2LHM A;  5LVH A;  2MEH A;  4DC4 A;  4DD3 A;  5F9X A;  1SQ2 L;  2BQE A;  2D6B A;  1LPI A;  1ULK A;  1WQM A;  4WP4 A;  2YBN A;  1UHA A;  2ZIL A;  5LXW A;  1HSX A;  3WL2 A;  2LYO A;  1B7S A;  4WLT A;  4X3B A;  6LYT A;  2H9K A;  5I54 A;  2XTH A;  1LTM A;  2HTX A;  1RJC B;  1QTK A;  1IWT A;  1IC7 Y;  2D4K A;  4TUN A;  4WLX A;  5C6L A;  1FDL Y;  1OUJ A;  1PZY A;  3A92 A;  1IR7 A;  3A67 Y;  4NHT A;  1CJ8 A;  4H94 A;  1LZA A;  2BQN A;  1BHZ A;  1AKI A;  4NHI A;  1W08 A;  4B4E A;  2BLX A;  5B06 A;  1JJ0 A;  207L A;  2HEA A;  2Z39 A;  1IOR A;  1GFK A;  1JTP L;  1UID A;  1GB7 A;  1ALC A;  1JJ1 A;  1JKA A;  3TXG A;  4DD2 A;  4AML A;  5LA8 A;  1B0D A;  4H9C A;  4NGI A;  3CT5 A;  4W96 A;  1GBY A;  2HUB A;  5FDJ A;  1NBZ C;  4LYO A;  2CWG A;  1IWZ A;  1XEI A;  5AMY A;  1LZR A;  2F2N A;  4ETD A;  1DI4 A;  1LOZ A;  2MEF A;  1IP1 A;  3WUL A;  1GBW A;  3EO5 A;  5IEL A;  1FLQ A;  3WYH A;  4HV1 A;  2MED A;  3W3E A;  4H8Z A;  3AGH A;  1GAZ A;  4NFV A;  5KKI A;  3AZ7 A;  4B0D A;  2DQC Y;  4GCF A;  4TX7 A;  4Z3M A;  1GE3 A;  1GAY A;  4GCD A;  1Z55 A;  2HED A;  4LT1 A;  1HEN A;  2X0A A;  1N4F A;  4OW1 A;  1HFZ A;  1SLY A;  2VB1 A;  1LSM A;  4H9H A;  4WM6 A;  5C6J A;  4WM3 A;  2C8P A;  2G4P A;  4UWU A;  1KIQ C;  4H9F A;  2Z2F A;  4TSB A;  2DKV A;  5KXP A;  2DQE Y;  4WM5 A;  1UIC A;  1LJK A;  4J1A A;  1NDG C;  1B2K A;  4NSJ A;  5KXN A;  2I25 L;  2YVB A;  4OWB A;  1GHL A;  4HJY A;  2BQC A;  4WO6 A;  1GF4 A;  4AXT A;  4WMG A;  2EKS C;  4H9A A;  1RI8 B;  1HFX A;  208L A;  4II8 A;  3WH1 A;  135L A;  4NSG A;  1D0L A;  3A91 A;  1C7P A;  2ZWB A;  4G4C A;  1XGU C;  3IJV A;  1V7S A;  4WG7 A;  1P9Z A;  4LZT A;  4BAF A;  1YKX X;  1GXV 2;  1NMM A;  2ZIK A;  1GB5 A;  2B5Z A;  1LSG A;  1LKR A;  4H93 A;  3A34 A;  4IJ4 A;  4LFP A;  4TWS A;  5JEN B;  1LMO A;  5LYT A;  2BAA A;  4ET8 A;  1LMA A;  1UC0 A;  1UIE A;  5DM9 A;  3W6E A;  3FE0 A;  4ZIX A;  1IWW A;  1HC0 A;  1P2C C;  1LHI A;  4OOT A;  4KL7 A;  5C6I A;  4PPO A;  3T6U A;  1LHM A;  3MGW A;  1A2Y C;  1KXW A;  4OWH A;  4N0J A;  1IWX A;  1ZV5 L;  1RE2 A;  4NWH A;  4XJH A;  3VWO A;  2W1M A;  4R0F A;  1GDX A;  4CGE A;  3KAM A;  2FBB A;  3P65 A;  4N5R A;  1BGI A;  1GE4 A;  4ZFP A;  2I26 L;  3LYM A;  1YIL A;  1CNS A;  2FYD A;  1IY3 A;  4NHS A;  5E4P A;  6LYZ A;  4YEM A;  5F14 A;  4C3W A;  4NGJ A;  1JUG A;  3B0K A;  5KXL A;  1OUC A;  1LZB A;  2HEB A;  2WAR A;  1B7P A;  3M3U A;  4UWN A;  4WM2 A;  1LAA A;  1LJ4 A;  2Z37 A;  4RW2 A;  1GFJ A;  1QQY A;  1IR8 A;  3HFM Y;  1IP5 A;  4W94 A;  3WPJ A;  1LZD A;  1GBS A;  1FLY A;  4RLN A;  4PRU A;  1GFU A;  2DQJ Y;  1D0K A;  1G7M C;  3W6F A;  4MST A;  4HPI A;  3A94 A;  4WM1 A;  1KIP C;  4BAD A;  1GF0 A;  4ETC A;  3AZ6 A;  1HER A;  3D3D A;  4H8X A;  1CJ9 A;  4HV2 A;  1GFR A;  1YAQ A;  4IAS A;  4DT3 A;  4N1C C;  5ILC A;  1B7L A;  1GFA A;  1IOS A;  2BQI A;  1DQJ C;  4DD7 A;  9LYZ A;  2W1X A;  1HNL A;  3CSR A;  4ETE A;  1UIG A;  5T3F A;  3WW5 A;  1GWD A;  4KT3 A;  1C46 A;  1IP6 A;  4OWC A;  3ULR A;  1XSF A;  2W1L A;  1LJJ A;  3WW6 A;  4LYB A;  1GB3 A;  1LYZ A;  3EXD A;  2Y8P A;  3LN2 A;  4L41 A;  3A3Q A;  5KXY A;  2Z19 A;  3WVY A;  5I4Y A;  3WMK A;  194L A;  1LZ4 A;  2RSC A;  5KY1 A;  3AW6 A;  1VFB C;  1UIB A;  4WL7 A;  1WVV A;  1J1P Y;  3E3D A;  3HBD A;  5DLA A;  1XFP L;  4N9R A;  1YRO A;  1DPW A;  1DXJ A;  1CJ7 A;  3AZ4 A;  4RLM A;  5LYM A;  4QEQ A;  1RCM A;  3ATN A;  1GBX A;  1IEE A;  1B9O A;  1D0M A;  1UAC Y;  3BKH A;  4XEN A;  5KXZ A;  5KXK A;  1YIK A;  1JHL A;  1GE2 A;  1WTM A;  2DQF C;  3A93 A;  3CT0 A;  5ILF A;  134L A;  1IY4 A;  1LJI A;  1VDQ A;  4N1E I;  2BQA A;  1UIA A;  4RW1 A;  1GD6 A;  3ZVQ B;  2BQK A;  1NKH A;  133L A;  5HLL A;  4DDA A;  1DKK A;  3A3R X;  4HTN A;  2MEC A;  3N9A A;  2YBJ A;  3TMW A;  2BQO A;  4ZEE A;  4M6D A;  5DN5 A;  3AGG G;  1WQO A;  2G4Q A;  1YL1 X;  1JKD A;  1FKV A;  4GLV A;  4P2E A;  2A7F A;  1GB0 A;  1LZ8 A;  4LT0 A;  4H1P A;  1WVU A;  3RZ4 A;  2EIZ C;  4M4O A;  1LZN A;  3OJP A;  4WO9 A;  2WGC A;  1IOQ A;  2Z12 A;  3WUN A;  3CQL A;  1F10 A;  1T6V L;  3AJN A;  1LSA A;  4HP0 A;  1HEV A;  1OUB A;  4IAT A;  2DQD Y;  4DWX A;  1OUE A;  5F81 A;  1IWY A;  1GB2 A;  1IC5 Y;  4NGZ A;  1UUZ C;  3IWR A;  4TSC A;  3SP3 A;  4AGA A;  5LAG A;  1C43 A;  4XAD A;  1IO5 A;  1JTT L;  1LZ5 A;  2BPU A;  5APE A;  5HMV A;  5KXO A;  2HU1 A;  4A7D A;  3A90 A;  3G3B B;  4GLA A;  4HTQ A;  1V7T A;  1EQE A;  2ZQ4 A;  4NGW A;  1LSB A;  3ZEK A;  1CKD A;  3K3T A;  1IR9 A;  3WU8 A;  3LYT A;  1B7R A;  2D91 A;  1LMQ A;  1NBY C;  4DD9 A;  2X3T A;  3P4Z A;  4PRQ A;  2BQG A;  1BWH A;  2YBL A;  5HNC A;  1QUT A;  1WTN A;  3RW8 A;  4C5F A;  1GBO A;  1DKJ A;  4XN6 A;  5LVG A;  1LZ1 A;  2HU3 A;  5F9U A;  3TXE A;  4B49 A;  1TBY A;  1JPO A;  4NG8 A;  3B0I A;  1BQL Y;  2AUB A;  4G9S A;  4GN3 A;  1YAP A;  1ULN A;  1C08 C;  1LKS A;  1YKZ X;  3WU7 A;  1K7V A;  1GFG A;  2MEG A;  4LYT A;  1ZVH L;  1HEL A;  4MPI A;  5KXS A;  3LYO A;  1GE1 A;  1JWR A;  4MR1 A;  2MEE A;  2DQG Y;  4G4H A;  2LZT A;  154L A;  1WKX A;  1D6P A;  1LSE A;  1VDP A;  3AB6 A;  1VAU A;  1IWV A;  1D6Q A;  1LZY A;  1OUH A;  1DI3 A;  2ZYP A;  1BB4 A;  3TXK A;  3WXT A;  193L A;  1HEO A;  1HHL A;  1LZG A;  1UIH A;  3EBA B;  3WUM A;  1LZT A;  1WQP A;  2G4N A;  2Z18 A;  5B07 A;  3N9E A;  1FBI X;  4QGZ A;  1GF3 A;  1DI5 A;  4Z41 A;  4EMN A;  2DBT A;  4PJ2 C;  5I53 A;  1NDM C;  4N8Z A;  1CKC A;  1INU A;  3A6B Y;  1IP2 A;  4NGL A;  3CB7 A;  4QDN A;  4QY9 A;  2Q0M X;  5IDD A;  4NGK A;  1T3P A;  4H92 A;  4J7V A;  4H8Y A;  4HSF A;  4DD1 A;  1G7H C;  4NSI A;  1GBZ A;  1IP7 A;  4OWE A;  4XJD A;  4XJB A;  1B7N A;  1HEM A;  5L9J A;  1BWI A;  2ZQ3 A;  1HEW A;  3TMV A;  1LSD A;  1LZC A;  1LZ9 A;  4CFO A;  2ZNX Y;  5II3 A;  1C45 A;  1AT5 A;  2MEB A;  4HPE A;  4CJ2 A;  4MCK A;  5KXR A;  1LCN A;  4ANR A;  4HJV A;  1IP4 A;  2BQL A;  2F4A A;  4XJI A;  3B72 A;  3WU9 A;  1I20 A;  4J0L A;  2HEF A;  5D5C A;  3AW7 A;  3TXI A;  1F0W A;  1QUS A;  1EQ5 A;  4WM4 A;  1YL0 X;  1JTO L;  3P66 A;  1REM A;  4D9Z A;  1OP9 B;  1IIZ A;  2YSS C;  5APF A;  3LYZ A;  3LZT A;  4I0C A;  3TXJ A;  1YQV Y;  3WPK A;  1LMN A;  1REX A;  3AZ5 A;  1LSC A;  4XJF A;  3WPL A;  1B5W A;  1LZ6 A;  1LMT A;  4CFP A;  1QIO A;  2UVO A;  1HMK A;  3TMX A;  2IFF Y; 
#chains in the Genus database with same CATH topology
 3TO7 A;  213L A;  4DDC A;  1W6Z A;  4PGJ B;  2GKV A;  4KXI A;  4H91 A;  1OQM A;  1L64 A;  3C8Q A;  2ARP F;  1C61 A;  2F30 A;  1ZWN A;  4H90 A;  1GB8 A;  2BQD A;  2LYM A;  2ENZ A;  4UWV A;  1VAT A;  251L A;  2Z38 A;  2PC2 A;  4WOA A;  4I7L A;  4LT2 A;  4ET9 A;  5J7C A;  3OXG A;  1QTE A;  2RBN A;  1L57 A;  1OUA A;  1H6M A;  1FYB A;  4EXM A;  1BUS A;  4LYZ A;  151L A;  3OK0 A;  2DQI Y;  3FSY A;  1LJF A;  164L A;  1BWJ A;  3TXH A;  3RT5 X;  4E1R A;  1JIY A;  1I56 A;  1P9G A;  1XBT A;  2W1Y A;  1LZS A;  138L A;  4ETA A;  5D5F A;  4EKS A;  186L A;  2NWD X;  4KPM A;  5I5Q A;  2ODD A;  3SBA A;  1BB7 A;  2F4G A;  4BS7 A;  1L80 A;  3CSQ A;  1Z7K B;  1UVF A;  1C6L A;  5FST A;  3F6Z A;  1NHB A;  1GXX A;  245L A;  3SGB I;  2B6T A;  2QQ0 A;  2YDG A;  1L91 A;  3P64 A;  4YEO A;  5FUY A;  3W6B A;  1IVM A;  2CWI A;  4BAP A;  242L A;  3QAK A;  1DZB X;  2KMP A;  1Q9B A;  2ZIJ A;  2MEA A;  4LYC A;  2XRC A;  4OOO A;  253L A;  1GB9 A;  2ORV A;  115L A;  5J8C A;  4E3U A;  1TBO A;  5I4X A;  1L75 A;  3EMS A;  1QSA A;  3UFF A;  3DNA A;  1GF8 A;  1C6A A;  4FDY A;  5LIO A;  3CSZ A;  2A4T A;  1L86 A;  113L A;  4W52 A;  1GFT A;  5M1Y A;  2LZM A;  1J1X Y;  1L52 A;  1L89 A;  3VE5 A;  4G49 A;  5A3Z A;  1WQQ A;  1L63 A;  119L A;  1LHK A;  4S0W A;  4LFX A;  1B7Q A;  5I14 A;  3G3A B;  1PQK A;  1QSW A;  2XBS A;  4Z46 A;  1L05 A;  4HJZ A;  1JIT A;  1KS3 A;  3QE8 A;  5LYZ A;  1C68 A;  1UUC A;  2BLY A;  4YXA C;  1LJN A;  140L A;  4CHX A;  3M18 B;  3W6C A;  2BQB A;  4WG1 A;  1JSE A;  2H9J A;  1MLC E;  3A95 A;  3QAH A;  1LJH A;  5KXM A;  3TOA A;  1L22 A;  1C6H A;  1REY A;  4HGU A;  1CX6 A;  2V53 A;  4PHI A;  1D3M A;  1DYC A;  2OD1 A;  5FEK A;  128L A;  3PDN A;  1LZE A;  1SWY A;  2XJW A;  5LVH A;  2LHM A;  1TGS I;  3HTG A;  1L87 A;  2MEH A;  1SGY I;  5F9X A;  1PQI A;  1L44 A;  2BQE A;  2D6B A;  1ULK A;  224L A;  1UHA A;  1R0R I;  5LXW A;  3DN0 A;  3WL2 A;  4WLT A;  4AQN A;  3SGQ I;  1L45 A;  2XTH A;  170L A;  1IWT A;  1OV5 A;  1L83 A;  3E59 A;  4H94 A;  1LZA A;  4NHI A;  1BHZ A;  1AKI A;  4EKQ A;  2Z39 A;  1JTP L;  1GFK A;  4EKP A;  1L29 A;  1JKA A;  4DD2 A;  1SGE I;  4NGI A;  3CT5 A;  4DKL A;  2CWG A;  5AMY A;  1LZR A;  1DI4 A;  1LYJ A;  1L70 A;  2MED A;  4HV1 A;  4H8Z A;  1GAZ A;  4NFV A;  5KKI A;  2DQC Y;  1LW9 A;  4TX7 A;  1GE3 A;  1SLY A;  1LSM A;  110L A;  4H9H A;  4WM3 A;  1KIQ C;  1L74 A;  2Z2F A;  4TSB A;  2DKV A;  2DQE Y;  3TOB A;  1UIC A;  228L A;  5KXN A;  2I25 L;  4OWB A;  4HJY A;  2BQC A;  4WO6 A;  1GF4 A;  4AXT A;  1P36 A;  3WH1 A;  118L A;  2V1C A;  2ZWB A;  1P9Z A;  3UEJ A;  4LDL A;  2ZIK A;  1GB5 A;  4H93 A;  1LKR A;  1SX2 A;  4IJ4 A;  5LYT A;  2BAA A;  2JYY A;  3VDP A;  1UIE A;  3UON A;  1C65 A;  2M5X A;  3CDT A;  1HC0 A;  1OWZ A;  1Y1C A;  1P7S A;  2XQO A;  3MGW A;  1KXW A;  3VWO A;  1ZV5 L;  4XJH A;  2Z6B A;  4EJ4 A;  1GDX A;  4N5R A;  1QTD A;  3KY9 A;  4ZFP A;  3OXL A;  1IY3 A;  5KXL A;  1JUG A;  3M3U A;  1B7P A;  3UGI A;  262L A;  1L81 A;  2Z37 A;  1GFJ A;  3WPJ A;  3OE6 A;  225L A;  1KBE A;  1G7M C;  1QTH A;  4WM1 A;  2ENN A;  3AZ6 A;  4H8X A;  5HQ8 A;  180L A;  1SGN I;  1T8G A;  5FUV A;  5ILC A;  1DQJ C;  1CU3 A;  4ETE A;  2J87 A;  5T3F A;  3WW5 A;  3OL0 A;  1KMA A;  4KT3 A;  1C46 A;  4OWC A;  3ULR A;  1XSF A;  220L A;  1V1I A;  1LJJ A;  3EXD A;  4L41 A;  5KXY A;  1JQU A;  3WVY A;  5I4Y A;  1LZ4 A;  139L A;  2LEO A;  3UOE A;  1SWZ A;  1J1P Y;  3E3D A;  1XFP L;  3GUJ A;  3AZ4 A;  1DPW A;  1DXJ A;  2OU9 A;  1L76 A;  1P56 A;  3DKE X;  1B9O A;  1D0M A;  3BKH A;  4XEN A;  2RB1 X;  239L A;  144L A;  1LJI A;  2OE9 X;  1UIA A;  254L A;  1NKH A;  216L A;  3HT8 A;  3HH5 A;  2SGF I;  1DKK A;  3EML A;  2B8T A;  3HWL A;  2A20 A;  3GUN A;  3JR6 A;  5DN5 A;  4PK0 A;  3AGG G;  3OXF A;  2OU0 X;  222L A;  4P2E A;  1C6J A;  1QUO A;  1MJA A;  4M4O A;  2WGC A;  1IOQ A;  2B7X A;  1F10 A;  1OUB A;  1L42 A;  143L A;  4EPF A;  3C7W A;  182L A;  4ARP A;  1C43 A;  4XAD A;  2BPU A;  1JTT L;  205L A;  4HTQ A;  1LSB A;  2QQD A;  3K3T A;  1XA6 A;  2D91 A;  1NBY C;  4DD9 A;  2X3T A;  1ZUR A;  4PRQ A;  1XEP A;  1BWH A;  3DMX A;  3RW8 A;  2B70 A;  5LVG A;  1L72 A;  5HI7 A;  1TBY A;  4NG8 A;  1ULN A;  1LYI A;  1LKS A;  2KMR A;  1K7V A;  2RC4 A;  2B6Y A;  5KXS A;  1C6I A;  1TOT A;  1JWR A;  3DN3 A;  4MR1 A;  1WKX A;  2B6Z A;  1DYA A;  4E1P A;  1D6Q A;  3TXK A;  2ZYP A;  1UIH A;  1SGD I;  1TBQ R;  122L A;  2NTG A;  111L A;  1FBI X;  150L A;  1DI5 A;  2PQ8 A;  5I53 A;  1CKC A;  1INU A;  2F3C I;  4QDN A;  4H92 A;  4J7V A;  4HSF A;  1G7H C;  3TMV A;  1LSD A;  1LZC A;  2MEB A;  1AT5 A;  4HPE A;  4MCK A;  4I7R A;  2BQL A;  1KW5 A;  4DQ5 A;  1I20 A;  1PQD A;  3AW7 A;  1L40 A;  3SB9 A;  4DQJ A;  1YL0 X;  1CGI I;  3LYZ A;  1LMT A;  4CFP A;  1QIO A;  1GHL A;  1PTQ A;  4GRV A;  2GKR I;  1IP3 A;  4LYM A;  112L A;  3BKV A;  5FHW A;  2O4W A;  4GN5 C;  3QWP A;  4Z98 A;  1G0P A;  2N71 A;  1OUI A;  2X52 A;  1IC4 Y;  1PCE A;  1NUB A;  1CUP A;  1D2Y A;  1C6N A;  1G7I C;  3N9C A;  1JJ3 A;  1HEQ A;  2KMO A;  1MJ9 A;  2YBI A;  158L A;  1CJ6 A;  1NWG A;  1L08 A;  256L A;  1AM7 A;  3R5D A;  4RDS A;  1FN5 A;  7WGA A;  1F6S A;  5LAF A;  5LVK A;  1BVK C;  1G0L A;  1V1H A;  165L A;  1VDT A;  2FYC A;  137L A;  5KXW A;  1XGQ C;  1FY7 A;  1OUF A;  2JA1 A;  3ATO A;  1AT6 A;  1L06 A;  1Y1B A;  5EX0 A;  1L17 A;  1IOT A;  2ELI A;  5A3E A;  1L55 A;  3TMU A;  3HH3 A;  4B4I A;  1H87 A;  1P5C A;  1L92 A;  4H9I A;  1O23 A;  1RFP A;  4ARJ A;  3QY4 A;  3QNG A;  2CDS A;  3LHM A;  3HUK A;  3OVO A;  3LZM A;  9WGA A;  4I8S A;  1AZF A;  5B59 A;  5F16 A;  1JIS A;  3W6A A;  1HF4 A;  3HBH A;  1TBR R;  1L50 A;  1HEP A;  5KKJ A;  5EX3 A;  3WXU A;  1GF9 A;  4FKD A;  1NF5 A;  1GPQ C;  4NSH A;  1L27 A;  3V2Y A;  5B05 A;  5CCL A;  4DD0 A;  3WVX A;  1L31 A;  4W54 A;  4XYY A;  2VRW B;  1C6T A;  3C7Y A;  1C6D A;  3RU5 A;  255L A;  3B0O A;  4NIJ A;  1DS2 I;  1QT8 A;  4LT3 A;  3R5A A;  2RB2 X;  261L A;  1IX0 A;  247L A;  3TJQ A;  1R79 A;  1MEL L;  5LVJ A;  1BB5 A;  3HH4 A;  1ULM A;  3OE0 A;  175L A;  5B1F A;  1XEK A;  1LSZ A;  1NQI A;  5I4W A;  260L A;  1DPX A;  4WLY A;  4NG1 A;  1W4R A;  5L3I A;  1OV7 A;  1HML A;  2GV0 A;  1B5X A;  1I1Z A;  1JKB A;  103L A;  1X4S A;  7LZM A;  2OZU A;  166L A;  1C6Q A;  4GI3 C;  2ZIL A;  1HSX A;  5J8F A;  2Q9D A;  1L84 A;  6LYT A;  2W0T A;  2D4K A;  4TUN A;  1L65 A;  4IAP A;  1CU2 A;  4NHT A;  1D3N A;  1L73 A;  199L A;  1OVJ A;  1W08 A;  1CT0 I;  1JJ0 A;  207L A;  3RU0 A;  1UID A;  1GB7 A;  1TLA A;  1B0D A;  4H9C A;  2HUB A;  1L09 A;  2F2N A;  1IP1 A;  1OMT A;  3AZ7 A;  4B0D A;  3TO6 A;  1GAY A;  4GCD A;  1JTN A;  4LT1 A;  1HEN A;  2X0A A;  167L A;  2B75 A;  1L67 A;  4DQ7 A;  250L A;  2OTZ X;  185L A;  1UVG A;  2YVB A;  4WMG A;  1RI8 B;  1HFX A;  208L A;  4NSG A;  1D0L A;  2QAR C;  1P2R A;  4G4C A;  195L A;  3IJV A;  126L A;  1V7S A;  5E3Q A;  1NMM A;  5JEN B;  1CU0 A;  2RBS A;  4W59 A;  3W6E A;  1P2C C;  171L A;  4OOT A;  1W3S A;  4OWH A;  157L A;  4N0J A;  1IWX A;  1RE2 A;  2W1M A;  4R0F A;  2CJS C;  1L53 A;  2FBB A;  1L02 A;  102L A;  1BGI A;  2I26 L;  3LYM A;  2FYD A;  104L A;  4YEM A;  2OVO A;  2LC9 A;  3B0K A;  131L A;  1OUC A;  2WAR A;  4UWN A;  181L A;  1L77 A;  1C66 A;  3ODU A;  1QQY A;  2RB0 X;  1L07 A;  1GFU A;  240L A;  1CHO I;  1CV4 A;  4HPI A;  3D00 A;  4ETC A;  215L A;  1HER A;  3D3D A;  4HV2 A;  1YAQ A;  3HDE A;  3HTB A;  4DT3 A;  4N1C C;  2F2Q A;  2Y0M A;  1LGX A;  1HDL A;  230L A;  1XJU A;  1L61 A;  1M8C A;  3WW6 A;  241L A;  3OE8 A;  4W56 A;  3A3Q A;  2Z19 A;  5KY1 A;  3AW6 A;  1VFB C;  2O79 A;  3FA0 A;  3HUQ A;  5CCM A;  3HBD A;  2GKT I;  1G06 A;  1CJ7 A;  5LYM A;  1LR9 A;  4QEQ A;  1L19 A;  1B6I A;  4ARL A;  109L A;  1GE2 A;  1X74 A;  188L A;  1WTM A;  134L A;  1VDQ A;  4N1E I;  4RW1 A;  3B4V C;  3FC3 A;  223L A;  4HTN A;  1L60 A;  3N9A A;  3TMW A;  2BQO A;  155L A;  2JW6 A;  4K5Y A;  1T97 A;  1OVH A;  4LT0 A;  236L A;  3SB6 A;  2ROW A;  3BJI A;  1DYG A;  1L93 A;  4WO9 A;  3WUN A;  125L A;  3CQL A;  4B6D A;  4HP0 A;  1HEV A;  2DQD Y;  4DWX A;  1OUE A;  5F81 A;  2GVI A;  1IC5 Y;  2NU1 I;  1LGU A;  4AGA A;  176L A;  1L97 A;  5KXO A;  5HMV A;  5APE A;  4A7D A;  1EPY A;  4NGW A;  3LYT A;  2B6X A;  3SBB C;  3P4Z A;  184L A;  1WTN A;  1GBO A;  1DKJ A;  1L0J A;  2HU3 A;  5F9U A;  3TXE A;  1L39 A;  2AUB A;  3VW7 A;  1C08 C;  1CTW A;  3WU7 A;  1GFG A;  2MEG A;  3LYO A;  3G3V A;  2DQG Y;  3HU8 A;  4SGB I;  149L A;  2LZT A;  154L A;  1VDP A;  1VAU A;  1AN1 I;  2HUM A;  193L A;  1HEO A;  1L36 A;  1LZG A;  1L03 A;  3EBA B;  1LZT A;  5B07 A;  168L A;  4QGZ A;  1GF3 A;  3C8R A;  4EMN A;  4PJ2 C;  173L A;  1NDM C;  2DIP A;  4NGL A;  1QTB A;  1SGP I;  4OVO A;  1IP7 A;  1B7N A;  3DN4 A;  2OU8 A;  1BWI A;  4W58 A;  1C6M A;  1YTP A;  5II3 A;  4L9M A;  4CJ2 A;  1CE3 A;  2QQE A;  4XJI A;  3WU9 A;  2HEF A;  2OU2 A;  4WM4 A;  3P66 A;  1REM A;  1OP9 B;  1IIZ A;  1LYG A;  3LZT A;  1YQV Y;  1HJA I;  1LSC A;  3WPL A;  3SB8 A;  1LZ6 A;  3TMX A;  2IFF Y;  1GF5 A;  2DQA A;  2Z2E A;  1GB6 A;  2RBQ A;  1GE0 A;  5E3P A;  1B7O A;  1CSO I;  1B5Y A;  1HSW A;  4GCC A;  1L98 A;  4XJG A;  2BQH A;  4EKR A;  2CGI A;  5B1G A;  4ETB A;  2LUY A;  1A4V A;  1LSF A;  5K7O A;  1MT1 A;  2CJL A;  1KIR C;  1EQ4 A;  3IJU A;  8LYZ A;  2Q9E A;  5LIN A;  2YQP A;  2FNF X;  1CV3 A;  1TIH A;  1C60 A;  2HEE A;  4NHP A;  1LR7 A;  3DN2 A;  2SGP I;  3A96 A;  1CKF A;  2WCY A;  1B5V A;  1FLW A;  2CWF A;  2BQM A;  4G4B A;  1GFE A;  1B7M A;  1KXY A;  1L71 A;  1SX7 A;  4WL6 A;  3GUO A;  1SSY A;  3HTF A;  4ZPU A;  5EBH A;  1I6S A;  1VED A;  1JEF A;  1G0J A;  1KNI A;  1YAM A;  1MJB A;  5HNL A;  2V1C C;  226L A;  3P68 A;  1ZYT A;  1ZMY L;  2YBM A;  1UA6 Y;  1WGC A;  1TBN A;  1FAR A;  1BB3 A;  234L A;  4YEN A;  4E97 A;  5KXT A;  3TXB A;  4NY5 A;  2NU0 I;  1JKC A;  1L01 A;  1L94 A;  4O34 A;  1K7T A;  1L16 A;  1GFH A;  4U3X B;  3FAD A;  1G0K A;  1LYH A;  238L A;  1LSN A;  1K7U A;  1L62 A;  1CU6 A;  3A8Z A;  1CGJ I;  1TAY A;  1REZ A;  1YAN A;  1KY1 A;  1OYU A;  1L26 A;  1PS5 A;  2LB7 A;  3J4G A;  1L00 A;  3T36 A;  2DQH Y;  4LDE A;  2N17 A;  2H5Z A;  4H9E A;  1LMP A;  3GXK A;  1OVO A;  1L85 A;  2MEI A;  5DL9 A;  2D4I A;  3TXD A;  1CV6 A;  1G1W A;  2NU4 I;  4WLD A;  1QS5 A;  1B5U A;  3FI5 A;  1UCO A;  1LHJ A;  2ZNW Y;  1YKY X;  1LMC A;  187L A;  4TTD A;  1BVX A;  3RNX A;  153L A;  2ZYC A;  1IWU A;  1VDS A;  108L A;  1C62 A;  145L A;  2LZ2 A;  1BMO A;  1UIF A;  1P2L A;  3QTL D;  1WQN A;  190L A;  4NHQ A;  2D4J A;  1XGT C;  1TEW A;  1LWK A;  1DYF A;  3GXR A;  4NWE A;  3CT1 A;  2F47 A;  1QTZ A;  2B0U C;  1UBZ A;  1WGT A;  4NGV A;  1L54 A;  1LWG A;  4HTK A;  4OWA A;  2A7D A;  2FBD A;  212L A;  197L A;  4YM8 A;  1JSF A;  4YXC A;  147L A;  4DC4 A;  4DD3 A;  1WQM A;  4WP4 A;  1B7S A;  4X3B A;  1G0Q A;  2H9K A;  1G0M A;  5I54 A;  2HTX A;  1RJC B;  1QTK A;  1L15 A;  4WLX A;  5C6L A;  1FDL Y;  1PZY A;  1IR7 A;  4ARQ B;  3CDV A;  4W51 A;  120L A;  1G1V A;  1P46 A;  1CT2 I;  2CWH A;  2BLX A;  3C83 A;  2HEA A;  1IOR A;  4DNC A;  1ALC A;  3TXG A;  1QTV A;  4YX7 C;  3HH6 A;  4W96 A;  1QT4 A;  2NTH A;  5FDJ A;  4LYO A;  2HUL A;  161L A;  4ETD A;  1PQM A;  3WUL A;  1L11 A;  1DS3 I;  1L47 A;  3W3E A;  3AGH A;  1QT3 A;  4I7K A;  1XX6 A;  4Z3M A;  2QB0 B;  1Z55 A;  2HED A;  3V2W A;  1N4F A;  1HFZ A;  2VB1 A;  5C6J A;  1L18 A;  4UWU A;  2OE7 X;  1SSW A;  4WM5 A;  2ANV A;  1CX7 A;  1L24 A;  1LJK A;  248L A;  4NSJ A;  1NDG C;  1B2K A;  2RH1 A;  2EKS C;  1L90 A;  4H9A A;  4II8 A;  135L A;  1L38 A;  1C7P A;  4LZT A;  4BAF A;  1GXV 2;  4TWS A;  1LMO A;  1L48 A;  114L A;  1LMA A;  1UC0 A;  5DM9 A;  4ZIX A;  3UEY A;  5C6I A;  4PPO A;  4DAJ A;  1CU5 A;  3T6U A;  1LHM A;  1A2Y C;  1DYB A;  4I7J A;  1L58 A;  3KAM A;  1KY0 A;  3P65 A;  1GE4 A;  3CDO A;  4AML A;  5F14 A;  130L A;  1VDD A;  1LZB A;  2HEB A;  3NY9 A;  2KCX A;  1LAA A;  1IR8 A;  4W94 A;  1LZD A;  1GBS A;  1FLY A;  3L2X A;  1T8A A;  4PRU A;  3W6F A;  191L A;  1D0K A;  1RFH A;  2ANX A;  3A94 A;  1QSQ A;  1KIP C;  1XJT A;  1GF0 A;  1GFR A;  1GFA A;  1IOS A;  2BQI A;  9LYZ A;  129L A;  3GUM A;  1LYF A;  1G0G A;  4I7T A;  1LI6 A;  1QSB A;  2GIV A;  231L A;  2W1L A;  4I7M A;  1GB3 A;  259L A;  194L A;  2RSC A;  2L78 A;  1CV1 A;  1QUH A;  4RLM A;  1RCM A;  1KBF A;  1GBX A;  5KXZ A;  1YIK A;  1JHL A;  3A93 A;  1IY4 A;  2BQA A;  3ZVQ B;  5HLL A;  133L A;  1QT5 A;  3UGD A;  4DDA A;  1D3J A;  2YBJ A;  4M6D A;  2NU2 I;  1WQO A;  217L A;  1YL1 X;  1JKD A;  4GLV A;  1C6C A;  1L13 A;  3DN6 A;  1GB0 A;  4ARM A;  4H1P A;  1QT7 A;  1OVK A;  3RZ4 A;  2B74 A;  1L43 A;  2EIZ C;  196L A;  1LR8 A;  1L46 A;  2Z12 A;  1TUS A;  1L28 A;  3AJN A;  4IAT A;  169L A;  123L A;  218L A;  3SP3 A;  2ORW A;  1HPT A;  257L A;  233L A;  1QS9 A;  3G3B B;  2ZQ4 A;  1CKD A;  1IR9 A;  1B7R A;  232L A;  3C81 A;  2BQG A;  2YBL A;  2E5R A;  1LZ1 A;  1L32 A;  4B49 A;  1LI3 A;  1L21 A;  1BQL Y;  3B0I A;  4G9S A;  4GN3 A;  1YAP A;  1HEL A;  3R5C A;  2E73 A;  2QPO A;  1D6P A;  1LSE A;  3AB6 A;  1IWV A;  1BB4 A;  1JTM A;  1HHL A;  3C7Z A;  252L A;  1C6K A;  3WUM A;  1WQP A;  2Z18 A;  3N9E A;  4Z41 A;  3CDQ A;  3A6B Y;  3C8S A;  3CB7 A;  1L23 A;  4H8Y A;  4DD1 A;  1GBZ A;  5L9J A;  2ZQ3 A;  1L56 A;  1LZ9 A;  2J9R A;  1C45 A;  4ANR A;  1IP4 A;  1C63 A;  3B72 A;  1F0W A;  2JXD A;  1EQ5 A;  127L A;  3HH2 C;  4ARQ A;  3DN1 A;  2YSS C;  1REX A;  3AZ5 A;  1LYD A;  4UXH A;  2UVO A;  4W53 A;  2CUU A;  5JHW C;  174L A;  1B5Z A;  2BQJ A;  219L A;  1GF6 A;  2XBR A;  1WTJ A;  4NGY A;  5KJ9 A;  4YF2 A;  1LYS A;  2SGD I;  4LGK A;  1E8L A;  4DDB A;  1QUG A;  2HUK A;  4B4J A;  2BQF A;  2C8O A;  1CKG A;  2YBH A;  3C82 A;  4NGO A;  1LSP A;  2IHL A;  2LYZ A;  4NEB A;  1XGP C;  1CV0 A;  4H9B A;  1OMU A;  3D9A C;  3HT7 A;  1L20 A;  3WUA A;  5DN4 A;  3AGI A;  5HQ1 A;  1LYO A;  3R5B A;  1H0Z A;  1CV5 A;  1C10 A;  3NY8 A;  1CKH A;  1C67 A;  192L A;  1F6R A;  1GF7 A;  3J6K A;  1FKQ A;  3W6D A;  1D9U A;  4LDO A;  5E9R A;  1L96 A;  3FI7 A;  1GFV A;  5HMJ A;  1GEV A;  5APD A;  142L A;  1WQR A;  1C6B A;  3B6L A;  4A24 A;  1HFY A;  1IY5 A;  1DYE A;  178L A;  1Y8F A;  1FLU A;  229L A;  2F32 A;  1T8F A;  1KXX A;  1XEJ A;  1QDT A;  1SGQ I;  1PQO A;  1QDR A;  244L A;  1KW7 A;  1BB6 A;  5LVI A;  2HEC A;  1LHH A;  4DYG A;  152L A;  3A6C Y;  3HU9 A;  5FCP A;  1LJG A;  1L37 A;  5KXX A;  5IHG A;  1QT6 A;  2OTY X;  4GN4 A;  177L A;  2EQL A;  2SGQ I;  5LA5 A;  1L69 A;  3MEK A;  4I7N A;  1G7J C;  1CUQ A;  3SB7 A;  1L30 A;  1IY6 A;  3HBE X;  1LJE A;  1L68 A;  3GUL A;  3AYQ A;  1IOC A;  172L A;  4R6C A;  1TCY A;  3RUN A;  2UZ3 A;  5FEL A;  4B1A A;  1L0K A;  1U5K A;  1PPF I;  4YOP A;  3SB5 A;  1GDW A;  4FJR A;  5APC A;  1QUD A;  1G7L C;  1L34 A;  189L A;  2EPE A;  5L3H A;  3TO9 A;  4GCB A;  221L A;  4ML7 A;  3TXF A;  132L A;  4J1B A;  1XGR C;  1EL1 A;  1TDY A;  3ZVQ A;  1ZVY B;  4UXI A;  1LSY A;  1M8B A;  1GEZ A;  160L A;  3LZ2 A;  1LJ3 A;  1NHE A;  2O7A A;  2DB6 A;  1OYV I;  1LYY A;  1OUD A;  1FAQ A;  1J1O Y;  2I6Z A;  1OUG A;  210L A;  4EOF A;  1LHL A;  246L A;  7LYZ A;  3CXL A;  1YAO A;  4GCE A;  2N5Z A;  183L A;  243L A;  1SQ2 L;  1LPI A;  156L A;  1L10 A;  1WTH A;  2YBN A;  206L A;  258L A;  2LYO A;  2OE4 X;  6LZM A;  3CDR A;  1LTM A;  214L A;  1IC7 Y;  107L A;  2L7X A;  1OUJ A;  3A92 A;  5FUX A;  3A67 Y;  1CJ8 A;  1LI2 A;  3HT6 A;  163L A;  2BQN A;  3OE9 A;  1PTR A;  4JCV E;  159L A;  209L A;  4B4E A;  5B06 A;  1D3F A;  3GUP A;  1JJ1 A;  5LA8 A;  1P64 A;  1GBY A;  3VDU A;  1NBZ C;  2OEA X;  1IWZ A;  1XEI A;  1LOZ A;  2QQC A;  1L59 A;  2MEF A;  1GBW A;  1C6G A;  3EO5 A;  5IEL A;  3L64 A;  1FLQ A;  3WYH A;  235L A;  1L99 A;  2L8E A;  2JZM A;  4GCF A;  1D2W A;  227L A;  4OW1 A;  1P3N A;  211L A;  4WM6 A;  1L49 A;  2C8P A;  2G4P A;  2ERW A;  1LYE A;  4H9F A;  5KXP A;  2RIJ A;  3NYA A;  2B6W A;  3D4S A;  4J1A A;  4ARM B;  3A91 A;  1XGU C;  4WG7 A;  1YKX X;  200L A;  2B5Z A;  1LSG A;  3A34 A;  4LFP A;  4ET8 A;  1P37 A;  2N52 A;  2B73 A;  3FE0 A;  141L A;  1IWW A;  1L79 A;  1LHI A;  4KL7 A;  5DAE A;  1CVK A;  3GUI A;  3DN8 A;  4I7Q A;  3SN6 R;  4NWH A;  4CGE A;  3HDF A;  1L95 A;  4I7S A;  1L35 A;  1YIL A;  1CNS A;  6LYZ A;  4NHS A;  5E4P A;  4C3W A;  4NGJ A;  2K9H A;  201L A;  1LPY A;  4WM2 A;  1LJ4 A;  4RW2 A;  3HFM Y;  1IP5 A;  3G3X A;  4RLN A;  1K28 A;  2DQJ Y;  2RAY X;  4MST A;  4BAD A;  4UXJ A;  1CJ9 A;  1NXU A;  1L66 A;  3G3W A;  4IAS A;  1C6E A;  1QTC A;  4I7O A;  1B7L A;  1D9W A;  3PBL A;  4DD7 A;  2W1X A;  1HNL A;  3CSR A;  1UIG A;  1C6P A;  2P6A C;  3HUA A;  1GWD A;  1IP6 A;  4LYB A;  1LYZ A;  4EPI A;  2Y8P A;  2B72 A;  3LN2 A;  4I7P A;  2RBP A;  3WMK A;  3DMV A;  3E2I A;  1LLH A;  1UIB A;  4WL7 A;  1WVV A;  5DLA A;  4N9R A;  5FUW A;  1DYD A;  1YRO A;  5E3R A;  3ATN A;  1IEE A;  1UAC Y;  5KXK A;  2YUU A;  2DQF C;  5ILF A;  3CT0 A;  1GD6 A;  2BQK A;  1L12 A;  1L41 A;  2BUS A;  1SGR I;  3A3R X;  2MEC A;  2SGE I;  3HTD A;  4ZEE A;  1C6F A;  2G4Q A;  1TUR A;  4W55 A;  1FKV A;  2A7F A;  1C64 A;  1LZ8 A;  1N13 A;  4DJH A;  4OO9 A;  1WVU A;  2NU3 I;  148L E;  1LZN A;  1IW4 A;  3OJP A;  1L04 A;  1T6H A;  1T6V L;  1LSA A;  162L A;  3SEK C;  2RAZ X;  1L88 A;  1IWY A;  237L A;  1GB2 A;  4NGZ A;  1UUZ C;  5LZM A;  3IWR A;  4TSC A;  5LAG A;  2RBR A;  1IO5 A;  1LZ5 A;  3HT9 A;  3F8V A;  2HU1 A;  3A90 A;  4GLA A;  1V7T A;  1EQE A;  3ZEK A;  3WU8 A;  1LMQ A;  1G07 A;  5HNC A;  1LGW A;  1QUT A;  1L82 A;  4PJZ A;  4C5F A;  3F9L A;  2WVJ A;  3C80 A;  4XN6 A;  3FSX A;  1OWY A;  4GBR B;  1JPO A;  1L33 A;  1YKZ X;  4LYT A;  1S20 A;  1PQJ A;  1ZVH L;  4MPI A;  3GOX A;  3PDS A;  1GE1 A;  2MEE A;  4G4H A;  1LZY A;  1OUH A;  1DI3 A;  3WXT A;  2LCB A;  3DMZ A;  4LZM A;  2G4N A;  1L51 A;  2DBT A;  3UGL A;  2N1A B;  4N8Z A;  1C69 A;  1L14 A;  1IP2 A;  4QY9 A;  2Q0M X;  5IDD A;  4NGK A;  1T3P A;  2RBO A;  4W57 A;  4NSI A;  4XJD A;  4XJB A;  4OWE A;  1HEM A;  3K2R A;  3RZE A;  1HEW A;  2KMQ A;  4CFO A;  2ZNX Y;  1CT4 I;  5KXR A;  1LCN A;  1P6Y A;  4HJV A;  2IGC A;  2F4A A;  4J0L A;  5D5C A;  3TXI A;  1QUS A;  1JTO L;  3GUK A;  4D9Z A;  5APF A;  4I0C A;  3TXJ A;  3WPK A;  1L25 A;  1LMN A;  1Z2I A;  4XJF A;  1B5W A;  249L A;  1YU6 C;  198L A;  1HMK A;  1PJU A;  146L A; 
#chains in the Genus database with same CATH homology
 213L A;  4DDC A;  1W6Z A;  4PGJ B;  4KXI A;  4H91 A;  1OQM A;  1L64 A;  3C8Q A;  1C61 A;  2F30 A;  1ZWN A;  4H90 A;  1GB8 A;  2BQD A;  2LYM A;  4UWV A;  1VAT A;  251L A;  2Z38 A;  2PC2 A;  4WOA A;  4I7L A;  4LT2 A;  4ET9 A;  5J7C A;  1QTE A;  2RBN A;  1L57 A;  1OUA A;  1H6M A;  4EXM A;  4LYZ A;  151L A;  3OK0 A;  2DQI Y;  1LJF A;  164L A;  1BWJ A;  3TXH A;  3RT5 X;  1JIY A;  1I56 A;  1P9G A;  2W1Y A;  1LZS A;  138L A;  4ETA A;  5D5F A;  4EKS A;  186L A;  2NWD X;  4KPM A;  5I5Q A;  3SBA A;  1BB7 A;  2F4G A;  4BS7 A;  1L80 A;  3CSQ A;  1C6L A;  5FST A;  3F6Z A;  1NHB A;  1GXX A;  245L A;  2B6T A;  2YDG A;  1L91 A;  3P64 A;  4YEO A;  3W6B A;  1IVM A;  2CWI A;  4BAP A;  242L A;  3QAK A;  1DZB X;  1Q9B A;  2ZIJ A;  2MEA A;  4LYC A;  4OOO A;  253L A;  1GB9 A;  115L A;  4E3U A;  5I4X A;  1L75 A;  3EMS A;  1QSA A;  3DNA A;  1GF8 A;  1C6A A;  4FDY A;  5LIO A;  3CSZ A;  2A4T A;  1L86 A;  113L A;  4W52 A;  1GFT A;  5M1Y A;  2LZM A;  1J1X Y;  1L52 A;  1L89 A;  4G49 A;  5A3Z A;  1WQQ A;  1L63 A;  119L A;  1LHK A;  4S0W A;  4LFX A;  1B7Q A;  5I14 A;  3G3A B;  1PQK A;  1QSW A;  2XBS A;  4Z46 A;  1L05 A;  4HJZ A;  1JIT A;  1KS3 A;  3QE8 A;  5LYZ A;  1C68 A;  2BLY A;  4YXA C;  1LJN A;  140L A;  4CHX A;  3M18 B;  3W6C A;  2BQB A;  4WG1 A;  1JSE A;  2H9J A;  1MLC E;  3A95 A;  1LJH A;  5KXM A;  1L22 A;  1C6H A;  1REY A;  1CX6 A;  4PHI A;  1D3M A;  1DYC A;  5FEK A;  128L A;  1LZE A;  1SWY A;  2XJW A;  5LVH A;  2LHM A;  3HTG A;  1L87 A;  2MEH A;  5F9X A;  1PQI A;  1L44 A;  2BQE A;  2D6B A;  1ULK A;  224L A;  1UHA A;  5LXW A;  3DN0 A;  3WL2 A;  4WLT A;  4AQN A;  1L45 A;  2XTH A;  170L A;  1IWT A;  1OV5 A;  1L83 A;  4H94 A;  1LZA A;  4NHI A;  1BHZ A;  1AKI A;  4EKQ A;  2Z39 A;  1JTP L;  1GFK A;  4EKP A;  1L29 A;  1JKA A;  4DD2 A;  4NGI A;  3CT5 A;  4DKL A;  2CWG A;  5AMY A;  1LZR A;  1DI4 A;  1LYJ A;  1L70 A;  2MED A;  4HV1 A;  4H8Z A;  1GAZ A;  4NFV A;  5KKI A;  2DQC Y;  1LW9 A;  4TX7 A;  1GE3 A;  1SLY A;  1LSM A;  110L A;  4H9H A;  4WM3 A;  1KIQ C;  1L74 A;  2Z2F A;  4TSB A;  2DKV A;  2DQE Y;  1UIC A;  228L A;  5KXN A;  2I25 L;  4OWB A;  4HJY A;  2BQC A;  4WO6 A;  1GF4 A;  4AXT A;  1P36 A;  3WH1 A;  118L A;  2ZWB A;  1P9Z A;  4LDL A;  2ZIK A;  1GB5 A;  4H93 A;  1LKR A;  1SX2 A;  4IJ4 A;  5LYT A;  2BAA A;  1UIE A;  3UON A;  1C65 A;  3CDT A;  1HC0 A;  1OWZ A;  1P7S A;  2XQO A;  3MGW A;  1KXW A;  3VWO A;  1ZV5 L;  4XJH A;  2Z6B A;  4EJ4 A;  1GDX A;  4N5R A;  1QTD A;  4ZFP A;  1IY3 A;  5KXL A;  1JUG A;  3M3U A;  1B7P A;  262L A;  1L81 A;  2Z37 A;  1GFJ A;  3WPJ A;  3OE6 A;  225L A;  1G7M C;  1QTH A;  4WM1 A;  3AZ6 A;  4H8X A;  180L A;  1T8G A;  5ILC A;  1DQJ C;  1CU3 A;  4ETE A;  5T3F A;  3WW5 A;  4KT3 A;  1C46 A;  4OWC A;  3ULR A;  1XSF A;  220L A;  1LJJ A;  3EXD A;  4L41 A;  5KXY A;  1JQU A;  3WVY A;  5I4Y A;  1LZ4 A;  139L A;  1SWZ A;  1J1P Y;  3E3D A;  1XFP L;  3GUJ A;  3AZ4 A;  1DPW A;  1DXJ A;  2OU9 A;  1L76 A;  1P56 A;  3DKE X;  1B9O A;  1D0M A;  3BKH A;  4XEN A;  2RB1 X;  239L A;  144L A;  1LJI A;  2OE9 X;  1UIA A;  254L A;  1NKH A;  216L A;  3HT8 A;  3HH5 A;  1DKK A;  3EML A;  3HWL A;  3GUN A;  3JR6 A;  5DN5 A;  4PK0 A;  3AGG G;  2OU0 X;  222L A;  4P2E A;  1C6J A;  1QUO A;  4M4O A;  2WGC A;  1IOQ A;  2B7X A;  1F10 A;  1OUB A;  1L42 A;  143L A;  4EPF A;  3C7W A;  182L A;  4ARP A;  1C43 A;  4XAD A;  2BPU A;  1JTT L;  205L A;  4HTQ A;  1LSB A;  3K3T A;  2D91 A;  1NBY C;  4DD9 A;  2X3T A;  1ZUR A;  4PRQ A;  1XEP A;  1BWH A;  3DMX A;  3RW8 A;  2B70 A;  5LVG A;  1L72 A;  1TBY A;  4NG8 A;  1ULN A;  1LYI A;  1LKS A;  1K7V A;  2B6Y A;  5KXS A;  1C6I A;  1JWR A;  3DN3 A;  4MR1 A;  1WKX A;  2B6Z A;  1DYA A;  1D6Q A;  3TXK A;  2ZYP A;  1UIH A;  122L A;  2NTG A;  111L A;  1FBI X;  150L A;  1DI5 A;  5I53 A;  1CKC A;  1INU A;  4QDN A;  4H92 A;  4J7V A;  4HSF A;  1G7H C;  3TMV A;  1LSD A;  1LZC A;  2MEB A;  1AT5 A;  4HPE A;  4MCK A;  4I7R A;  2BQL A;  1KW5 A;  4DQ5 A;  1I20 A;  1PQD A;  3AW7 A;  1L40 A;  3SB9 A;  4DQJ A;  1YL0 X;  3LYZ A;  1LMT A;  4CFP A;  1QIO A;  1GHL A;  4GRV A;  1IP3 A;  4LYM A;  112L A;  3BKV A;  5FHW A;  2O4W A;  4GN5 C;  4Z98 A;  1G0P A;  1OUI A;  2X52 A;  1IC4 Y;  1CUP A;  1D2Y A;  1C6N A;  1G7I C;  3N9C A;  1JJ3 A;  1HEQ A;  2YBI A;  158L A;  1CJ6 A;  1NWG A;  1L08 A;  256L A;  1AM7 A;  4RDS A;  1FN5 A;  7WGA A;  1F6S A;  5LAF A;  5LVK A;  1BVK C;  1G0L A;  165L A;  1VDT A;  2FYC A;  137L A;  5KXW A;  1XGQ C;  1OUF A;  3ATO A;  1AT6 A;  1L06 A;  1L17 A;  1IOT A;  5A3E A;  1L55 A;  3TMU A;  3HH3 A;  4B4I A;  1H87 A;  1P5C A;  1L92 A;  4H9I A;  1O23 A;  1RFP A;  4ARJ A;  3QY4 A;  3QNG A;  2CDS A;  3LHM A;  3HUK A;  3LZM A;  9WGA A;  4I8S A;  1AZF A;  5B59 A;  5F16 A;  1JIS A;  3W6A A;  1HF4 A;  3HBH A;  1L50 A;  1HEP A;  5KKJ A;  3WXU A;  1GF9 A;  1NF5 A;  1GPQ C;  4NSH A;  1L27 A;  3V2Y A;  5B05 A;  4DD0 A;  3WVX A;  1L31 A;  4W54 A;  4XYY A;  1C6T A;  3C7Y A;  1C6D A;  3RU5 A;  255L A;  3B0O A;  4NIJ A;  1QT8 A;  4LT3 A;  2RB2 X;  261L A;  1IX0 A;  247L A;  1MEL L;  5LVJ A;  1BB5 A;  3HH4 A;  1ULM A;  3OE0 A;  175L A;  5B1F A;  1XEK A;  1LSZ A;  1NQI A;  5I4W A;  260L A;  1DPX A;  4WLY A;  4NG1 A;  5L3I A;  1OV7 A;  1HML A;  2GV0 A;  1B5X A;  1I1Z A;  1JKB A;  103L A;  7LZM A;  166L A;  1C6Q A;  2ZIL A;  1HSX A;  2Q9D A;  1L84 A;  6LYT A;  2D4K A;  4TUN A;  1L65 A;  4IAP A;  1CU2 A;  4NHT A;  1D3N A;  1L73 A;  199L A;  1OVJ A;  1W08 A;  1JJ0 A;  207L A;  1UID A;  1GB7 A;  1TLA A;  1B0D A;  4H9C A;  2HUB A;  1L09 A;  2F2N A;  1IP1 A;  3AZ7 A;  4B0D A;  1GAY A;  4GCD A;  1JTN A;  4LT1 A;  1HEN A;  2X0A A;  167L A;  2B75 A;  1L67 A;  4DQ7 A;  250L A;  2OTZ X;  185L A;  2YVB A;  4WMG A;  1RI8 B;  1HFX A;  208L A;  4NSG A;  1D0L A;  2QAR C;  1P2R A;  4G4C A;  195L A;  3IJV A;  126L A;  1V7S A;  1NMM A;  5JEN B;  1CU0 A;  2RBS A;  4W59 A;  3W6E A;  1P2C C;  171L A;  4OOT A;  4OWH A;  157L A;  4N0J A;  1IWX A;  1RE2 A;  2W1M A;  4R0F A;  1L53 A;  2FBB A;  1L02 A;  102L A;  1BGI A;  2I26 L;  3LYM A;  2FYD A;  104L A;  4YEM A;  2LC9 A;  3B0K A;  131L A;  1OUC A;  2WAR A;  4UWN A;  181L A;  1L77 A;  1C66 A;  3ODU A;  1QQY A;  2RB0 X;  1L07 A;  1GFU A;  240L A;  1CV4 A;  4HPI A;  4ETC A;  215L A;  1HER A;  3D3D A;  4HV2 A;  1YAQ A;  3HDE A;  3HTB A;  4DT3 A;  4N1C C;  2F2Q A;  1LGX A;  230L A;  1XJU A;  1L61 A;  3WW6 A;  241L A;  3OE8 A;  4W56 A;  3A3Q A;  2Z19 A;  5KY1 A;  3AW6 A;  1VFB C;  2O79 A;  3FA0 A;  3HUQ A;  3HBD A;  1G06 A;  1CJ7 A;  5LYM A;  4QEQ A;  1L19 A;  1B6I A;  4ARL A;  109L A;  1GE2 A;  188L A;  1WTM A;  134L A;  1VDQ A;  4N1E I;  4RW1 A;  223L A;  4HTN A;  1L60 A;  3N9A A;  3TMW A;  2BQO A;  155L A;  4K5Y A;  1T97 A;  1OVH A;  4LT0 A;  236L A;  3SB6 A;  1DYG A;  1L93 A;  4WO9 A;  3WUN A;  125L A;  3CQL A;  4HP0 A;  1HEV A;  2DQD Y;  4DWX A;  1OUE A;  5F81 A;  1IC5 Y;  1LGU A;  4AGA A;  176L A;  1L97 A;  5KXO A;  5HMV A;  5APE A;  4A7D A;  1EPY A;  4NGW A;  3LYT A;  2B6X A;  3SBB C;  3P4Z A;  184L A;  1WTN A;  1GBO A;  1DKJ A;  1L0J A;  2HU3 A;  5F9U A;  3TXE A;  1L39 A;  2AUB A;  3VW7 A;  1C08 C;  1CTW A;  3WU7 A;  1GFG A;  2MEG A;  3LYO A;  3G3V A;  2DQG Y;  3HU8 A;  149L A;  2LZT A;  154L A;  1VDP A;  1VAU A;  2HUM A;  193L A;  1HEO A;  1L36 A;  1LZG A;  1L03 A;  3EBA B;  1LZT A;  5B07 A;  168L A;  4QGZ A;  1GF3 A;  3C8R A;  4EMN A;  4PJ2 C;  173L A;  1NDM C;  4NGL A;  1QTB A;  1IP7 A;  1B7N A;  3DN4 A;  2OU8 A;  1BWI A;  4W58 A;  1C6M A;  5II3 A;  4CJ2 A;  4XJI A;  3WU9 A;  2HEF A;  4WM4 A;  3P66 A;  1REM A;  1OP9 B;  1IIZ A;  1LYG A;  3LZT A;  1YQV Y;  1LSC A;  3WPL A;  3SB8 A;  1LZ6 A;  3TMX A;  2IFF Y;  1GF5 A;  2DQA A;  2Z2E A;  1GB6 A;  2RBQ A;  1GE0 A;  1B7O A;  1B5Y A;  1HSW A;  4GCC A;  1L98 A;  4XJG A;  2BQH A;  4EKR A;  2CGI A;  5B1G A;  4ETB A;  1A4V A;  1LSF A;  5K7O A;  2CJL A;  1KIR C;  1EQ4 A;  3IJU A;  8LYZ A;  2Q9E A;  5LIN A;  1CV3 A;  1C60 A;  2HEE A;  4NHP A;  3DN2 A;  3A96 A;  1CKF A;  1B5V A;  1FLW A;  2BQM A;  4G4B A;  1GFE A;  1B7M A;  1KXY A;  1L71 A;  1SX7 A;  4WL6 A;  3GUO A;  1SSY A;  3HTF A;  4ZPU A;  5EBH A;  1I6S A;  1VED A;  1JEF A;  1G0J A;  1KNI A;  1YAM A;  5HNL A;  226L A;  3P68 A;  1ZYT A;  1ZMY L;  2YBM A;  1UA6 Y;  1WGC A;  1BB3 A;  234L A;  4YEN A;  4E97 A;  5KXT A;  3TXB A;  4NY5 A;  1JKC A;  1L01 A;  1L94 A;  4O34 A;  1K7T A;  1L16 A;  1GFH A;  4U3X B;  3FAD A;  1G0K A;  1LYH A;  238L A;  1LSN A;  1K7U A;  1L62 A;  1CU6 A;  3A8Z A;  1TAY A;  1REZ A;  1YAN A;  1KY1 A;  1OYU A;  1L26 A;  1PS5 A;  2LB7 A;  3J4G A;  1L00 A;  3T36 A;  2DQH Y;  4LDE A;  2H5Z A;  4H9E A;  1LMP A;  3GXK A;  1L85 A;  2MEI A;  5DL9 A;  2D4I A;  3TXD A;  1CV6 A;  1G1W A;  4WLD A;  1QS5 A;  1B5U A;  3FI5 A;  1UCO A;  1LHJ A;  2ZNW Y;  1YKY X;  1LMC A;  187L A;  4TTD A;  1BVX A;  3RNX A;  153L A;  2ZYC A;  1IWU A;  1VDS A;  108L A;  1C62 A;  145L A;  2LZ2 A;  1UIF A;  1P2L A;  1WQN A;  190L A;  4NHQ A;  2D4J A;  1XGT C;  1TEW A;  1LWK A;  1DYF A;  3GXR A;  4NWE A;  3CT1 A;  2F47 A;  1QTZ A;  1UBZ A;  1WGT A;  4NGV A;  1L54 A;  1LWG A;  4HTK A;  4OWA A;  2A7D A;  2FBD A;  212L A;  197L A;  4YM8 A;  1JSF A;  4YXC A;  147L A;  4DC4 A;  4DD3 A;  1WQM A;  4WP4 A;  1B7S A;  4X3B A;  1G0Q A;  2H9K A;  1G0M A;  5I54 A;  2HTX A;  1RJC B;  1QTK A;  1L15 A;  4WLX A;  5C6L A;  1FDL Y;  1PZY A;  1IR7 A;  4ARQ B;  3CDV A;  4W51 A;  120L A;  1G1V A;  1P46 A;  2BLX A;  3C83 A;  2HEA A;  1IOR A;  1ALC A;  3TXG A;  1QTV A;  4YX7 C;  3HH6 A;  4W96 A;  1QT4 A;  2NTH A;  5FDJ A;  4LYO A;  2HUL A;  161L A;  4ETD A;  1PQM A;  3WUL A;  1L11 A;  1L47 A;  3W3E A;  3AGH A;  1QT3 A;  4I7K A;  4Z3M A;  2QB0 B;  1Z55 A;  2HED A;  3V2W A;  1N4F A;  1HFZ A;  2VB1 A;  5C6J A;  1L18 A;  4UWU A;  2OE7 X;  1SSW A;  4WM5 A;  2ANV A;  1CX7 A;  1L24 A;  1LJK A;  248L A;  4NSJ A;  1NDG C;  1B2K A;  2RH1 A;  2EKS C;  1L90 A;  4H9A A;  4II8 A;  135L A;  1L38 A;  1C7P A;  4LZT A;  4BAF A;  1GXV 2;  4TWS A;  1LMO A;  1L48 A;  114L A;  1LMA A;  1UC0 A;  5DM9 A;  4ZIX A;  5C6I A;  4PPO A;  4DAJ A;  1CU5 A;  3T6U A;  1LHM A;  1A2Y C;  1DYB A;  4I7J A;  1L58 A;  3KAM A;  1KY0 A;  3P65 A;  1GE4 A;  3CDO A;  4AML A;  5F14 A;  130L A;  1LZB A;  2HEB A;  3NY9 A;  1LAA A;  1IR8 A;  4W94 A;  1LZD A;  1GBS A;  1FLY A;  3L2X A;  1T8A A;  4PRU A;  3W6F A;  191L A;  1D0K A;  2ANX A;  3A94 A;  1QSQ A;  1KIP C;  1XJT A;  1GF0 A;  1GFR A;  1GFA A;  1IOS A;  2BQI A;  9LYZ A;  129L A;  3GUM A;  1LYF A;  1G0G A;  4I7T A;  1LI6 A;  1QSB A;  231L A;  2W1L A;  4I7M A;  1GB3 A;  259L A;  194L A;  2RSC A;  2L78 A;  1CV1 A;  1QUH A;  4RLM A;  1RCM A;  1GBX A;  5KXZ A;  1YIK A;  1JHL A;  3A93 A;  1IY4 A;  2BQA A;  3ZVQ B;  5HLL A;  133L A;  1QT5 A;  4DDA A;  1D3J A;  2YBJ A;  4M6D A;  1WQO A;  217L A;  1YL1 X;  1JKD A;  4GLV A;  1C6C A;  1L13 A;  3DN6 A;  1GB0 A;  4ARM A;  4H1P A;  1QT7 A;  1OVK A;  3RZ4 A;  2B74 A;  1L43 A;  2EIZ C;  196L A;  1L46 A;  2Z12 A;  1L28 A;  3AJN A;  4IAT A;  169L A;  123L A;  218L A;  3SP3 A;  257L A;  233L A;  1QS9 A;  3G3B B;  2ZQ4 A;  1CKD A;  1IR9 A;  1B7R A;  232L A;  3C81 A;  2BQG A;  2YBL A;  1LZ1 A;  1L32 A;  4B49 A;  1LI3 A;  1L21 A;  1BQL Y;  3B0I A;  4G9S A;  4GN3 A;  1YAP A;  1HEL A;  1D6P A;  1LSE A;  3AB6 A;  1IWV A;  1BB4 A;  1JTM A;  1HHL A;  3C7Z A;  252L A;  1C6K A;  3WUM A;  1WQP A;  2Z18 A;  3N9E A;  4Z41 A;  3CDQ A;  3A6B Y;  3C8S A;  3CB7 A;  1L23 A;  4H8Y A;  4DD1 A;  1GBZ A;  5L9J A;  2ZQ3 A;  1L56 A;  1LZ9 A;  1C45 A;  4ANR A;  1IP4 A;  1C63 A;  3B72 A;  1F0W A;  1EQ5 A;  127L A;  4ARQ A;  3DN1 A;  2YSS C;  1REX A;  3AZ5 A;  1LYD A;  2UVO A;  4W53 A;  2CUU A;  174L A;  1B5Z A;  2BQJ A;  219L A;  1GF6 A;  2XBR A;  4NGY A;  5KJ9 A;  4YF2 A;  1LYS A;  4LGK A;  1E8L A;  4DDB A;  1QUG A;  2HUK A;  4B4J A;  2BQF A;  2C8O A;  1CKG A;  2YBH A;  3C82 A;  4NGO A;  1LSP A;  2IHL A;  2LYZ A;  4NEB A;  1XGP C;  1CV0 A;  4H9B A;  3D9A C;  3HT7 A;  1L20 A;  3WUA A;  5DN4 A;  3AGI A;  5HQ1 A;  1LYO A;  1CV5 A;  1C10 A;  3NY8 A;  1CKH A;  1C67 A;  192L A;  1F6R A;  1GF7 A;  3J6K A;  1FKQ A;  3W6D A;  1D9U A;  4LDO A;  5E9R A;  1L96 A;  3FI7 A;  1GFV A;  5HMJ A;  1GEV A;  5APD A;  142L A;  1WQR A;  1C6B A;  3B6L A;  1HFY A;  1DYE A;  178L A;  1FLU A;  229L A;  2F32 A;  1T8F A;  1KXX A;  1XEJ A;  1QDT A;  1PQO A;  1QDR A;  244L A;  1KW7 A;  1BB6 A;  5LVI A;  2HEC A;  1LHH A;  4DYG A;  152L A;  3A6C Y;  3HU9 A;  5FCP A;  1LJG A;  1L37 A;  5KXX A;  5IHG A;  1QT6 A;  2OTY X;  4GN4 A;  177L A;  2EQL A;  5LA5 A;  1L69 A;  4I7N A;  1G7J C;  1CUQ A;  3SB7 A;  1L30 A;  3HBE X;  1LJE A;  1L68 A;  3GUL A;  3AYQ A;  1IOC A;  172L A;  4R6C A;  1TCY A;  3RUN A;  5FEL A;  4B1A A;  1L0K A;  4YOP A;  3SB5 A;  1GDW A;  4FJR A;  5APC A;  1QUD A;  1G7L C;  1L34 A;  189L A;  2EPE A;  5L3H A;  4GCB A;  221L A;  4ML7 A;  3TXF A;  132L A;  4J1B A;  1XGR C;  1EL1 A;  1TDY A;  3ZVQ A;  1ZVY B;  1LSY A;  1GEZ A;  160L A;  3LZ2 A;  1LJ3 A;  1NHE A;  2O7A A;  1LYY A;  1OUD A;  1J1O Y;  2I6Z A;  1OUG A;  210L A;  4EOF A;  1LHL A;  246L A;  7LYZ A;  1YAO A;  4GCE A;  2N5Z A;  183L A;  243L A;  1SQ2 L;  1LPI A;  156L A;  1L10 A;  1WTH A;  2YBN A;  206L A;  258L A;  2LYO A;  2OE4 X;  6LZM A;  3CDR A;  1LTM A;  214L A;  1IC7 Y;  107L A;  1OUJ A;  3A92 A;  3A67 Y;  1CJ8 A;  1LI2 A;  3HT6 A;  163L A;  2BQN A;  3OE9 A;  159L A;  209L A;  4B4E A;  5B06 A;  1D3F A;  3GUP A;  1JJ1 A;  5LA8 A;  1P64 A;  1GBY A;  1NBZ C;  2OEA X;  1IWZ A;  1XEI A;  1LOZ A;  1L59 A;  2MEF A;  1GBW A;  1C6G A;  3EO5 A;  5IEL A;  3L64 A;  1FLQ A;  3WYH A;  235L A;  1L99 A;  4GCF A;  1D2W A;  227L A;  4OW1 A;  1P3N A;  211L A;  4WM6 A;  1L49 A;  2C8P A;  2G4P A;  1LYE A;  4H9F A;  5KXP A;  3NYA A;  2B6W A;  3D4S A;  4J1A A;  4ARM B;  3A91 A;  1XGU C;  4WG7 A;  1YKX X;  200L A;  2B5Z A;  1LSG A;  3A34 A;  4LFP A;  4ET8 A;  1P37 A;  2B73 A;  3FE0 A;  141L A;  1IWW A;  1L79 A;  1LHI A;  4KL7 A;  1CVK A;  3GUI A;  3DN8 A;  4I7Q A;  3SN6 R;  4NWH A;  4CGE A;  3HDF A;  1L95 A;  4I7S A;  1L35 A;  1YIL A;  1CNS A;  6LYZ A;  4NHS A;  5E4P A;  4C3W A;  4NGJ A;  201L A;  1LPY A;  4WM2 A;  1LJ4 A;  4RW2 A;  3HFM Y;  1IP5 A;  3G3X A;  4RLN A;  1K28 A;  2DQJ Y;  2RAY X;  4MST A;  4BAD A;  1CJ9 A;  1L66 A;  3G3W A;  4IAS A;  1C6E A;  1QTC A;  4I7O A;  1B7L A;  1D9W A;  3PBL A;  4DD7 A;  2W1X A;  1HNL A;  3CSR A;  1UIG A;  1C6P A;  3HUA A;  1GWD A;  1IP6 A;  4LYB A;  1LYZ A;  4EPI A;  2Y8P A;  2B72 A;  3LN2 A;  4I7P A;  2RBP A;  3WMK A;  3DMV A;  1LLH A;  1UIB A;  4WL7 A;  1WVV A;  5DLA A;  4N9R A;  1DYD A;  1YRO A;  3ATN A;  1IEE A;  1UAC Y;  5KXK A;  2DQF C;  5ILF A;  3CT0 A;  1GD6 A;  2BQK A;  1L12 A;  1L41 A;  3A3R X;  2MEC A;  3HTD A;  4ZEE A;  1C6F A;  2G4Q A;  4W55 A;  1FKV A;  2A7F A;  1C64 A;  1LZ8 A;  4DJH A;  4OO9 A;  1WVU A;  148L E;  1LZN A;  3OJP A;  1L04 A;  1T6H A;  1T6V L;  1LSA A;  162L A;  2RAZ X;  1L88 A;  1IWY A;  237L A;  1GB2 A;  4NGZ A;  1UUZ C;  5LZM A;  3IWR A;  4TSC A;  5LAG A;  2RBR A;  1IO5 A;  1LZ5 A;  3HT9 A;  3F8V A;  2HU1 A;  3A90 A;  4GLA A;  1V7T A;  1EQE A;  3ZEK A;  3WU8 A;  1LMQ A;  1G07 A;  5HNC A;  1LGW A;  1QUT A;  1L82 A;  4PJZ A;  4C5F A;  3F9L A;  3C80 A;  4XN6 A;  1OWY A;  4GBR B;  1JPO A;  1L33 A;  1YKZ X;  4LYT A;  1PQJ A;  1ZVH L;  4MPI A;  3PDS A;  1GE1 A;  2MEE A;  4G4H A;  1LZY A;  1OUH A;  1DI3 A;  3WXT A;  2LCB A;  3DMZ A;  4LZM A;  2G4N A;  1L51 A;  2DBT A;  4N8Z A;  1C69 A;  1L14 A;  1IP2 A;  4QY9 A;  2Q0M X;  5IDD A;  4NGK A;  1T3P A;  2RBO A;  4W57 A;  4NSI A;  4XJD A;  4XJB A;  4OWE A;  1HEM A;  3K2R A;  3RZE A;  1HEW A;  4CFO A;  2ZNX Y;  5KXR A;  1LCN A;  1P6Y A;  4HJV A;  2IGC A;  2F4A A;  4J0L A;  5D5C A;  3TXI A;  1QUS A;  1JTO L;  3GUK A;  4D9Z A;  5APF A;  4I0C A;  3TXJ A;  3WPK A;  1L25 A;  1LMN A;  4XJF A;  1B5W A;  249L A;  198L A;  1HMK A;  146L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...