1PTRA

Protein kinase c delta cys2 domain complexed with phorbol-13-acetate
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
50
structure length
50
Chain Sequence
HRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN KINASE C DELTA TYPE
publication title Crystal structure of the cys2 activator-binding domain of protein kinase C delta in complex with phorbol ester.
pubmed doi rcsb
source organism Mus musculus
molecule tags Phosphotransferase
total genus 9
structure length 50
sequence length 50
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1995-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1ptrA00
4FKDA 5FUXA 1TBOA 3UEYA 1W4RA 2YUUA 2QPOA 1PTRA 3UFFA 3UGLA 2B8TA 1FARA 1R79A 1KBEA 3BJIA 1RFHA 2ELIA 3UGDA 2J87A 4UXJA 3CXLA 2WVJA 2DB6A 2QQ0A 1XA6A 1TBNA 3E2IA 2J9RA 2ROWA 1XBTA 2GVIA 2UZ3A 4L9MA 2VRWB 5FUWA 3UEJA 1FAQA 2ENNA 2ENZA 4UXHA 1Y8FA 3KY9A 2ORVA 2FNFX 2JA1A 2QQEA 4UXIA 2ORWA 1XX6A 5FUYA 3UGIA 2E73A 4B6DA 1KBFA 1PTQA 5FUVA
chains in the Genus database with same CATH superfamily
1WGTA 1UVGA 1LR7A 2L8EA 3VE5A 2GKTI 1V1IA 2QPOA 2JW6A 3OXLA 5E3PA 1TBRR 3TO6A 2UVOA 2SGFI 4UXJA 3TJQA 4E1PA 1SGPI 2DIPA 2NU4I 1IW4A 3FSXA 1CHOI 2DB6A 2QQ0A 2ERWA 2SGPI 1BMOA 3OL0A 1HJAI 1Y1CA 2LB7A 4L9MA 2XRCA 2RIJA 2WGCA 3HH2C 1UHAA 2V53A 2ENNA 1MJ9A 1W3SA 2NU3I 1SGNI 2ORVA 2FNFX 2JZMA 1TURA 5E3RA 1OMUA 2JXDA 2CWHA 2JA1A 1P9GA 1IY5A 1PJUA 1FY7A 1CSOI 1MJAA 1Y1BA 1XX6A 1OYVI 1HEVA 3UGIA 4E1RA 3TOAA 2QQCA 1PTQA 2ROWA 1R0RI 5J8FA 2GIVA 5FUXA 3UEYA 2NU1I 1BUSA 4JCVE 1TGSI 2P6AC 1SGDI 1TUSA 2B8TA 1KBEA 1NUBA 4GI3C 2M5XA 2ELIA 1MJBA 3BJIA 3UGDA 1NXUA 1PCEA 1Z7KB 2OVOA 2NU0I 1TIHA 2SGDI 2V1CC 2WVJA 2F3CI 1HDLA 1WKXA 3UOEA 3E59A 2E5RA 2J9RA 1XBTA 2KMPA 1UUCA 4A24A 3UEJA 1S20A 1FAQA 1K7VA 3R5CA 4AMLA 5J8CA 1MT1A 1ULMA 5JHWC 2QQEA 4UXIA 9WGAA 1CT2I 2N52A 2E73A 4B6DA 1SGQI 1K7UA 2X52A 5FUVA 2V1CA 3OVOA 1CGJI 1TBOA 2BUSA 3B4VC 3R5BA 4FKDA 1P9ZA 4DNCA 2SGEI 2SGQI 5CCLA 2KMRA 1K7TA 2CWFA 5HI7A 1PTRA 1WTJA 2CJSC 2NU2I 1R79A 1M8CA 1OVOA 1HPTA 2OD1A 1RFHA 1X4SA 3OXFA 2DKVA 2J87A 2OU2A 3R5DA 2LEOA 4WP4A 1YU6C 1DS2I 2B0UC 2RC4A 4OVOA 1H0ZA 1XA6A 1SGYI 5EX0A 1TBNA 3E2IA 3FSYA 3QWPA 2GVIA 1CT4I 2LUYA 1V1HA 2VRWB 5FUWA 1WGCA 2Y0MA 1FYBA 2WCYA 2KMOA 3D00A 5DAEA 3KY9A 3OXGA 1U5KA 5E3QA 3VDUA 1Q9BA 7WGAA 1SGEI 1UVFA 1N13A 2ODDA 2ORWA 2PQ8A 3RU0A 1KBFA 1DS3I 2N71A 2X3TA 1OMTA 1IY6A 3VDPA 2JYYA 1TOTA 2K9HA 1PPFI 3TO9A 2GKVA 1SGRI 1W4RA 1LR9A 2L7XA 2YUUA 1ULNA 2OZUA 2KMQA 1AN1I 1FARA 3QAHA 3UGLA 2N1AB 3UFFA 4SGBI 5EX3A 1KMAA 2A20A 2ARPF 3FC3A 3QTLD 2CWGA 1CT0I 2QQDA 3TO7A 2UZ3A 3SGQI 1M8BA 3GOXA 1LR8A 1CE3A 5CCMA 1X74A 2GKRI 3MEKA 3R5AA 1CGII 1VDDA 1Y8FA 2ENZA 3PDNA 4HGUA 4UXHA 1ULKA 1TBQR 4MPIA 3SGBI 3SEKC 2W0TA 1Z2IA 5FUYA 3TOBA 5HQ8A 2KCXA 1YTPA 3CXLA 2YQPA 2N17A
chains in the Genus database with same CATH topology
1UVGA 1LR7A 2L8EA 3VE5A 2GKTI 1V1IA 2QPOA 2JW6A 3OXLA 1TBRR 2SGFI 4UXJA 3TJQA 4E1PA 1SGPI 2DIPA 2NU4I 1IW4A 1CHOI 2DB6A 2QQ0A 2ERWA 2SGPI 1BMOA 3OL0A 1HJAI 1Y1CA 4L9MA 2XRCA 3HH2C 2V53A 2ENNA 1W3SA 2NU3I 1SGNI 2ORVA 2FNFX 2JZMA 1TURA 1OMUA 2JXDA 2JA1A 1IY5A 1PJUA 1Y1BA 1CSOI 1XX6A 1OYVI 3UGIA 4E1RA 2QQCA 1PTQA 2ROWA 1R0RI 5FUXA 3UEYA 2NU1I 1BUSA 4JCVE 1TGSI 2P6AC 1SGDI 1TUSA 2B8TA 1KBEA 1NUBA 4GI3C 2M5XA 2ELIA 3BJIA 3UGDA 1PCEA 1Z7KB 2OVOA 2NU0I 1TIHA 2SGDI 2V1CC 2WVJA 2F3CI 1HDLA 3E59A 2E5RA 2J9RA 1XBTA 2KMPA 1UUCA 4A24A 3UEJA 1FAQA 1MT1A 5JHWC 2QQEA 4UXIA 1CT2I 2N52A 2E73A 4B6DA 1SGQI 5FUVA 2V1CA 3OVOA 1CGJI 1TBOA 2BUSA 3B4VC 4FKDA 2SGEI 2SGQI 5CCLA 2KMRA 5HI7A 1PTRA 2CJSC 2NU2I 1R79A 1M8CA 1OVOA 1HPTA 2OD1A 1RFHA 1X4SA 3OXFA 2J87A 1H0ZA 2LEOA 1YU6C 1DS2I 2B0UC 4OVOA 1XA6A 1SGYI 5EX0A 1TBNA 3E2IA 3QWPA 2GVIA 1CT4I 2LUYA 1V1HA 2VRWB 5FUWA 1FYBA 2WCYA 2KMOA 3D00A 5DAEA 3KY9A 3OXGA 1U5KA 3VDUA 1SGEI 1UVFA 1N13A 2ODDA 2ORWA 3RU0A 1KBFA 1DS3I 2N71A 1OMTA 1IY6A 3VDPA 2JYYA 1TOTA 2K9HA 1PPFI 2GKVA 1SGRI 1W4RA 1LR9A 2L7XA 2YUUA 3UFFA 2KMQA 1AN1I 1FARA 3UGLA 2N1AB 4SGBI 5EX3A 1KMAA 2A20A 2ARPF 3FC3A 3QTLD 1CT0I 2QQDA 2UZ3A 3SGQI 1M8BA 3GOXA 1LR8A 1CE3A 5CCMA 1X74A 2GKRI 3MEKA 1CGII 1VDDA 1Y8FA 2ENZA 3PDNA 4HGUA 4UXHA 1TBQR 3SGBI 3SEKC 2W0TA 5FUYA 5HQ8A 2KCXA 1YTPA 3CXLA 2YQPA 2N17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FKD A;  5FUX A;  1TBO A;  3UEY A;  1W4R A;  2YUU A;  2QPO A;  1PTR A;  3UFF A;  3UGL A;  2B8T A;  1FAR A;  1R79 A;  1KBE A;  3BJI A;  1RFH A;  2ELI A;  3UGD A;  2J87 A;  4UXJ A;  3CXL A;  2WVJ A;  2DB6 A;  2QQ0 A;  1XA6 A;  1TBN A;  3E2I A;  2J9R A;  2ROW A;  1XBT A;  2GVI A;  2UZ3 A;  4L9M A;  2VRW B;  5FUW A;  3UEJ A;  1FAQ A;  2ENN A;  2ENZ A;  4UXH A;  1Y8F A;  3KY9 A;  2ORV A;  2FNF X;  2JA1 A;  2QQE A;  4UXI A;  2ORW A;  1XX6 A;  5FUY A;  3UGI A;  2E73 A;  4B6D A;  1KBF A;  1PTQ A;  5FUV A; 
#chains in the Genus database with same CATH topology
 1WGT A;  1UVG A;  1LR7 A;  2L8E A;  3VE5 A;  2GKT I;  1V1I A;  2QPO A;  2JW6 A;  3OXL A;  5E3P A;  1TBR R;  3TO6 A;  2UVO A;  2SGF I;  4UXJ A;  3TJQ A;  4E1P A;  1SGP I;  2DIP A;  2NU4 I;  1IW4 A;  3FSX A;  1CHO I;  2DB6 A;  2QQ0 A;  2ERW A;  2SGP I;  1BMO A;  3OL0 A;  1HJA I;  1Y1C A;  2LB7 A;  4L9M A;  2XRC A;  2RIJ A;  2WGC A;  3HH2 C;  1UHA A;  2V53 A;  2ENN A;  1MJ9 A;  1W3S A;  2NU3 I;  1SGN I;  2ORV A;  2FNF X;  2JZM A;  1TUR A;  5E3R A;  1OMU A;  2JXD A;  2CWH A;  2JA1 A;  1P9G A;  1IY5 A;  1PJU A;  1FY7 A;  1CSO I;  1MJA A;  1Y1B A;  1XX6 A;  1OYV I;  1HEV A;  3UGI A;  4E1R A;  3TOA A;  2QQC A;  1PTQ A;  2ROW A;  1R0R I;  5J8F A;  2GIV A;  5FUX A;  3UEY A;  2NU1 I;  1BUS A;  4JCV E;  1TGS I;  2P6A C;  1SGD I;  1TUS A;  2B8T A;  1KBE A;  1NUB A;  4GI3 C;  2M5X A;  2ELI A;  1MJB A;  3BJI A;  3UGD A;  1NXU A;  1PCE A;  1Z7K B;  2OVO A;  2NU0 I;  1TIH A;  2SGD I;  2V1C C;  2WVJ A;  2F3C I;  1HDL A;  1WKX A;  3UOE A;  3E59 A;  2E5R A;  2J9R A;  1XBT A;  2KMP A;  1UUC A;  4A24 A;  3UEJ A;  1S20 A;  1FAQ A;  1K7V A;  3R5C A;  4AML A;  5J8C A;  1MT1 A;  1ULM A;  5JHW C;  2QQE A;  4UXI A;  9WGA A;  1CT2 I;  2N52 A;  2E73 A;  4B6D A;  1SGQ I;  1K7U A;  2X52 A;  5FUV A;  2V1C A;  3OVO A;  1CGJ I;  1TBO A;  2BUS A;  3B4V C;  3R5B A;  4FKD A;  1P9Z A;  4DNC A;  2SGE I;  2SGQ I;  5CCL A;  2KMR A;  1K7T A;  2CWF A;  5HI7 A;  1PTR A;  1WTJ A;  2CJS C;  2NU2 I;  1R79 A;  1M8C A;  1OVO A;  1HPT A;  2OD1 A;  1RFH A;  1X4S A;  3OXF A;  2DKV A;  2J87 A;  2OU2 A;  3R5D A;  2LEO A;  4WP4 A;  1YU6 C;  1DS2 I;  2B0U C;  2RC4 A;  4OVO A;  1H0Z A;  1XA6 A;  1SGY I;  5EX0 A;  1TBN A;  3E2I A;  3FSY A;  3QWP A;  2GVI A;  1CT4 I;  2LUY A;  1V1H A;  2VRW B;  5FUW A;  1WGC A;  2Y0M A;  1FYB A;  2WCY A;  2KMO A;  3D00 A;  5DAE A;  3KY9 A;  3OXG A;  1U5K A;  5E3Q A;  3VDU A;  1Q9B A;  7WGA A;  1SGE I;  1UVF A;  1N13 A;  2ODD A;  2ORW A;  2PQ8 A;  3RU0 A;  1KBF A;  1DS3 I;  2N71 A;  2X3T A;  1OMT A;  1IY6 A;  3VDP A;  2JYY A;  1TOT A;  2K9H A;  1PPF I;  3TO9 A;  2GKV A;  1SGR I;  1W4R A;  1LR9 A;  2L7X A;  2YUU A;  1ULN A;  2OZU A;  2KMQ A;  1AN1 I;  1FAR A;  3QAH A;  3UGL A;  2N1A B;  3UFF A;  4SGB I;  5EX3 A;  1KMA A;  2A20 A;  2ARP F;  3FC3 A;  3QTL D;  2CWG A;  1CT0 I;  2QQD A;  3TO7 A;  2UZ3 A;  3SGQ I;  1M8B A;  3GOX A;  1LR8 A;  1CE3 A;  5CCM A;  1X74 A;  2GKR I;  3MEK A;  3R5A A;  1CGI I;  1VDD A;  1Y8F A;  2ENZ A;  3PDN A;  4HGU A;  4UXH A;  1ULK A;  1TBQ R;  4MPI A;  3SGB I;  3SEK C;  2W0T A;  1Z2I A;  5FUY A;  3TOB A;  5HQ8 A;  2KCX A;  1YTP A;  3CXL A;  2YQP A;  2N17 A; 
#chains in the Genus database with same CATH homology
 1UVG A;  1LR7 A;  2L8E A;  3VE5 A;  2GKT I;  1V1I A;  2QPO A;  2JW6 A;  3OXL A;  1TBR R;  2SGF I;  4UXJ A;  3TJQ A;  4E1P A;  1SGP I;  2DIP A;  2NU4 I;  1IW4 A;  1CHO I;  2DB6 A;  2QQ0 A;  2ERW A;  2SGP I;  1BMO A;  3OL0 A;  1HJA I;  1Y1C A;  4L9M A;  2XRC A;  3HH2 C;  2V53 A;  2ENN A;  1W3S A;  2NU3 I;  1SGN I;  2ORV A;  2FNF X;  2JZM A;  1TUR A;  1OMU A;  2JXD A;  2JA1 A;  1IY5 A;  1PJU A;  1Y1B A;  1CSO I;  1XX6 A;  1OYV I;  3UGI A;  4E1R A;  2QQC A;  1PTQ A;  2ROW A;  1R0R I;  5FUX A;  3UEY A;  2NU1 I;  1BUS A;  4JCV E;  1TGS I;  2P6A C;  1SGD I;  1TUS A;  2B8T A;  1KBE A;  1NUB A;  4GI3 C;  2M5X A;  2ELI A;  3BJI A;  3UGD A;  1PCE A;  1Z7K B;  2OVO A;  2NU0 I;  1TIH A;  2SGD I;  2V1C C;  2WVJ A;  2F3C I;  1HDL A;  3E59 A;  2E5R A;  2J9R A;  1XBT A;  2KMP A;  1UUC A;  4A24 A;  3UEJ A;  1FAQ A;  1MT1 A;  5JHW C;  2QQE A;  4UXI A;  1CT2 I;  2N52 A;  2E73 A;  4B6D A;  1SGQ I;  5FUV A;  2V1C A;  3OVO A;  1CGJ I;  1TBO A;  2BUS A;  3B4V C;  4FKD A;  2SGE I;  2SGQ I;  5CCL A;  2KMR A;  5HI7 A;  1PTR A;  2CJS C;  2NU2 I;  1R79 A;  1M8C A;  1OVO A;  1HPT A;  2OD1 A;  1RFH A;  1X4S A;  3OXF A;  2J87 A;  1H0Z A;  2LEO A;  1YU6 C;  1DS2 I;  2B0U C;  4OVO A;  1XA6 A;  1SGY I;  5EX0 A;  1TBN A;  3E2I A;  3QWP A;  2GVI A;  1CT4 I;  2LUY A;  1V1H A;  2VRW B;  5FUW A;  1FYB A;  2WCY A;  2KMO A;  3D00 A;  5DAE A;  3KY9 A;  3OXG A;  1U5K A;  3VDU A;  1SGE I;  1UVF A;  1N13 A;  2ODD A;  2ORW A;  3RU0 A;  1KBF A;  1DS3 I;  2N71 A;  1OMT A;  1IY6 A;  3VDP A;  2JYY A;  1TOT A;  2K9H A;  1PPF I;  2GKV A;  1SGR I;  1W4R A;  1LR9 A;  2L7X A;  2YUU A;  3UFF A;  2KMQ A;  1AN1 I;  1FAR A;  3UGL A;  2N1A B;  4SGB I;  5EX3 A;  1KMA A;  2A20 A;  2ARP F;  3FC3 A;  3QTL D;  1CT0 I;  2QQD A;  2UZ3 A;  3SGQ I;  1M8B A;  3GOX A;  1LR8 A;  1CE3 A;  5CCM A;  1X74 A;  2GKR I;  3MEK A;  1CGI I;  1VDD A;  1Y8F A;  2ENZ A;  3PDN A;  4HGU A;  4UXH A;  1TBQ R;  3SGB I;  3SEK C;  2W0T A;  5FUY A;  5HQ8 A;  2KCX A;  1YTP A;  3CXL A;  2YQP A;  2N17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...