1PTRA

Protein kinase c delta cys2 domain complexed with phorbol-13-acetate
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
50
structure length
50
Chain Sequence
HRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Phosphotransferase
molecule keywords PROTEIN KINASE C DELTA TYPE
publication title Crystal structure of the cys2 activator-binding domain of protein kinase C delta in complex with phorbol ester.
pubmed doi rcsb
source organism Mus musculus
total genus 9
structure length 50
sequence length 50
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1995-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1ptrA00
3E2IA 1Y8FA 1XBTA 4UXJA 3UGIA 2ENZA 1XX6A 4UXHA 3BJIA 3UEJA 1TBOA 1TBNA 2GVIA 1R79A 2ORWA 1FAQA 1W4RA 2QPOA 4FKDA 1RFHA 5FUWA 5FUXA 2ENNA 1PTRA 2YUUA 3UEYA 2J87A 3CXLA 3UGLA 5FUVA 3UFFA 1FARA 4UXIA 1KBFA 2JA1A 2E73A 2QQ0A 2QQEA 5FUYA 3UGDA 2UZ3A 4L9MA 2WVJA 1PTQA 2B8TA 4B6DA 2VRWB 1XA6A 2ROWA 2ORVA 3KY9A 2ELIA 2DB6A 2FNFX 1KBEA 2J9RA
chains in the Genus database with same CATH superfamily
4AMLA 1K7TA 1PPFI 2CWHA 1YTPA 1TIHA 2KCXA 4UXHA 1ULMA 2ODDA 4E1PA 1TOTA 1OYVI 2X52A 3SGBI 1S20A 1FAQA 2QPOA 5CCMA 5FUXA 5E3RA 1Q9BA 1CHOI 3R5AA 1PTRA 1V1IA 1ULNA 2NU0I 5E3PA 1HPTA 2X3TA 3OVOA 3RU0A 3HH2C 3UEYA 2JZMA 5EX3A 1FARA 2OD1A 2V1CC 2E73A 2QQ0A 3UGDA 1M8CA 2UZ3A 1PTQA 3VE5A 3OXFA 2JW6A 5E3QA 1OMUA 2B8TA 2L7XA 1MJBA 1SGPI 1UHAA 3D00A 2JXDA 5CCLA 2ORVA 2ERWA 1WTJA 1WGTA 2DB6A 1LR7A 3OXGA 3R5BA 4E1RA 3TO6A 1YU6C 1WKXA 2F3CI 2KMPA 3E2IA 3FSXA 1OMTA 1MT1A 2QQCA 3UGIA 1P9ZA 1TBQR 2CWGA 2ENZA 2SGEI 2V1CA 3QWPA 1HDLA 1SGYI 2Y0MA 1Y1BA 1KMAA 1R79A 1CGJI 1CT0I 5HQ8A 3OXLA 3R5DA 1TBRR 2CWFA 2KMQA 3SEKC 1Y1CA 1TGSI 1UVFA 2KMOA 5J8FA 1VDDA 2L8EA 1X74A 2ARPF 2RC4A 2NU3I 3PDNA 2GIVA 5FUYA 2DKVA 7WGAA 1V1HA 2K9HA 2N1AB 1PJUA 2GKVA 2SGDI 2V53A 3VDUA 1P9GA 1Z2IA 2OZUA 4B6DA 1IY6A 5JHWC 2VRWB 5EX0A 1MJAA 3FSYA 2N71A 1H0ZA 2E5RA 1FY7A 2SGFI 4FKDA 4GI3C 1SGQI 1SGNI 1LR9A 1CE3A 1Y8FA 2A20A 1HJAI 1SGEI 2GKRI 1W3SA 1XX6A 1UVGA 3BJIA 1X4SA 3R5CA 2GVIA 1LR8A 1UUCA 3GOXA 3MEKA 3TOBA 3VDPA 2DIPA 2BUSA 2PQ8A 5FUWA 3TO9A 2YQPA 9WGAA 2YUUA 1OVOA 1TURA 1TUSA 2WGCA 3CXLA 4HGUA 2B0UC 5HI7A 3TO7A 2LUYA 2QQDA 2NU1I 3OL0A 4UXIA 3UFFA 4A24A 1KBFA 1NXUA 2QQEA 5DAEA 2LB7A 2XRCA 1PCEA 1HEVA 2NU2I 4MPIA 1SGRI 1XA6A 1FYBA 2ROWA 2UVOA 4WP4A 4DNCA 2ELIA 1IW4A 1IY5A 1CGII 2GKTI 2CJSC 4SGBI 2J9RA 3E59A 2OVOA 1U5KA 2N52A 1CSOI 1XBTA 2M5XA 4UXJA 3B4VC 3SGQI 3UOEA 1AN1I 2WCYA 2P6AC 1CT2I 1DS2I 3UEJA 5J8CA 1TBOA 1TBNA 2ORWA 4JCVE 3QTLD 1W4RA 2SGPI 2W0TA 3TOAA 1BUSA 1RFHA 2SGQI 1ULKA 2ENNA 2J87A 1R0RI 1Z7KB 3UGLA 1N13A 3QAHA 1K7VA 5FUVA 2N17A 2OU2A 3FC3A 2JA1A 1MJ9A 4L9MA 2KMRA 1CT4I 2WVJA 4OVOA 3TJQA 1DS3I 1BMOA 2NU4I 1K7UA 2JYYA 1SGDI 3KY9A 2LEOA 1NUBA 2FNFX 1KBEA 2RIJA 1WGCA 1M8BA
chains in the Genus database with same CATH topology
1PPFI 1YTPA 1TIHA 2KCXA 4UXHA 4E1PA 2ODDA 1TOTA 1OYVI 3SGBI 1FAQA 2QPOA 5CCMA 5FUXA 1CHOI 1PTRA 1V1IA 2NU0I 1HPTA 3OVOA 3UEYA 3RU0A 3HH2C 2JZMA 5EX3A 1FARA 2OD1A 2V1CC 2E73A 2QQ0A 3UGDA 1M8CA 2UZ3A 1PTQA 3VE5A 3OXFA 2JW6A 1OMUA 2B8TA 2L7XA 1SGPI 3D00A 2JXDA 5CCLA 2ORVA 2ERWA 3OXGA 2DB6A 1LR7A 4E1RA 1YU6C 2F3CI 2KMPA 3E2IA 1OMTA 1MT1A 2QQCA 3UGIA 3QWPA 1TBQR 2ENZA 2SGEI 2V1CA 1HDLA 1SGYI 1Y1BA 1KMAA 1R79A 1CGJI 1CT0I 5HQ8A 3OXLA 1TBRR 2KMQA 3SEKC 1Y1CA 1TGSI 1UVFA 2KMOA 1VDDA 2L8EA 2ARPF 3PDNA 2NU3I 5FUYA 1V1HA 2K9HA 2N1AB 1PJUA 2GKVA 2SGDI 2V53A 3VDUA 4B6DA 1IY6A 5JHWC 2VRWB 5EX0A 2N71A 1H0ZA 2E5RA 2SGFI 4GI3C 4FKDA 1SGQI 1SGNI 1LR9A 1CE3A 1Y8FA 2A20A 1HJAI 1SGEI 2GKRI 1W3SA 1XX6A 1UVGA 3BJIA 1X4SA 2GVIA 1LR8A 1UUCA 3GOXA 3MEKA 3VDPA 2DIPA 2BUSA 5FUWA 2YQPA 2YUUA 1OVOA 1TURA 1TUSA 3CXLA 4HGUA 2B0UC 5HI7A 2LUYA 2QQDA 2NU1I 3OL0A 4UXIA 3UFFA 4A24A 1KBFA 2QQEA 5DAEA 2XRCA 1PCEA 2NU2I 1SGRI 1XA6A 1FYBA 2ROWA 2ELIA 1IW4A 1IY5A 1CGII 2GKTI 2CJSC 4SGBI 2J9RA 3E59A 2OVOA 1U5KA 2N52A 1CSOI 1XBTA 2M5XA 4UXJA 3B4VC 3SGQI 1AN1I 2WCYA 2P6AC 1CT2I 1DS2I 3UEJA 1TBOA 1TBNA 2ORWA 4JCVE 3QTLD 1W4RA 2SGPI 2W0TA 1BUSA 1RFHA 2SGQI 2ENNA 1M8BA 2J87A 1R0RI 1Z7KB 3UGLA 1N13A 5FUVA 2N17A 3FC3A 2JA1A 4L9MA 2KMRA 1CT4I 2WVJA 4OVOA 3TJQA 1DS3I 1BMOA 2NU4I 2JYYA 1SGDI 3KY9A 2LEOA 1NUBA 2FNFX 1KBEA 1X74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E2I A;  1Y8F A;  1XBT A;  4UXJ A;  3UGI A;  2ENZ A;  1XX6 A;  4UXH A;  3BJI A;  3UEJ A;  1TBO A;  1TBN A;  2GVI A;  1R79 A;  2ORW A;  1FAQ A;  1W4R A;  2QPO A;  4FKD A;  1RFH A;  5FUW A;  5FUX A;  2ENN A;  1PTR A;  2YUU A;  3UEY A;  2J87 A;  3CXL A;  3UGL A;  5FUV A;  3UFF A;  1FAR A;  4UXI A;  1KBF A;  2JA1 A;  2E73 A;  2QQ0 A;  2QQE A;  5FUY A;  3UGD A;  2UZ3 A;  4L9M A;  2WVJ A;  1PTQ A;  2B8T A;  4B6D A;  2VRW B;  1XA6 A;  2ROW A;  2ORV A;  3KY9 A;  2ELI A;  2DB6 A;  2FNF X;  1KBE A;  2J9R A; 
#chains in the Genus database with same CATH topology
 4AML A;  1K7T A;  1PPF I;  2CWH A;  1YTP A;  1TIH A;  2KCX A;  4UXH A;  1ULM A;  2ODD A;  4E1P A;  1TOT A;  1OYV I;  2X52 A;  3SGB I;  1S20 A;  1FAQ A;  2QPO A;  5CCM A;  5FUX A;  5E3R A;  1Q9B A;  1CHO I;  3R5A A;  1PTR A;  1V1I A;  1ULN A;  2NU0 I;  5E3P A;  1HPT A;  2X3T A;  3OVO A;  3RU0 A;  3HH2 C;  3UEY A;  2JZM A;  5EX3 A;  1FAR A;  2OD1 A;  2V1C C;  2E73 A;  2QQ0 A;  3UGD A;  1M8C A;  2UZ3 A;  1PTQ A;  3VE5 A;  3OXF A;  2JW6 A;  5E3Q A;  1OMU A;  2B8T A;  2L7X A;  1MJB A;  1SGP I;  1UHA A;  3D00 A;  2JXD A;  5CCL A;  2ORV A;  2ERW A;  1WTJ A;  1WGT A;  2DB6 A;  1LR7 A;  3OXG A;  3R5B A;  4E1R A;  3TO6 A;  1YU6 C;  1WKX A;  2F3C I;  2KMP A;  3E2I A;  3FSX A;  1OMT A;  1MT1 A;  2QQC A;  3UGI A;  1P9Z A;  1TBQ R;  2CWG A;  2ENZ A;  2SGE I;  2V1C A;  3QWP A;  1HDL A;  1SGY I;  2Y0M A;  1Y1B A;  1KMA A;  1R79 A;  1CGJ I;  1CT0 I;  5HQ8 A;  3OXL A;  3R5D A;  1TBR R;  2CWF A;  2KMQ A;  3SEK C;  1Y1C A;  1TGS I;  1UVF A;  2KMO A;  5J8F A;  1VDD A;  2L8E A;  1X74 A;  2ARP F;  2RC4 A;  2NU3 I;  3PDN A;  2GIV A;  5FUY A;  2DKV A;  7WGA A;  1V1H A;  2K9H A;  2N1A B;  1PJU A;  2GKV A;  2SGD I;  2V53 A;  3VDU A;  1P9G A;  1Z2I A;  2OZU A;  4B6D A;  1IY6 A;  5JHW C;  2VRW B;  5EX0 A;  1MJA A;  3FSY A;  2N71 A;  1H0Z A;  2E5R A;  1FY7 A;  2SGF I;  4FKD A;  4GI3 C;  1SGQ I;  1SGN I;  1LR9 A;  1CE3 A;  1Y8F A;  2A20 A;  1HJA I;  1SGE I;  2GKR I;  1W3S A;  1XX6 A;  1UVG A;  3BJI A;  1X4S A;  3R5C A;  2GVI A;  1LR8 A;  1UUC A;  3GOX A;  3MEK A;  3TOB A;  3VDP A;  2DIP A;  2BUS A;  2PQ8 A;  5FUW A;  3TO9 A;  2YQP A;  9WGA A;  2YUU A;  1OVO A;  1TUR A;  1TUS A;  2WGC A;  3CXL A;  4HGU A;  2B0U C;  5HI7 A;  3TO7 A;  2LUY A;  2QQD A;  2NU1 I;  3OL0 A;  4UXI A;  3UFF A;  4A24 A;  1KBF A;  1NXU A;  2QQE A;  5DAE A;  2LB7 A;  2XRC A;  1PCE A;  1HEV A;  2NU2 I;  4MPI A;  1SGR I;  1XA6 A;  1FYB A;  2ROW A;  2UVO A;  4WP4 A;  4DNC A;  2ELI A;  1IW4 A;  1IY5 A;  1CGI I;  2GKT I;  2CJS C;  4SGB I;  2J9R A;  3E59 A;  2OVO A;  1U5K A;  2N52 A;  1CSO I;  1XBT A;  2M5X A;  4UXJ A;  3B4V C;  3SGQ I;  3UOE A;  1AN1 I;  2WCY A;  2P6A C;  1CT2 I;  1DS2 I;  3UEJ A;  5J8C A;  1TBO A;  1TBN A;  2ORW A;  4JCV E;  3QTL D;  1W4R A;  2SGP I;  2W0T A;  3TOA A;  1BUS A;  1RFH A;  2SGQ I;  1ULK A;  2ENN A;  2J87 A;  1R0R I;  1Z7K B;  3UGL A;  1N13 A;  3QAH A;  1K7V A;  5FUV A;  2N17 A;  2OU2 A;  3FC3 A;  2JA1 A;  1MJ9 A;  4L9M A;  2KMR A;  1CT4 I;  2WVJ A;  4OVO A;  3TJQ A;  1DS3 I;  1BMO A;  2NU4 I;  1K7U A;  2JYY A;  1SGD I;  3KY9 A;  2LEO A;  1NUB A;  2FNF X;  1KBE A;  2RIJ A;  1WGC A;  1M8B A; 
#chains in the Genus database with same CATH homology
 1PPF I;  1YTP A;  1TIH A;  2KCX A;  4UXH A;  4E1P A;  2ODD A;  1TOT A;  1OYV I;  3SGB I;  1FAQ A;  2QPO A;  5CCM A;  5FUX A;  1CHO I;  1PTR A;  1V1I A;  2NU0 I;  1HPT A;  3OVO A;  3UEY A;  3RU0 A;  3HH2 C;  2JZM A;  5EX3 A;  1FAR A;  2OD1 A;  2V1C C;  2E73 A;  2QQ0 A;  3UGD A;  1M8C A;  2UZ3 A;  1PTQ A;  3VE5 A;  3OXF A;  2JW6 A;  1OMU A;  2B8T A;  2L7X A;  1SGP I;  3D00 A;  2JXD A;  5CCL A;  2ORV A;  2ERW A;  3OXG A;  2DB6 A;  1LR7 A;  4E1R A;  1YU6 C;  2F3C I;  2KMP A;  3E2I A;  1OMT A;  1MT1 A;  2QQC A;  3UGI A;  3QWP A;  1TBQ R;  2ENZ A;  2SGE I;  2V1C A;  1HDL A;  1SGY I;  1Y1B A;  1KMA A;  1R79 A;  1CGJ I;  1CT0 I;  5HQ8 A;  3OXL A;  1TBR R;  2KMQ A;  3SEK C;  1Y1C A;  1TGS I;  1UVF A;  2KMO A;  1VDD A;  2L8E A;  2ARP F;  3PDN A;  2NU3 I;  5FUY A;  1V1H A;  2K9H A;  2N1A B;  1PJU A;  2GKV A;  2SGD I;  2V53 A;  3VDU A;  4B6D A;  1IY6 A;  5JHW C;  2VRW B;  5EX0 A;  2N71 A;  1H0Z A;  2E5R A;  2SGF I;  4GI3 C;  4FKD A;  1SGQ I;  1SGN I;  1LR9 A;  1CE3 A;  1Y8F A;  2A20 A;  1HJA I;  1SGE I;  2GKR I;  1W3S A;  1XX6 A;  1UVG A;  3BJI A;  1X4S A;  2GVI A;  1LR8 A;  1UUC A;  3GOX A;  3MEK A;  3VDP A;  2DIP A;  2BUS A;  5FUW A;  2YQP A;  2YUU A;  1OVO A;  1TUR A;  1TUS A;  3CXL A;  4HGU A;  2B0U C;  5HI7 A;  2LUY A;  2QQD A;  2NU1 I;  3OL0 A;  4UXI A;  3UFF A;  4A24 A;  1KBF A;  2QQE A;  5DAE A;  2XRC A;  1PCE A;  2NU2 I;  1SGR I;  1XA6 A;  1FYB A;  2ROW A;  2ELI A;  1IW4 A;  1IY5 A;  1CGI I;  2GKT I;  2CJS C;  4SGB I;  2J9R A;  3E59 A;  2OVO A;  1U5K A;  2N52 A;  1CSO I;  1XBT A;  2M5X A;  4UXJ A;  3B4V C;  3SGQ I;  1AN1 I;  2WCY A;  2P6A C;  1CT2 I;  1DS2 I;  3UEJ A;  1TBO A;  1TBN A;  2ORW A;  4JCV E;  3QTL D;  1W4R A;  2SGP I;  2W0T A;  1BUS A;  1RFH A;  2SGQ I;  2ENN A;  1M8B A;  2J87 A;  1R0R I;  1Z7K B;  3UGL A;  1N13 A;  5FUV A;  2N17 A;  3FC3 A;  2JA1 A;  4L9M A;  2KMR A;  1CT4 I;  2WVJ A;  4OVO A;  3TJQ A;  1DS3 I;  1BMO A;  2NU4 I;  2JYY A;  1SGD I;  3KY9 A;  2LEO A;  1NUB A;  2FNF X;  1KBE A;  1X74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...