4E1PA

Crystal structure of the dimerization domain of lsr2 from mycobacterium tuberculosis in the p 1 21 1 space group
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
55
structure length
55
Chain Sequence
KVTVTLVDDFDGSGAADETVEFGLDGVTYEIDLSTKNATKLRGDLKQWVAAGRRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein lsr2
publication title The structure of the oligomerization domain of Lsr2 from Mycobacterium tuberculosis reveals a mechanism for chromosome organization and protection.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
total genus 12
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.230 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4e1pA00
4E1PA 4E1RA
chains in the Genus database with same CATH superfamily
2QQEA 2RC4A 5EX0A 2B8TA 2QQCA 1K7UA 1LR8A 1N13A 2VRWB 5E3QA 1TOTA 1V1IA 1P9ZA 1TBOA 1DS3I 1WTJA 2N71A 2SGFI 3OXGA 2JZMA 2OU2A 1R0RI 1NUBA 2P6AC 2J87A 2WGCA 2GKVA 3TOAA 2ERWA 1M8CA 1LR7A 3OXLA 4AMLA 9WGAA 1HJAI 1HPTA 3SGBI 5DAEA 1SGQI 1SGRI 2BUSA 3E59A 3D00A 3QAHA 2SGQI 3SGQI 3VE5A 4UXHA 1WKXA 2DKVA 5E3PA 1OMTA 1SGDI 1MJAA 1CT0I 4L9MA 2N17A 5J8FA 1ULNA 4B6DA 2ARPF 3PDNA 2JYYA 1BMOA 1CGJI 1PTQA 2JA1A 1BUSA 1XA6A 3TO9A 3MEKA 1Y1BA 1WGCA 1ULMA 2FNFX 3QWPA 1XBTA 2UVOA 2KCXA 3CXLA 2CJSC 4FKDA 4E1PA 3OVOA 1X4SA 1UVGA 2ELIA 1IW4A 2YQPA 1TIHA 2YUUA 4MPIA 1TBNA 3R5BA 1K7TA 1PPFI 3UEJA 2CWFA 1TGSI 1Q9BA 2A20A 2OZUA 1TBRR 7WGAA 1FYBA 3RU0A 1ULKA 3FC3A 4E1RA 4HGUA 2NU3I 2N52A 1TBQR 1P9GA 1U5KA 2ENNA 2X3TA 1W4RA 2ENZA 2W0TA 1OYVI 2SGPI 2JW6A 2E5RA 1S20A 1X74A 3KY9A 1LR9A 2CWHA 1VDDA 3UEYA 1SGPI 5EX3A 2J9RA 2JXDA 2XRCA 1FAQA 1OVOA 5JHWC 2PQ8A 1UVFA 1Y8FA 2CWGA 3E2IA 2SGDI 2V1CA 3TJQA 5J8CA 1TURA 1CE3A 1OMUA 3UOEA 3OL0A 2GVIA 1RFHA 3R5DA 3FSYA 2GKTI 2DIPA 2M5XA 1SGYI 5FUXA 2E73A 1XX6A 1UHAA 2QQDA 1H0ZA 2V1CC 1MT1A 1TUSA 1NXUA 1YU6C 2WVJA 2LEOA 2NU4I 4DNCA 1KBFA 2ODDA 1CT2I 3TO7A 1SGNI 3HH2C 3UGIA 5HI7A 2N1AB 5HQ8A 2B0UC 2L7XA 3QTLD 4OVOA 2Y0MA 3B4VC 1W3SA 5FUYA 3TOBA 1CSOI 1YTPA 2KMOA 2GIVA 3TO6A 2SGEI 1R79A 3SEKC 2GKRI 2LUYA 4WP4A 2NU0I 1DS2I 4JCVE 1K7VA 1PTRA 2KMRA 2NU1I 2OD1A 2UZ3A 1CHOI 3FSXA 1MJ9A 2L8EA 1MJBA 4GI3C 1CT4I 1SGEI 5FUWA 1AN1I 2RIJA 1CGII 4SGBI 1WGTA 1KMAA 1M8BA 3R5CA 2ORVA 2ROWA 1KBEA 3R5AA 2X52A 5FUVA 1HEVA 3UGDA 1IY6A 2F3CI 2KMPA 3VDPA 3OXFA 3UFFA 5CCLA 3GOXA 4UXIA 4UXJA 2V53A 3UGLA 1FY7A 1IY5A 2OVOA 1Z7KB 1HDLA 2ORWA 2QQ0A 4A24A 1V1HA 3VDUA 1Y1CA 1PCEA 1Z2IA 5CCMA 1FARA 2LB7A 2NU2I 2KMQA 2DB6A 2QPOA 3BJIA 5E3RA 2K9HA 2WCYA 1UUCA 1PJUA
chains in the Genus database with same CATH topology
2QQEA 2B8TA 2QQCA 1LR8A 1N13A 2VRWB 1TOTA 1V1IA 2N71A 1TBOA 1DS3I 3OXGA 2SGFI 2JZMA 1R0RI 1NUBA 2P6AC 2J87A 2GKVA 2ERWA 1M8CA 1LR7A 3OXLA 1HJAI 1HPTA 3SGBI 5DAEA 1SGQI 1SGRI 2BUSA 3E59A 3D00A 3SGQI 2SGQI 3VE5A 4UXHA 1OMTA 1SGDI 1CT0I 4L9MA 2N17A 4B6DA 2ARPF 3PDNA 2JYYA 1BMOA 1CGJI 1PTQA 2JA1A 1BUSA 1XA6A 3MEKA 1Y1BA 2FNFX 3QWPA 1XBTA 3CXLA 2KCXA 4FKDA 2CJSC 4E1PA 3OVOA 1X4SA 1UVGA 2ELIA 1IW4A 2YQPA 1TIHA 2YUUA 1TBNA 1PPFI 3UEJA 1TGSI 2A20A 1FYBA 1TBRR 3RU0A 3FC3A 4E1RA 4HGUA 2NU3I 2N52A 1TBQR 1U5KA 2ENNA 1W4RA 2ENZA 2W0TA 1OYVI 2SGPI 2JW6A 2E5RA 1X74A 3KY9A 5EX0A 1LR9A 3UEYA 1VDDA 1SGPI 5EX3A 2J9RA 2JXDA 2XRCA 1FAQA 1OVOA 5JHWC 1UVFA 1Y8FA 3E2IA 2SGDI 2V1CA 3TJQA 1TURA 1CE3A 1OMUA 3OL0A 2GVIA 1RFHA 2GKTI 2DIPA 2M5XA 1SGYI 5FUXA 2E73A 1XX6A 2QQDA 1H0ZA 2V1CC 1MT1A 1TUSA 2WVJA 1YU6C 2LEOA 2NU4I 1KBFA 2ODDA 1CT2I 1SGNI 3HH2C 3UGIA 5HI7A 2N1AB 5HQ8A 2B0UC 2L7XA 3QTLD 4OVOA 3B4VC 1W3SA 5FUYA 1CSOI 1YTPA 2KMOA 2SGEI 1R79A 3SEKC 2GKRI 2LUYA 2NU0I 1DS2I 4JCVE 1PTRA 2KMRA 2NU1I 2OD1A 2UZ3A 1CHOI 2L8EA 4GI3C 1CT4I 1SGEI 5FUWA 1AN1I 1CGII 4SGBI 1KMAA 1M8BA 2ORVA 2ROWA 1KBEA 5FUVA 3UGDA 1IY6A 2F3CI 2KMPA 3VDPA 3OXFA 3UFFA 5CCLA 3GOXA 4UXIA 4UXJA 2V53A 3UGLA 1IY5A 2OVOA 1Z7KB 1HDLA 2ORWA 2QQ0A 4A24A 1V1HA 3VDUA 1Y1CA 1PCEA 5CCMA 1FARA 2NU2I 2QPOA 2KMQA 2DB6A 3BJIA 2K9HA 2WCYA 1UUCA 1PJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E1P A;  4E1R A; 
#chains in the Genus database with same CATH topology
 2QQE A;  2RC4 A;  5EX0 A;  2B8T A;  2QQC A;  1K7U A;  1LR8 A;  1N13 A;  2VRW B;  5E3Q A;  1TOT A;  1V1I A;  1P9Z A;  1TBO A;  1DS3 I;  1WTJ A;  2N71 A;  2SGF I;  3OXG A;  2JZM A;  2OU2 A;  1R0R I;  1NUB A;  2P6A C;  2J87 A;  2WGC A;  2GKV A;  3TOA A;  2ERW A;  1M8C A;  1LR7 A;  3OXL A;  4AML A;  9WGA A;  1HJA I;  1HPT A;  3SGB I;  5DAE A;  1SGQ I;  1SGR I;  2BUS A;  3E59 A;  3D00 A;  3QAH A;  2SGQ I;  3SGQ I;  3VE5 A;  4UXH A;  1WKX A;  2DKV A;  5E3P A;  1OMT A;  1SGD I;  1MJA A;  1CT0 I;  4L9M A;  2N17 A;  5J8F A;  1ULN A;  4B6D A;  2ARP F;  3PDN A;  2JYY A;  1BMO A;  1CGJ I;  1PTQ A;  2JA1 A;  1BUS A;  1XA6 A;  3TO9 A;  3MEK A;  1Y1B A;  1WGC A;  1ULM A;  2FNF X;  3QWP A;  1XBT A;  2UVO A;  2KCX A;  3CXL A;  2CJS C;  4FKD A;  4E1P A;  3OVO A;  1X4S A;  1UVG A;  2ELI A;  1IW4 A;  2YQP A;  1TIH A;  2YUU A;  4MPI A;  1TBN A;  3R5B A;  1K7T A;  1PPF I;  3UEJ A;  2CWF A;  1TGS I;  1Q9B A;  2A20 A;  2OZU A;  1TBR R;  7WGA A;  1FYB A;  3RU0 A;  1ULK A;  3FC3 A;  4E1R A;  4HGU A;  2NU3 I;  2N52 A;  1TBQ R;  1P9G A;  1U5K A;  2ENN A;  2X3T A;  1W4R A;  2ENZ A;  2W0T A;  1OYV I;  2SGP I;  2JW6 A;  2E5R A;  1S20 A;  1X74 A;  3KY9 A;  1LR9 A;  2CWH A;  1VDD A;  3UEY A;  1SGP I;  5EX3 A;  2J9R A;  2JXD A;  2XRC A;  1FAQ A;  1OVO A;  5JHW C;  2PQ8 A;  1UVF A;  1Y8F A;  2CWG A;  3E2I A;  2SGD I;  2V1C A;  3TJQ A;  5J8C A;  1TUR A;  1CE3 A;  1OMU A;  3UOE A;  3OL0 A;  2GVI A;  1RFH A;  3R5D A;  3FSY A;  2GKT I;  2DIP A;  2M5X A;  1SGY I;  5FUX A;  2E73 A;  1XX6 A;  1UHA A;  2QQD A;  1H0Z A;  2V1C C;  1MT1 A;  1TUS A;  1NXU A;  1YU6 C;  2WVJ A;  2LEO A;  2NU4 I;  4DNC A;  1KBF A;  2ODD A;  1CT2 I;  3TO7 A;  1SGN I;  3HH2 C;  3UGI A;  5HI7 A;  2N1A B;  5HQ8 A;  2B0U C;  2L7X A;  3QTL D;  4OVO A;  2Y0M A;  3B4V C;  1W3S A;  5FUY A;  3TOB A;  1CSO I;  1YTP A;  2KMO A;  2GIV A;  3TO6 A;  2SGE I;  1R79 A;  3SEK C;  2GKR I;  2LUY A;  4WP4 A;  2NU0 I;  1DS2 I;  4JCV E;  1K7V A;  1PTR A;  2KMR A;  2NU1 I;  2OD1 A;  2UZ3 A;  1CHO I;  3FSX A;  1MJ9 A;  2L8E A;  1MJB A;  4GI3 C;  1CT4 I;  1SGE I;  5FUW A;  1AN1 I;  2RIJ A;  1CGI I;  4SGB I;  1WGT A;  1KMA A;  1M8B A;  3R5C A;  2ORV A;  2ROW A;  1KBE A;  3R5A A;  2X52 A;  5FUV A;  1HEV A;  3UGD A;  1IY6 A;  2F3C I;  2KMP A;  3VDP A;  3OXF A;  3UFF A;  5CCL A;  3GOX A;  4UXI A;  4UXJ A;  2V53 A;  3UGL A;  1FY7 A;  1IY5 A;  2OVO A;  1Z7K B;  1HDL A;  2ORW A;  2QQ0 A;  4A24 A;  1V1H A;  3VDU A;  1Y1C A;  1PCE A;  1Z2I A;  5CCM A;  1FAR A;  2LB7 A;  2NU2 I;  2KMQ A;  2DB6 A;  2QPO A;  3BJI A;  5E3R A;  2K9H A;  2WCY A;  1UUC A;  1PJU A; 
#chains in the Genus database with same CATH homology
 2QQE A;  2B8T A;  2QQC A;  1LR8 A;  1N13 A;  2VRW B;  1TOT A;  1V1I A;  2N71 A;  1TBO A;  1DS3 I;  3OXG A;  2SGF I;  2JZM A;  1R0R I;  1NUB A;  2P6A C;  2J87 A;  2GKV A;  2ERW A;  1M8C A;  1LR7 A;  3OXL A;  1HJA I;  1HPT A;  3SGB I;  5DAE A;  1SGQ I;  1SGR I;  2BUS A;  3E59 A;  3D00 A;  3SGQ I;  2SGQ I;  3VE5 A;  4UXH A;  1OMT A;  1SGD I;  1CT0 I;  4L9M A;  2N17 A;  4B6D A;  2ARP F;  3PDN A;  2JYY A;  1BMO A;  1CGJ I;  1PTQ A;  2JA1 A;  1BUS A;  1XA6 A;  3MEK A;  1Y1B A;  2FNF X;  3QWP A;  1XBT A;  3CXL A;  2KCX A;  4FKD A;  2CJS C;  4E1P A;  3OVO A;  1X4S A;  1UVG A;  2ELI A;  1IW4 A;  2YQP A;  1TIH A;  2YUU A;  1TBN A;  1PPF I;  3UEJ A;  1TGS I;  2A20 A;  1FYB A;  1TBR R;  3RU0 A;  3FC3 A;  4E1R A;  4HGU A;  2NU3 I;  2N52 A;  1TBQ R;  1U5K A;  2ENN A;  1W4R A;  2ENZ A;  2W0T A;  1OYV I;  2SGP I;  2JW6 A;  2E5R A;  1X74 A;  3KY9 A;  5EX0 A;  1LR9 A;  3UEY A;  1VDD A;  1SGP I;  5EX3 A;  2J9R A;  2JXD A;  2XRC A;  1FAQ A;  1OVO A;  5JHW C;  1UVF A;  1Y8F A;  3E2I A;  2SGD I;  2V1C A;  3TJQ A;  1TUR A;  1CE3 A;  1OMU A;  3OL0 A;  2GVI A;  1RFH A;  2GKT I;  2DIP A;  2M5X A;  1SGY I;  5FUX A;  2E73 A;  1XX6 A;  2QQD A;  1H0Z A;  2V1C C;  1MT1 A;  1TUS A;  2WVJ A;  1YU6 C;  2LEO A;  2NU4 I;  1KBF A;  2ODD A;  1CT2 I;  1SGN I;  3HH2 C;  3UGI A;  5HI7 A;  2N1A B;  5HQ8 A;  2B0U C;  2L7X A;  3QTL D;  4OVO A;  3B4V C;  1W3S A;  5FUY A;  1CSO I;  1YTP A;  2KMO A;  2SGE I;  1R79 A;  3SEK C;  2GKR I;  2LUY A;  2NU0 I;  1DS2 I;  4JCV E;  1PTR A;  2KMR A;  2NU1 I;  2OD1 A;  2UZ3 A;  1CHO I;  2L8E A;  4GI3 C;  1CT4 I;  1SGE I;  5FUW A;  1AN1 I;  1CGI I;  4SGB I;  1KMA A;  1M8B A;  2ORV A;  2ROW A;  1KBE A;  5FUV A;  3UGD A;  1IY6 A;  2F3C I;  2KMP A;  3VDP A;  3OXF A;  3UFF A;  5CCL A;  3GOX A;  4UXI A;  4UXJ A;  2V53 A;  3UGL A;  1IY5 A;  2OVO A;  1Z7K B;  1HDL A;  2ORW A;  2QQ0 A;  4A24 A;  1V1H A;  3VDU A;  1Y1C A;  1PCE A;  5CCM A;  1FAR A;  2NU2 I;  2QPO A;  2KMQ A;  2DB6 A;  3BJI A;  2K9H A;  2WCY A;  1UUC A;  1PJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...