4E1PA

Crystal structure of the dimerization domain of lsr2 from mycobacterium tuberculosis in the p 1 21 1 space group
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
55
structure length
55
Chain Sequence
KVTVTLVDDFDGSGAADETVEFGLDGVTYEIDLSTKNATKLRGDLKQWVAAGRRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Protein lsr2
publication title The structure of the oligomerization domain of Lsr2 from Mycobacterium tuberculosis reveals a mechanism for chromosome organization and protection.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 12
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.230 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4e1pA00
4E1PA 4E1RA
chains in the Genus database with same CATH superfamily
2ERWA 1Y8FA 1YU6C 3QAHA 5HI7A 1LR8A 2NU1I 2JYYA 4MPIA 2N52A 2QQEA 1W3SA 1S20A 2WGCA 2N71A 1MT1A 2OU2A 3VDPA 5J8CA 3GOXA 2QQ0A 1TBOA 2V1CC 2SGQI 2ORVA 1FYBA 3KY9A 3TO6A 3D00A 1BMOA 1Y1CA 2LUYA 7WGAA 2P6AC 3HH2C 4HGUA 3FC3A 1WGTA 1PCEA 2CWFA 2DIPA 3BJIA 2YUUA 3TO9A 3R5CA 2L7XA 3UEYA 2B0UC 2K9HA 4FKDA 5E3RA 1HEVA 1CT0I 2ENNA 3UEJA 4UXIA 3QWPA 1TOTA 1WKXA 1W4RA 2JXDA 2JZMA 2X52A 2V53A 1SGQI 1TGSI 2ARPF 4L9MA 1CGJI 2LB7A 1K7UA 3UGIA 2YQPA 3TO7A 4E1RA 1AN1I 5J8FA 2SGFI 1MJAA 1TIHA 2XRCA 2GKVA 2RC4A 4OVOA 4AMLA 5FUVA 4DNCA 4B6DA 2OD1A 3R5DA 4A24A 3RU0A 2KCXA 5HQ8A 1KMAA 3SEKC 1RFHA 1SGPI 2UVOA 2KMOA 2M5XA 1TBQR 2SGDI 5EX0A 2CWGA 2UZ3A 1Q9BA 3VE5A 1YTPA 1Y1BA 2J9RA 3R5AA 1MJBA 2E5RA 2DKVA 3VDUA 1UHAA 1XA6A 1OMUA 1CT4I 1VDDA 2L8EA 3OXGA 2ENZA 1BUSA 1PJUA 1K7VA 1X74A 2V1CA 2JW6A 1ULKA 1IY5A 1CGII 1TBNA 1XBTA 1P9ZA 2OVOA 1Z7KB 2KMQA 4SGBI 2SGEI 1WGCA 5E3QA 5JHWC 2CJSC 1N13A 1ULNA 1U5KA 3E2IA 1NUBA 4JCVE 1SGRI 2DB6A 2QQDA 1SGEI 4WP4A 1LR9A 1NXUA 1KBEA 3R5BA 2GKTI 2GKRI 2F3CI 1FAQA 2BUSA 2WCYA 5FUYA 1V1IA 1TBRR 1CSOI 5FUXA 1IY6A 1ULMA 2VRWB 1HJAI 3SGQI 1UVFA 3FSXA 5DAEA 1FY7A 5CCMA 2PQ8A 1SGYI 2GIVA 2QQCA 3FSYA 1R0RI 4UXHA 4UXJA 2NU3I 2W0TA 5EX3A 3E59A 5E3PA 2LEOA 3OL0A 1DS3I 1CHOI 1PTQA 1UUCA 1Z2IA 2A20A 2ORWA 2WVJA 3OVOA 3QTLD 1LR7A 1H0ZA 2JA1A 2NU0I 2RIJA 2OZUA 4E1PA 3CXLA 1FARA 1CE3A 3UOEA 3PDNA 5FUWA 3TOBA 1V1HA 1KBFA 3SGBI 2ELIA 2N17A 2NU2I 1UVGA 2GVIA 1XX6A 1PPFI 2KMPA 2ROWA 2SGPI 1OYVI 1CT2I 5CCLA 3TOAA 1X4SA 2N1AB 3UFFA 1MJ9A 2Y0MA 1PTRA 2FNFX 1M8BA 1OMTA 1IW4A 1M8CA 3OXLA 1DS2I 1SGNI 2KMRA 2B8TA 2E73A 1HDLA 4GI3C 1SGDI 2CWHA 2QPOA 3UGDA 2J87A 1TURA 1HPTA 3UGLA 1P9GA 1WTJA 1OVOA 1R79A 2X3TA 3B4VC 3MEKA 3OXFA 2NU4I 2ODDA 1TUSA 9WGAA 3TJQA 1K7TA
chains in the Genus database with same CATH topology
2ERWA 1Y8FA 1YU6C 5HI7A 1LR8A 2NU1I 2JYYA 2N52A 2QQEA 1W3SA 2N71A 1MT1A 3VDPA 3GOXA 2QQ0A 1TBOA 2V1CC 2SGQI 2ORVA 1FYBA 3KY9A 3D00A 1BMOA 1Y1CA 2LUYA 2P6AC 3HH2C 4HGUA 3FC3A 1PCEA 3BJIA 2DIPA 2YUUA 2L7XA 3UEYA 2B0UC 2K9HA 4FKDA 1CT0I 2ENNA 3UEJA 4UXIA 3QWPA 1TOTA 1W4RA 2JXDA 2JZMA 2V53A 1SGQI 1TGSI 2ARPF 4L9MA 1CGJI 3UGIA 2YQPA 4E1RA 1AN1I 2SGFI 1TIHA 2XRCA 2GKVA 4OVOA 5FUVA 4B6DA 2OD1A 4A24A 3RU0A 2KCXA 5HQ8A 1KMAA 3SEKC 1RFHA 1SGPI 5EX0A 2KMOA 2M5XA 1TBQR 2SGDI 2UZ3A 3VE5A 1YTPA 1Y1BA 2J9RA 2E5RA 3VDUA 1XA6A 1OMUA 1CT4I 1VDDA 2L8EA 3OXGA 2ENZA 1BUSA 1X74A 1PJUA 2V1CA 2JW6A 1IY5A 1CGII 1TBNA 1XBTA 2OVOA 4SGBI 1Z7KB 2KMQA 5JHWC 2SGEI 2CJSC 1N13A 1U5KA 3E2IA 1NUBA 4JCVE 1SGRI 2DB6A 2QQDA 1SGEI 1LR9A 1KBEA 2GKTI 2GKRI 2F3CI 1FAQA 2BUSA 2WCYA 5FUYA 1V1IA 1TBRR 1CSOI 5FUXA 1IY6A 2VRWB 1HJAI 3SGQI 1UVFA 5DAEA 5CCMA 1SGYI 2QQCA 1R0RI 4UXHA 4UXJA 2NU3I 2W0TA 5EX3A 3E59A 2LEOA 3OL0A 1DS3I 2A20A 1CHOI 1PTQA 1UUCA 2ORWA 2WVJA 3OVOA 3QTLD 1LR7A 1H0ZA 2JA1A 2NU0I 4E1PA 3CXLA 1FARA 1CE3A 3PDNA 5FUWA 1V1HA 1KBFA 3SGBI 2ELIA 2N17A 2NU2I 1UVGA 2GVIA 1XX6A 1PPFI 2KMPA 2ROWA 2SGPI 1OYVI 1CT2I 5CCLA 1X4SA 2N1AB 3UFFA 1PTRA 2FNFX 1M8BA 1OMTA 1IW4A 1M8CA 3OXLA 1DS2I 1SGNI 2KMRA 2B8TA 2E73A 1HDLA 4GI3C 1SGDI 2QPOA 3UGDA 2J87A 1TURA 1HPTA 3UGLA 3MEKA 1OVOA 1R79A 3B4VC 3OXFA 2NU4I 2ODDA 1TUSA 3TJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E1P A;  4E1R A; 
#chains in the Genus database with same CATH topology
 2ERW A;  1Y8F A;  1YU6 C;  3QAH A;  5HI7 A;  1LR8 A;  2NU1 I;  2JYY A;  4MPI A;  2N52 A;  2QQE A;  1W3S A;  1S20 A;  2WGC A;  2N71 A;  1MT1 A;  2OU2 A;  3VDP A;  5J8C A;  3GOX A;  2QQ0 A;  1TBO A;  2V1C C;  2SGQ I;  2ORV A;  1FYB A;  3KY9 A;  3TO6 A;  3D00 A;  1BMO A;  1Y1C A;  2LUY A;  7WGA A;  2P6A C;  3HH2 C;  4HGU A;  3FC3 A;  1WGT A;  1PCE A;  2CWF A;  2DIP A;  3BJI A;  2YUU A;  3TO9 A;  3R5C A;  2L7X A;  3UEY A;  2B0U C;  2K9H A;  4FKD A;  5E3R A;  1HEV A;  1CT0 I;  2ENN A;  3UEJ A;  4UXI A;  3QWP A;  1TOT A;  1WKX A;  1W4R A;  2JXD A;  2JZM A;  2X52 A;  2V53 A;  1SGQ I;  1TGS I;  2ARP F;  4L9M A;  1CGJ I;  2LB7 A;  1K7U A;  3UGI A;  2YQP A;  3TO7 A;  4E1R A;  1AN1 I;  5J8F A;  2SGF I;  1MJA A;  1TIH A;  2XRC A;  2GKV A;  2RC4 A;  4OVO A;  4AML A;  5FUV A;  4DNC A;  4B6D A;  2OD1 A;  3R5D A;  4A24 A;  3RU0 A;  2KCX A;  5HQ8 A;  1KMA A;  3SEK C;  1RFH A;  1SGP I;  2UVO A;  2KMO A;  2M5X A;  1TBQ R;  2SGD I;  5EX0 A;  2CWG A;  2UZ3 A;  1Q9B A;  3VE5 A;  1YTP A;  1Y1B A;  2J9R A;  3R5A A;  1MJB A;  2E5R A;  2DKV A;  3VDU A;  1UHA A;  1XA6 A;  1OMU A;  1CT4 I;  1VDD A;  2L8E A;  3OXG A;  2ENZ A;  1BUS A;  1PJU A;  1K7V A;  1X74 A;  2V1C A;  2JW6 A;  1ULK A;  1IY5 A;  1CGI I;  1TBN A;  1XBT A;  1P9Z A;  2OVO A;  1Z7K B;  2KMQ A;  4SGB I;  2SGE I;  1WGC A;  5E3Q A;  5JHW C;  2CJS C;  1N13 A;  1ULN A;  1U5K A;  3E2I A;  1NUB A;  4JCV E;  1SGR I;  2DB6 A;  2QQD A;  1SGE I;  4WP4 A;  1LR9 A;  1NXU A;  1KBE A;  3R5B A;  2GKT I;  2GKR I;  2F3C I;  1FAQ A;  2BUS A;  2WCY A;  5FUY A;  1V1I A;  1TBR R;  1CSO I;  5FUX A;  1IY6 A;  1ULM A;  2VRW B;  1HJA I;  3SGQ I;  1UVF A;  3FSX A;  5DAE A;  1FY7 A;  5CCM A;  2PQ8 A;  1SGY I;  2GIV A;  2QQC A;  3FSY A;  1R0R I;  4UXH A;  4UXJ A;  2NU3 I;  2W0T A;  5EX3 A;  3E59 A;  5E3P A;  2LEO A;  3OL0 A;  1DS3 I;  1CHO I;  1PTQ A;  1UUC A;  1Z2I A;  2A20 A;  2ORW A;  2WVJ A;  3OVO A;  3QTL D;  1LR7 A;  1H0Z A;  2JA1 A;  2NU0 I;  2RIJ A;  2OZU A;  4E1P A;  3CXL A;  1FAR A;  1CE3 A;  3UOE A;  3PDN A;  5FUW A;  3TOB A;  1V1H A;  1KBF A;  3SGB I;  2ELI A;  2N17 A;  2NU2 I;  1UVG A;  2GVI A;  1XX6 A;  1PPF I;  2KMP A;  2ROW A;  2SGP I;  1OYV I;  1CT2 I;  5CCL A;  3TOA A;  1X4S A;  2N1A B;  3UFF A;  1MJ9 A;  2Y0M A;  1PTR A;  2FNF X;  1M8B A;  1OMT A;  1IW4 A;  1M8C A;  3OXL A;  1DS2 I;  1SGN I;  2KMR A;  2B8T A;  2E73 A;  1HDL A;  4GI3 C;  1SGD I;  2CWH A;  2QPO A;  3UGD A;  2J87 A;  1TUR A;  1HPT A;  3UGL A;  1P9G A;  1WTJ A;  1OVO A;  1R79 A;  2X3T A;  3B4V C;  3MEK A;  3OXF A;  2NU4 I;  2ODD A;  1TUS A;  9WGA A;  3TJQ A;  1K7T A; 
#chains in the Genus database with same CATH homology
 2ERW A;  1Y8F A;  1YU6 C;  5HI7 A;  1LR8 A;  2NU1 I;  2JYY A;  2N52 A;  2QQE A;  1W3S A;  2N71 A;  1MT1 A;  3VDP A;  3GOX A;  2QQ0 A;  1TBO A;  2V1C C;  2SGQ I;  2ORV A;  1FYB A;  3KY9 A;  3D00 A;  1BMO A;  1Y1C A;  2LUY A;  2P6A C;  3HH2 C;  4HGU A;  3FC3 A;  1PCE A;  3BJI A;  2DIP A;  2YUU A;  2L7X A;  3UEY A;  2B0U C;  2K9H A;  4FKD A;  1CT0 I;  2ENN A;  3UEJ A;  4UXI A;  3QWP A;  1TOT A;  1W4R A;  2JXD A;  2JZM A;  2V53 A;  1SGQ I;  1TGS I;  2ARP F;  4L9M A;  1CGJ I;  3UGI A;  2YQP A;  4E1R A;  1AN1 I;  2SGF I;  1TIH A;  2XRC A;  2GKV A;  4OVO A;  5FUV A;  4B6D A;  2OD1 A;  4A24 A;  3RU0 A;  2KCX A;  5HQ8 A;  1KMA A;  3SEK C;  1RFH A;  1SGP I;  5EX0 A;  2KMO A;  2M5X A;  1TBQ R;  2SGD I;  2UZ3 A;  3VE5 A;  1YTP A;  1Y1B A;  2J9R A;  2E5R A;  3VDU A;  1XA6 A;  1OMU A;  1CT4 I;  1VDD A;  2L8E A;  3OXG A;  2ENZ A;  1BUS A;  1X74 A;  1PJU A;  2V1C A;  2JW6 A;  1IY5 A;  1CGI I;  1TBN A;  1XBT A;  2OVO A;  4SGB I;  1Z7K B;  2KMQ A;  5JHW C;  2SGE I;  2CJS C;  1N13 A;  1U5K A;  3E2I A;  1NUB A;  4JCV E;  1SGR I;  2DB6 A;  2QQD A;  1SGE I;  1LR9 A;  1KBE A;  2GKT I;  2GKR I;  2F3C I;  1FAQ A;  2BUS A;  2WCY A;  5FUY A;  1V1I A;  1TBR R;  1CSO I;  5FUX A;  1IY6 A;  2VRW B;  1HJA I;  3SGQ I;  1UVF A;  5DAE A;  5CCM A;  1SGY I;  2QQC A;  1R0R I;  4UXH A;  4UXJ A;  2NU3 I;  2W0T A;  5EX3 A;  3E59 A;  2LEO A;  3OL0 A;  1DS3 I;  2A20 A;  1CHO I;  1PTQ A;  1UUC A;  2ORW A;  2WVJ A;  3OVO A;  3QTL D;  1LR7 A;  1H0Z A;  2JA1 A;  2NU0 I;  4E1P A;  3CXL A;  1FAR A;  1CE3 A;  3PDN A;  5FUW A;  1V1H A;  1KBF A;  3SGB I;  2ELI A;  2N17 A;  2NU2 I;  1UVG A;  2GVI A;  1XX6 A;  1PPF I;  2KMP A;  2ROW A;  2SGP I;  1OYV I;  1CT2 I;  5CCL A;  1X4S A;  2N1A B;  3UFF A;  1PTR A;  2FNF X;  1M8B A;  1OMT A;  1IW4 A;  1M8C A;  3OXL A;  1DS2 I;  1SGN I;  2KMR A;  2B8T A;  2E73 A;  1HDL A;  4GI3 C;  1SGD I;  2QPO A;  3UGD A;  2J87 A;  1TUR A;  1HPT A;  3UGL A;  3MEK A;  1OVO A;  1R79 A;  3B4V C;  3OXF A;  2NU4 I;  2ODD A;  1TUS A;  3TJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...