4E1PA

Crystal structure of the dimerization domain of lsr2 from mycobacterium tuberculosis in the p 1 21 1 space group
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
55
structure length
55
Chain Sequence
b'KVTVTLVDDFDGSGAADETVEFGLDGVTYEIDLSTKNATKLRGDLKQWVAAGRRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein lsr2
publication title The structure of the oligomerization domain of Lsr2 from Mycobacterium tuberculosis reveals a mechanism for chromosome organization and protection.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
total genus 12
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.230 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4e1pA00
4E1RA 4E1PA
chains in the Genus database with same CATH superfamily
1KBEA 1SGYI 2LB7A 2NU3I 2Y0MA 2NU2I 4WP4A 2ENNA 5E3RA 1LR8A 2OVOA 2CJSC 3FC3A 3UEYA 2SGPI 2ORVA 4HGUA 1MJAA 2JXDA 3VDUA 1KBFA 3R5DA 1OMTA 3E2IA 2DB6A 1TIHA 1Y1BA 2UVOA 2KCXA 5FUWA 5J8CA 2JW6A 1M8CA 2JYYA 1SGQI 1TBNA 5EX0A 1V1HA 4MPIA 2SGEI 1R79A 1UVGA 1ULKA 3E59A 3VE5A 3FSYA 1CSOI 3SGBI 4E1RA 2E73A 1K7UA 5FUYA 2KMQA 1NUBA 2OU2A 3PDNA 1KMAA 2BUSA 5HQ8A 1HEVA 1HPTA 4OVOA 2QQ0A 2W0TA 1ULNA 4B6DA 1SGPI 1CGJI 1SGDI 5JHWC 1CE3A 1UHAA 2A20A 3SEKC 2RIJA 1BUSA 3UGLA 1WKXA 1TUSA 1X74A 2B0UC 1P9GA 2B8TA 5FUVA 1YU6C 2N71A 3KY9A 3TO6A 3VDPA 2QQEA 2WGCA 2CWFA 2CWHA 1IY6A 3SGQI 1R0RI 1LR9A 1DS2I 2XRCA 2ROWA 3OXGA 2N52A 1UUCA 2ERWA 1U5KA 4UXIA 2J87A 3R5CA 4UXHA 3OVOA 2GKVA 3FSXA 5E3QA 1PJUA 1Z7KB 1TGSI 2GKRI 5DAEA 7WGAA 2WVJA 1SGRI 4UXJA 2P6AC 2FNFX 1PTRA 2GIVA 3MEKA 1TBOA 3QTLD 5EX3A 1Z2IA 1HDLA 3OXLA 2JA1A 2V1CA 2LEOA 2YUUA 1CT0I 1SGNI 1P9ZA 2F3CI 3QAHA 2OZUA 1RFHA 2V53A 2QPOA 5FUXA 1TOTA 2SGFI 3BJIA 3OXFA 2WCYA 1M8BA 3TOBA 1FAQA 1W4RA 1BMOA 4SGBI 1DS3I 2PQ8A 4DNCA 3GOXA 2ELIA 2N17A 1W3SA 2ARPF 2YQPA 1HJAI 2KMOA 1V1IA 2E5RA 1H0ZA 2X52A 5HI7A 1CT2I 5J8FA 1MT1A 1AN1I 3QWPA 1Y8FA 1PPFI 1WTJA 2J9RA 1MJ9A 3CXLA 1S20A 3UFFA 1K7TA 2JZMA 3UGDA 1UVFA 2ODDA 1SGEI 1XA6A 1MJBA 4GI3C 2KMRA 3RU0A 2DIPA 1XX6A 2DKVA 1PTQA 1IW4A 1Q9BA 2NU4I 2KMPA 3TJQA 2N1AB 1OVOA 4E1PA 1PCEA 5CCMA 2GKTI 4FKDA 2CWGA 5CCLA 2L8EA 5E3PA 2QQDA 1ULMA 2ORWA 2L7XA 2M5XA 3TO7A 2LUYA 1K7VA 3B4VC 1CHOI 2VRWB 4AMLA 3UGIA 3R5AA 1TBRR 3UOEA 2V1CC 1X4SA 3HH2C 3TO9A 1FY7A 1OMUA 1CT4I 2K9HA 2NU0I 2UZ3A 1TURA 4JCVE 1FARA 1XBTA 3TOAA 4L9MA 4A24A 1IY5A 1FYBA 2GVIA 1NXUA 1Y1CA 2QQCA 1WGTA 9WGAA 2ENZA 2NU1I 2SGQI 2SGDI 1N13A 3R5BA 1WGCA 2OD1A 2RC4A 1VDDA 1CGII 1OYVI 2X3TA 3UEJA 1YTPA 1LR7A 1TBQR 3OL0A 3D00A
chains in the Genus database with same CATH topology
1KBEA 1SGYI 2NU3I 2NU2I 2ENNA 1LR8A 2OVOA 2CJSC 3FC3A 3UEYA 2SGPI 2ORVA 4HGUA 2JXDA 3VDUA 1KBFA 1OMTA 3E2IA 2DB6A 1TIHA 1Y1BA 2KCXA 5FUWA 2JW6A 1M8CA 2JYYA 1SGQI 1TBNA 5EX0A 1V1HA 2SGEI 1R79A 1UVGA 3E59A 3VE5A 1CSOI 3SGBI 4E1RA 2E73A 5FUYA 2KMQA 1NUBA 3PDNA 1KMAA 2BUSA 5HQ8A 1HPTA 4OVOA 2QQ0A 2W0TA 4B6DA 1SGPI 1CGJI 1SGDI 5JHWC 1CE3A 2A20A 3SEKC 1BUSA 3UGLA 1TUSA 1X74A 2B0UC 2B8TA 5FUVA 1YU6C 2N71A 3KY9A 3VDPA 2QQEA 1IY6A 3SGQI 1R0RI 1LR9A 1DS2I 2XRCA 2ROWA 3OXGA 2N52A 1UUCA 2ERWA 1U5KA 4UXIA 2J87A 4UXHA 3OVOA 2GKVA 1PJUA 1Z7KB 1TGSI 2GKRI 5DAEA 2WVJA 1SGRI 4UXJA 2P6AC 2FNFX 1PTRA 3MEKA 1TBOA 3QTLD 5EX3A 1HDLA 3OXLA 2JA1A 2V1CA 2LEOA 2YUUA 1CT0I 1SGNI 2F3CI 1RFHA 2V53A 2QPOA 5FUXA 1TOTA 2SGFI 3BJIA 3OXFA 2WCYA 1M8BA 1FAQA 1W4RA 1BMOA 4SGBI 1DS3I 3GOXA 2ELIA 2N17A 1W3SA 2ARPF 2YQPA 1HJAI 2KMOA 1V1IA 2E5RA 1H0ZA 5HI7A 1CT2I 1MT1A 1AN1I 3QWPA 1Y8FA 1PPFI 2J9RA 3CXLA 3UFFA 2JZMA 3UGDA 1UVFA 2ODDA 1SGEI 1XA6A 4GI3C 2KMRA 3RU0A 2DIPA 1XX6A 1PTQA 1IW4A 2NU4I 3TJQA 2KMPA 2N1AB 1OVOA 4E1PA 1PCEA 5CCMA 2GKTI 4FKDA 5CCLA 2L8EA 2QQDA 2ORWA 2L7XA 2M5XA 2LUYA 3B4VC 1CHOI 2VRWB 3UGIA 1TBRR 2V1CC 1X4SA 3HH2C 1OMUA 2K9HA 1CT4I 2NU0I 2UZ3A 4JCVE 1TURA 4A24A 1FARA 1XBTA 1IY5A 4L9MA 1FYBA 2GVIA 1Y1CA 2QQCA 2ENZA 2NU1I 2SGQI 2SGDI 1N13A 2OD1A 1VDDA 1CGII 1OYVI 3UEJA 1YTPA 1LR7A 1TBQR 3OL0A 3D00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E1R A;  4E1P A; 
#chains in the Genus database with same CATH topology
 1KBE A;  1SGY I;  2LB7 A;  2NU3 I;  2Y0M A;  2NU2 I;  4WP4 A;  2ENN A;  5E3R A;  1LR8 A;  2OVO A;  2CJS C;  3FC3 A;  3UEY A;  2SGP I;  2ORV A;  4HGU A;  1MJA A;  2JXD A;  3VDU A;  1KBF A;  3R5D A;  1OMT A;  3E2I A;  2DB6 A;  1TIH A;  1Y1B A;  2UVO A;  2KCX A;  5FUW A;  5J8C A;  2JW6 A;  1M8C A;  2JYY A;  1SGQ I;  1TBN A;  5EX0 A;  1V1H A;  4MPI A;  2SGE I;  1R79 A;  1UVG A;  1ULK A;  3E59 A;  3VE5 A;  3FSY A;  1CSO I;  3SGB I;  4E1R A;  2E73 A;  1K7U A;  5FUY A;  2KMQ A;  1NUB A;  2OU2 A;  3PDN A;  1KMA A;  2BUS A;  5HQ8 A;  1HEV A;  1HPT A;  4OVO A;  2QQ0 A;  2W0T A;  1ULN A;  4B6D A;  1SGP I;  1CGJ I;  1SGD I;  5JHW C;  1CE3 A;  1UHA A;  2A20 A;  3SEK C;  2RIJ A;  1BUS A;  3UGL A;  1WKX A;  1TUS A;  1X74 A;  2B0U C;  1P9G A;  2B8T A;  5FUV A;  1YU6 C;  2N71 A;  3KY9 A;  3TO6 A;  3VDP A;  2QQE A;  2WGC A;  2CWF A;  2CWH A;  1IY6 A;  3SGQ I;  1R0R I;  1LR9 A;  1DS2 I;  2XRC A;  2ROW A;  3OXG A;  2N52 A;  1UUC A;  2ERW A;  1U5K A;  4UXI A;  2J87 A;  3R5C A;  4UXH A;  3OVO A;  2GKV A;  3FSX A;  5E3Q A;  1PJU A;  1Z7K B;  1TGS I;  2GKR I;  5DAE A;  7WGA A;  2WVJ A;  1SGR I;  4UXJ A;  2P6A C;  2FNF X;  1PTR A;  2GIV A;  3MEK A;  1TBO A;  3QTL D;  5EX3 A;  1Z2I A;  1HDL A;  3OXL A;  2JA1 A;  2V1C A;  2LEO A;  2YUU A;  1CT0 I;  1SGN I;  1P9Z A;  2F3C I;  3QAH A;  2OZU A;  1RFH A;  2V53 A;  2QPO A;  5FUX A;  1TOT A;  2SGF I;  3BJI A;  3OXF A;  2WCY A;  1M8B A;  3TOB A;  1FAQ A;  1W4R A;  1BMO A;  4SGB I;  1DS3 I;  2PQ8 A;  4DNC A;  3GOX A;  2ELI A;  2N17 A;  1W3S A;  2ARP F;  2YQP A;  1HJA I;  2KMO A;  1V1I A;  2E5R A;  1H0Z A;  2X52 A;  5HI7 A;  1CT2 I;  5J8F A;  1MT1 A;  1AN1 I;  3QWP A;  1Y8F A;  1PPF I;  1WTJ A;  2J9R A;  1MJ9 A;  3CXL A;  1S20 A;  3UFF A;  1K7T A;  2JZM A;  3UGD A;  1UVF A;  2ODD A;  1SGE I;  1XA6 A;  1MJB A;  4GI3 C;  2KMR A;  3RU0 A;  2DIP A;  1XX6 A;  2DKV A;  1PTQ A;  1IW4 A;  1Q9B A;  2NU4 I;  2KMP A;  3TJQ A;  2N1A B;  1OVO A;  4E1P A;  1PCE A;  5CCM A;  2GKT I;  4FKD A;  2CWG A;  5CCL A;  2L8E A;  5E3P A;  2QQD A;  1ULM A;  2ORW A;  2L7X A;  2M5X A;  3TO7 A;  2LUY A;  1K7V A;  3B4V C;  1CHO I;  2VRW B;  4AML A;  3UGI A;  3R5A A;  1TBR R;  3UOE A;  2V1C C;  1X4S A;  3HH2 C;  3TO9 A;  1FY7 A;  1OMU A;  1CT4 I;  2K9H A;  2NU0 I;  2UZ3 A;  1TUR A;  4JCV E;  1FAR A;  1XBT A;  3TOA A;  4L9M A;  4A24 A;  1IY5 A;  1FYB A;  2GVI A;  1NXU A;  1Y1C A;  2QQC A;  1WGT A;  9WGA A;  2ENZ A;  2NU1 I;  2SGQ I;  2SGD I;  1N13 A;  3R5B A;  1WGC A;  2OD1 A;  2RC4 A;  1VDD A;  1CGI I;  1OYV I;  2X3T A;  3UEJ A;  1YTP A;  1LR7 A;  1TBQ R;  3OL0 A;  3D00 A; 
#chains in the Genus database with same CATH homology
 1KBE A;  1SGY I;  2NU3 I;  2NU2 I;  2ENN A;  1LR8 A;  2OVO A;  2CJS C;  3FC3 A;  3UEY A;  2SGP I;  2ORV A;  4HGU A;  2JXD A;  3VDU A;  1KBF A;  1OMT A;  3E2I A;  2DB6 A;  1TIH A;  1Y1B A;  2KCX A;  5FUW A;  2JW6 A;  1M8C A;  2JYY A;  1SGQ I;  1TBN A;  5EX0 A;  1V1H A;  2SGE I;  1R79 A;  1UVG A;  3E59 A;  3VE5 A;  1CSO I;  3SGB I;  4E1R A;  2E73 A;  5FUY A;  2KMQ A;  1NUB A;  3PDN A;  1KMA A;  2BUS A;  5HQ8 A;  1HPT A;  4OVO A;  2QQ0 A;  2W0T A;  4B6D A;  1SGP I;  1CGJ I;  1SGD I;  5JHW C;  1CE3 A;  2A20 A;  3SEK C;  1BUS A;  3UGL A;  1TUS A;  1X74 A;  2B0U C;  2B8T A;  5FUV A;  1YU6 C;  2N71 A;  3KY9 A;  3VDP A;  2QQE A;  1IY6 A;  3SGQ I;  1R0R I;  1LR9 A;  1DS2 I;  2XRC A;  2ROW A;  3OXG A;  2N52 A;  1UUC A;  2ERW A;  1U5K A;  4UXI A;  2J87 A;  4UXH A;  3OVO A;  2GKV A;  1PJU A;  1Z7K B;  1TGS I;  2GKR I;  5DAE A;  2WVJ A;  1SGR I;  4UXJ A;  2P6A C;  2FNF X;  1PTR A;  3MEK A;  1TBO A;  3QTL D;  5EX3 A;  1HDL A;  3OXL A;  2JA1 A;  2V1C A;  2LEO A;  2YUU A;  1CT0 I;  1SGN I;  2F3C I;  1RFH A;  2V53 A;  2QPO A;  5FUX A;  1TOT A;  2SGF I;  3BJI A;  3OXF A;  2WCY A;  1M8B A;  1FAQ A;  1W4R A;  1BMO A;  4SGB I;  1DS3 I;  3GOX A;  2ELI A;  2N17 A;  1W3S A;  2ARP F;  2YQP A;  1HJA I;  2KMO A;  1V1I A;  2E5R A;  1H0Z A;  5HI7 A;  1CT2 I;  1MT1 A;  1AN1 I;  3QWP A;  1Y8F A;  1PPF I;  2J9R A;  3CXL A;  3UFF A;  2JZM A;  3UGD A;  1UVF A;  2ODD A;  1SGE I;  1XA6 A;  4GI3 C;  2KMR A;  3RU0 A;  2DIP A;  1XX6 A;  1PTQ A;  1IW4 A;  2NU4 I;  3TJQ A;  2KMP A;  2N1A B;  1OVO A;  4E1P A;  1PCE A;  5CCM A;  2GKT I;  4FKD A;  5CCL A;  2L8E A;  2QQD A;  2ORW A;  2L7X A;  2M5X A;  2LUY A;  3B4V C;  1CHO I;  2VRW B;  3UGI A;  1TBR R;  2V1C C;  1X4S A;  3HH2 C;  1OMU A;  2K9H A;  1CT4 I;  2NU0 I;  2UZ3 A;  4JCV E;  1TUR A;  4A24 A;  1FAR A;  1XBT A;  1IY5 A;  4L9M A;  1FYB A;  2GVI A;  1Y1C A;  2QQC A;  2ENZ A;  2NU1 I;  2SGQ I;  2SGD I;  1N13 A;  2OD1 A;  1VDD A;  1CGI I;  1OYV I;  3UEJ A;  1YTP A;  1LR7 A;  1TBQ R;  3OL0 A;  3D00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...