1TBNA

Nmr structure of a protein kinase c-g phorbol-binding domain, minimized average structure
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
66
structure length
66
Chain Sequence
QTDDPRNKHKFRLHSYSSPTFCDHCGSLLYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Calcium-binding protein
molecule keywords PROTEIN KINASE C, GAMMA TYPE
publication title NMR structure of a protein kinase C-gamma phorbol-binding domain and study of protein-lipid micelle interactions.
pubmed doi rcsb
source organism Rattus rattus
total genus 6
structure length 66
sequence length 66
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 1997-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1tbnA00
2E73A 1W4RA 1PTRA 3UGLA 4UXHA 2GVIA 4B6DA 2ENNA 2JA1A 1TBOA 3KY9A 4L9MA 5FUVA 3UEJA 1RFHA 1XA6A 3UFFA 2FNFX 4UXIA 4UXJA 3UGIA 5FUYA 2YUUA 2ENZA 2J87A 2ORVA 2VRWB 5FUXA 2DB6A 3CXLA 2ELIA 2WVJA 1PTQA 1FAQA 5FUWA 2J9RA 3BJIA 4FKDA 3UGDA 1Y8FA 2QPOA 1TBNA 2QQEA 1R79A 2QQ0A 2ORWA 3UEYA 2ROWA 2B8TA 1KBFA 2UZ3A 3E2IA 1XBTA 1XX6A 1FARA 1KBEA
chains in the Genus database with same CATH superfamily
1CSOI 1V1IA 1Z7KB 2E73A 1PTRA 2JW6A 3UGLA 1H0ZA 3TO6A 5HI7A 1TBOA 3KY9A 1PCEA 1YTPA 4L9MA 1FY7A 1AN1I 1XA6A 5J8FA 3UFFA 2V53A 1UVGA 4OVOA 1CE3A 2ORVA 3QTLD 2KMOA 2DB6A 1LR7A 5J8CA 2N52A 1ULKA 2KCXA 1CGJI 5E3PA 2NU0I 2DIPA 1CHOI 2QQDA 1CT0I 3BJIA 3TO7A 2QPOA 3FC3A 2WGCA 2WCYA 4A24A 2SGEI 3QAHA 1X74A 3OXFA 1TOTA 1R0RI 3R5BA 1LR8A 2K9HA 2N71A 2VRWB 1KBEA 2CWFA 3SGBI 1SGEI 1X4SA 1M8BA 2GVIA 1NXUA 4DNCA 3HH2C 3TJQA 3OVOA 5JHWC 1MJBA 2P6AC 2UVOA 3UEJA 4GI3C 2FNFX 2NU3I 1NUBA 4UXIA 2JYYA 2ENZA 2GKVA 2J87A 4WP4A 1HEVA 1K7VA 1TIHA 2RC4A 2RIJA 3CXLA 2LUYA 2Y0MA 5CCMA 3B4VC 5E3QA 3TOBA 5DAEA 1WTJA 3QWPA 2DKVA 4FKDA 3UOEA 1Y8FA 2ARPF 2M5XA 2N1AB 2CJSC 2JXDA 1MJAA 1HPTA 2ORWA 1P9ZA 3TO9A 3UEYA 1HJAI 2OU2A 1M8CA 2B8TA 3PDNA 1KBFA 3OXGA 2E5RA 1WKXA 2KMRA 2V1CA 3E2IA 1PPFI 1XBTA 1N13A 2NU1I 3TOAA 4AMLA 4MPIA 3SEKC 2GIVA 1ULNA 2XRCA 4B6DA 1CT4I 1V1HA 1W3SA 2OZUA 1UHAA 1VDDA 1Y1CA 2ERWA 2ODDA 5HQ8A 3GOXA 1MT1A 1OYVI 1OVOA 3E59A 1RFHA 5E3RA 5CCLA 2SGFI 4HGUA 3RU0A 9WGAA 1IY6A 2F3CI 1DS3I 2OD1A 4UXJA 1Q9BA 1UUCA 1TGSI 1WGCA 1BUSA 1YU6C 3MEKA 2V1CC 2W0TA 5FUXA 3VDUA 1IW4A 1SGNI 2SGQI 2L8EA 2QQCA 3OXLA 1IY5A 3VDPA 1PTQA 1FAQA 1WGTA 2L7XA 2PQ8A 1SGDI 3UGDA 3R5DA 1HDLA 4JCVE 2QQEA 1R79A 1U5KA 2LB7A 7WGAA 2ROWA 2X52A 2X3TA 2NU2I 1FARA 1LR9A 1SGRI 1MJ9A 2YQPA 2KMPA 1W4RA 2CWGA 1Y1BA 1UVFA 4UXHA 2ENNA 4SGBI 1OMTA 2JA1A 1TURA 3R5AA 2GKTI 1S20A 1KMAA 5FUVA 1FYBA 2LEOA 1SGQI 1TBQR 3UGIA 5FUYA 2YUUA 1Z2IA 2JZMA 1CT2I 1BMOA 1K7TA 1PJUA 2A20A 3D00A 3FSXA 4E1RA 2BUSA 2SGDI 2ELIA 1CGII 1DS2I 1ULMA 2KMQA 2WVJA 1TUSA 3VE5A 3SGQI 2B0UC 2J9RA 2OVOA 3FSYA 5FUWA 1OMUA 1SGYI 3OL0A 1TBNA 1P9GA 3R5CA 5EX3A 1SGPI 2QQ0A 2NU4I 5EX0A 4E1PA 1TBRR 2SGPI 2N17A 2UZ3A 1K7UA 2GKRI 1XX6A 2CWHA
chains in the Genus database with same CATH topology
1CSOI 1V1IA 1Z7KB 2E73A 1PTRA 2JW6A 3UGLA 1H0ZA 5HI7A 1TBOA 3KY9A 1PCEA 1YTPA 4L9MA 1AN1I 1XA6A 3UFFA 2V53A 1UVGA 4OVOA 1CE3A 2ORVA 3QTLD 2KMOA 2DB6A 1LR7A 2N52A 2KCXA 1CGJI 2NU0I 2DIPA 1CHOI 2QQDA 1CT0I 3BJIA 2QPOA 3FC3A 2WCYA 4A24A 2SGEI 1X74A 3OXFA 1TOTA 1R0RI 1LR8A 2K9HA 2N71A 2VRWB 1KBEA 3SGBI 1SGEI 1X4SA 1M8BA 2GVIA 3HH2C 3TJQA 3OVOA 5JHWC 2P6AC 3UEJA 4GI3C 2FNFX 2NU3I 1NUBA 4UXIA 2JYYA 2ENZA 2GKVA 2J87A 1TIHA 3CXLA 2LUYA 5CCMA 3B4VC 5DAEA 3QWPA 4FKDA 1Y8FA 2ARPF 2M5XA 2N1AB 2CJSC 2JXDA 1HPTA 2ORWA 3UEYA 1HJAI 1M8CA 2B8TA 3PDNA 1KBFA 3OXGA 2E5RA 2KMRA 2V1CA 3E2IA 1XBTA 1PPFI 1N13A 2NU1I 3SEKC 2XRCA 4B6DA 1CT4I 1V1HA 1W3SA 1VDDA 2ODDA 1Y1CA 2ERWA 5HQ8A 3GOXA 1MT1A 1OYVI 1OVOA 3E59A 1RFHA 5CCLA 1IY6A 2SGFI 4HGUA 3RU0A 2F3CI 1DS3I 2OD1A 4UXJA 1UUCA 1TGSI 1BUSA 1YU6C 3MEKA 2V1CC 2W0TA 5FUXA 3VDUA 1IW4A 1SGNI 2SGQI 2L8EA 2QQCA 3OXLA 1IY5A 3VDPA 1PTQA 1FAQA 3UGDA 2L7XA 1SGDI 1HDLA 4JCVE 2QQEA 1R79A 1U5KA 2ROWA 2NU2I 1FARA 1LR9A 1SGRI 2YQPA 2KMPA 1W4RA 1Y1BA 1UVFA 4UXHA 2ENNA 4SGBI 1OMTA 2JA1A 1TURA 2GKTI 1KMAA 5FUVA 1FYBA 2LEOA 1SGQI 1TBQR 3UGIA 5FUYA 2YUUA 2JZMA 1CT2I 1BMOA 1PJUA 2A20A 3D00A 4E1RA 2BUSA 2SGDI 2ELIA 1CGII 1DS2I 2KMQA 2WVJA 1TUSA 3VE5A 3SGQI 2B0UC 2J9RA 2OVOA 5FUWA 1OMUA 1SGYI 3OL0A 1TBNA 5EX3A 1SGPI 2QQ0A 2NU4I 5EX0A 4E1PA 1TBRR 2SGPI 2N17A 2UZ3A 2GKRI 1XX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E73 A;  1W4R A;  1PTR A;  3UGL A;  4UXH A;  2GVI A;  4B6D A;  2ENN A;  2JA1 A;  1TBO A;  3KY9 A;  4L9M A;  5FUV A;  3UEJ A;  1RFH A;  1XA6 A;  3UFF A;  2FNF X;  4UXI A;  4UXJ A;  3UGI A;  5FUY A;  2YUU A;  2ENZ A;  2J87 A;  2ORV A;  2VRW B;  5FUX A;  2DB6 A;  3CXL A;  2ELI A;  2WVJ A;  1PTQ A;  1FAQ A;  5FUW A;  2J9R A;  3BJI A;  4FKD A;  3UGD A;  1Y8F A;  2QPO A;  1TBN A;  2QQE A;  1R79 A;  2QQ0 A;  2ORW A;  3UEY A;  2ROW A;  2B8T A;  1KBF A;  2UZ3 A;  3E2I A;  1XBT A;  1XX6 A;  1FAR A;  1KBE A; 
#chains in the Genus database with same CATH topology
 1CSO I;  1V1I A;  1Z7K B;  2E73 A;  1PTR A;  2JW6 A;  3UGL A;  1H0Z A;  3TO6 A;  5HI7 A;  1TBO A;  3KY9 A;  1PCE A;  1YTP A;  4L9M A;  1FY7 A;  1AN1 I;  1XA6 A;  5J8F A;  3UFF A;  2V53 A;  1UVG A;  4OVO A;  1CE3 A;  2ORV A;  3QTL D;  2KMO A;  2DB6 A;  1LR7 A;  5J8C A;  2N52 A;  1ULK A;  2KCX A;  1CGJ I;  5E3P A;  2NU0 I;  2DIP A;  1CHO I;  2QQD A;  1CT0 I;  3BJI A;  3TO7 A;  2QPO A;  3FC3 A;  2WGC A;  2WCY A;  4A24 A;  2SGE I;  3QAH A;  1X74 A;  3OXF A;  1TOT A;  1R0R I;  3R5B A;  1LR8 A;  2K9H A;  2N71 A;  2VRW B;  1KBE A;  2CWF A;  3SGB I;  1SGE I;  1X4S A;  1M8B A;  2GVI A;  1NXU A;  4DNC A;  3HH2 C;  3TJQ A;  3OVO A;  5JHW C;  1MJB A;  2P6A C;  2UVO A;  3UEJ A;  4GI3 C;  2FNF X;  2NU3 I;  1NUB A;  4UXI A;  2JYY A;  2ENZ A;  2GKV A;  2J87 A;  4WP4 A;  1HEV A;  1K7V A;  1TIH A;  2RC4 A;  2RIJ A;  3CXL A;  2LUY A;  2Y0M A;  5CCM A;  3B4V C;  5E3Q A;  3TOB A;  5DAE A;  1WTJ A;  3QWP A;  2DKV A;  4FKD A;  3UOE A;  1Y8F A;  2ARP F;  2M5X A;  2N1A B;  2CJS C;  2JXD A;  1MJA A;  1HPT A;  2ORW A;  1P9Z A;  3TO9 A;  3UEY A;  1HJA I;  2OU2 A;  1M8C A;  2B8T A;  3PDN A;  1KBF A;  3OXG A;  2E5R A;  1WKX A;  2KMR A;  2V1C A;  3E2I A;  1PPF I;  1XBT A;  1N13 A;  2NU1 I;  3TOA A;  4AML A;  4MPI A;  3SEK C;  2GIV A;  1ULN A;  2XRC A;  4B6D A;  1CT4 I;  1V1H A;  1W3S A;  2OZU A;  1UHA A;  1VDD A;  1Y1C A;  2ERW A;  2ODD A;  5HQ8 A;  3GOX A;  1MT1 A;  1OYV I;  1OVO A;  3E59 A;  1RFH A;  5E3R A;  5CCL A;  2SGF I;  4HGU A;  3RU0 A;  9WGA A;  1IY6 A;  2F3C I;  1DS3 I;  2OD1 A;  4UXJ A;  1Q9B A;  1UUC A;  1TGS I;  1WGC A;  1BUS A;  1YU6 C;  3MEK A;  2V1C C;  2W0T A;  5FUX A;  3VDU A;  1IW4 A;  1SGN I;  2SGQ I;  2L8E A;  2QQC A;  3OXL A;  1IY5 A;  3VDP A;  1PTQ A;  1FAQ A;  1WGT A;  2L7X A;  2PQ8 A;  1SGD I;  3UGD A;  3R5D A;  1HDL A;  4JCV E;  2QQE A;  1R79 A;  1U5K A;  2LB7 A;  7WGA A;  2ROW A;  2X52 A;  2X3T A;  2NU2 I;  1FAR A;  1LR9 A;  1SGR I;  1MJ9 A;  2YQP A;  2KMP A;  1W4R A;  2CWG A;  1Y1B A;  1UVF A;  4UXH A;  2ENN A;  4SGB I;  1OMT A;  2JA1 A;  1TUR A;  3R5A A;  2GKT I;  1S20 A;  1KMA A;  5FUV A;  1FYB A;  2LEO A;  1SGQ I;  1TBQ R;  3UGI A;  5FUY A;  2YUU A;  1Z2I A;  2JZM A;  1CT2 I;  1BMO A;  1K7T A;  1PJU A;  2A20 A;  3D00 A;  3FSX A;  4E1R A;  2BUS A;  2SGD I;  2ELI A;  1CGI I;  1DS2 I;  1ULM A;  2KMQ A;  2WVJ A;  1TUS A;  3VE5 A;  3SGQ I;  2B0U C;  2J9R A;  2OVO A;  3FSY A;  5FUW A;  1OMU A;  1SGY I;  3OL0 A;  1TBN A;  1P9G A;  3R5C A;  5EX3 A;  1SGP I;  2QQ0 A;  2NU4 I;  5EX0 A;  4E1P A;  1TBR R;  2SGP I;  2N17 A;  2UZ3 A;  1K7U A;  2GKR I;  1XX6 A;  2CWH A; 
#chains in the Genus database with same CATH homology
 1CSO I;  1V1I A;  1Z7K B;  2E73 A;  1PTR A;  2JW6 A;  3UGL A;  1H0Z A;  5HI7 A;  1TBO A;  3KY9 A;  1PCE A;  1YTP A;  4L9M A;  1AN1 I;  1XA6 A;  3UFF A;  2V53 A;  1UVG A;  4OVO A;  1CE3 A;  2ORV A;  3QTL D;  2KMO A;  2DB6 A;  1LR7 A;  2N52 A;  2KCX A;  1CGJ I;  2NU0 I;  2DIP A;  1CHO I;  2QQD A;  1CT0 I;  3BJI A;  2QPO A;  3FC3 A;  2WCY A;  4A24 A;  2SGE I;  1X74 A;  3OXF A;  1TOT A;  1R0R I;  1LR8 A;  2K9H A;  2N71 A;  2VRW B;  1KBE A;  3SGB I;  1SGE I;  1X4S A;  1M8B A;  2GVI A;  3HH2 C;  3TJQ A;  3OVO A;  5JHW C;  2P6A C;  3UEJ A;  4GI3 C;  2FNF X;  2NU3 I;  1NUB A;  4UXI A;  2JYY A;  2ENZ A;  2GKV A;  2J87 A;  1TIH A;  3CXL A;  2LUY A;  5CCM A;  3B4V C;  5DAE A;  3QWP A;  4FKD A;  1Y8F A;  2ARP F;  2M5X A;  2N1A B;  2CJS C;  2JXD A;  1HPT A;  2ORW A;  3UEY A;  1HJA I;  1M8C A;  2B8T A;  3PDN A;  1KBF A;  3OXG A;  2E5R A;  2KMR A;  2V1C A;  3E2I A;  1XBT A;  1PPF I;  1N13 A;  2NU1 I;  3SEK C;  2XRC A;  4B6D A;  1CT4 I;  1V1H A;  1W3S A;  1VDD A;  2ODD A;  1Y1C A;  2ERW A;  5HQ8 A;  3GOX A;  1MT1 A;  1OYV I;  1OVO A;  3E59 A;  1RFH A;  5CCL A;  1IY6 A;  2SGF I;  4HGU A;  3RU0 A;  2F3C I;  1DS3 I;  2OD1 A;  4UXJ A;  1UUC A;  1TGS I;  1BUS A;  1YU6 C;  3MEK A;  2V1C C;  2W0T A;  5FUX A;  3VDU A;  1IW4 A;  1SGN I;  2SGQ I;  2L8E A;  2QQC A;  3OXL A;  1IY5 A;  3VDP A;  1PTQ A;  1FAQ A;  3UGD A;  2L7X A;  1SGD I;  1HDL A;  4JCV E;  2QQE A;  1R79 A;  1U5K A;  2ROW A;  2NU2 I;  1FAR A;  1LR9 A;  1SGR I;  2YQP A;  2KMP A;  1W4R A;  1Y1B A;  1UVF A;  4UXH A;  2ENN A;  4SGB I;  1OMT A;  2JA1 A;  1TUR A;  2GKT I;  1KMA A;  5FUV A;  1FYB A;  2LEO A;  1SGQ I;  1TBQ R;  3UGI A;  5FUY A;  2YUU A;  2JZM A;  1CT2 I;  1BMO A;  1PJU A;  2A20 A;  3D00 A;  4E1R A;  2BUS A;  2SGD I;  2ELI A;  1CGI I;  1DS2 I;  2KMQ A;  2WVJ A;  1TUS A;  3VE5 A;  3SGQ I;  2B0U C;  2J9R A;  2OVO A;  5FUW A;  1OMU A;  1SGY I;  3OL0 A;  1TBN A;  5EX3 A;  1SGP I;  2QQ0 A;  2NU4 I;  5EX0 A;  4E1P A;  1TBR R;  2SGP I;  2N17 A;  2UZ3 A;  2GKR I;  1XX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...