1TBNA

Nmr structure of a protein kinase c-g phorbol-binding domain, minimized average structure
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
66
structure length
66
Chain Sequence
QTDDPRNKHKFRLHSYSSPTFCDHCGSLLYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title NMR structure of a protein kinase C-gamma phorbol-binding domain and study of protein-lipid micelle interactions.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Calcium-binding protein
molecule keywords PROTEIN KINASE C, GAMMA TYPE
total genus 6
structure length 66
sequence length 66
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 1997-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1tbnA00
3UFFA 2WVJA 3CXLA 4UXHA 2QPOA 3UGIA 1PTRA 1FAQA 1R79A 1XA6A 3UEJA 3UEYA 2J9RA 2JA1A 1FARA 4UXIA 2FNFX 2ORWA 5FUVA 4B6DA 3UGLA 1PTQA 2GVIA 4FKDA 4L9MA 1KBEA 2ROWA 4UXJA 2E73A 2VRWB 2ORVA 2YUUA 1TBOA 2ENZA 3BJIA 2QQEA 5FUYA 5FUXA 5FUWA 1Y8FA 1TBNA 2ELIA 1XX6A 1W4RA 2B8TA 2UZ3A 3UGDA 3E2IA 2DB6A 2QQ0A 1RFHA 2J87A 1KBFA 1XBTA 2ENNA 3KY9A
chains in the Genus database with same CATH superfamily
2N52A 1LR9A 3OXFA 2JYYA 1HPTA 2WVJA 2JW6A 3CXLA 4WP4A 1WKXA 2QPOA 2V1CA 2W0TA 1IW4A 3UGIA 5HQ8A 2DKVA 1HDLA 1K7UA 2NU0I 1MJBA 1P9ZA 2J9RA 1MJ9A 1ULKA 2Y0MA 5E3RA 1TBRR 2FNFX 2ORWA 1TURA 5FUVA 2GVIA 2RIJA 2ODDA 2ROWA 4GI3C 4JCVE 2E73A 4UXJA 1SGPI 2VRWB 1W3SA 1N13A 2LB7A 2ORVA 1Y1BA 3FSYA 1OVOA 2GKRI 2JZMA 2SGQI 1MT1A 7WGAA 1OMUA 4MPIA 2B8TA 2A20A 1PPFI 3E2IA 2DB6A 1WTJA 1BUSA 1RFHA 1V1HA 1Z2IA 2J87A 2KMPA 3KY9A 3VDPA 1H0ZA 3QTLD 1CGII 3R5CA 5J8CA 1NUBA 2DIPA 5JHWC 1DS3I 2N1AB 3PDNA 1Q9BA 2NU4I 2OZUA 1FAQA 2K9HA 1XA6A 3UEJA 1Y1CA 2V1CC 2JA1A 1BMOA 3RU0A 1CSOI 1LR7A 1FARA 1SGDI 2X52A 5CCMA 1PCEA 2V53A 3B4VC 4A24A 2LUYA 5J8FA 3GOXA 2L8EA 1KBEA 2PQ8A 3R5DA 3UFFA 2KMOA 1CHOI 1R0RI 3OXLA 1OYVI 1TUSA 2NU1I 1SGQI 2YUUA 3BJIA 9WGAA 3TJQA 2P6AC 3R5BA 5E3QA 5FUWA 2ELIA 3TO6A 2N17A 5EX3A 1CE3A 2SGDI 2B0UC 2M5XA 1KMAA 2ENNA 1OMTA 2KCXA 2JXDA 1SGYI 2LEOA 2F3CI 4E1RA 2SGPI 3MEKA 3SGBI 3QAHA 4UXHA 2BUSA 1IY5A 3D00A 5E3PA 1PTRA 2GKTI 1R79A 3OL0A 2YQPA 2OU2A 1WGCA 1X4SA 1YU6C 4UXIA 1LR8A 2KMQA 2OVOA 1CT2I 1CGJI 3TOBA 3UGLA 5CCLA 4DNCA 2CWHA 4HGUA 3TOAA 1S20A 1TBOA 2KMRA 2XRCA 2GIVA 2X3TA 4OVOA 1Y8FA 2SGFI 1W4RA 2NU3I 5FUXA 2UZ3A 1K7TA 2QQ0A 2QQCA 2RC4A 3VDUA 1NXUA 4AMLA 2L7XA 2WCYA 1WGTA 1P9GA 3TO9A 4SGBI 1U5KA 2CWGA 1HJAI 3OVOA 1VDDA 2E5RA 5EX0A 1SGRI 1FYBA 1PJUA 1X74A 3UEYA 1V1IA 3FSXA 3UOEA 1FY7A 3OXGA 1CT4I 1K7VA 2UVOA 2CWFA 3QWPA 1ULMA 4B6DA 1UVGA 1PTQA 2NU2I 3R5AA 4FKDA 1UUCA 2N71A 4L9MA 3SEKC 1TOTA 3VE5A 1IY6A 2SGEI 2QQDA 1TBQR 1MJAA 1TIHA 2GKVA 3E59A 2ENZA 3HH2C 1M8BA 3FC3A 2QQEA 5FUYA 2WGCA 1DS2I 1ULNA 1TBNA 1UVFA 1XX6A 2CJSC 5DAEA 2ARPF 1SGEI 1UHAA 1YTPA 1Z7KB 1TGSI 2ERWA 1CT0I 3SGQI 3TO7A 3UGDA 1HEVA 1AN1I 1M8CA 2OD1A 4E1PA 1XBTA 1KBFA 1SGNI 5HI7A
chains in the Genus database with same CATH topology
2N52A 1LR9A 3OXFA 2JYYA 1HPTA 2WVJA 2JW6A 3CXLA 3UFFA 1IW4A 2QPOA 2V1CA 2W0TA 3UGIA 5HQ8A 1HDLA 2NU0I 2J9RA 1TBRR 2FNFX 2ORWA 1TURA 5FUVA 2GVIA 2ODDA 2ROWA 4GI3C 4JCVE 2E73A 4UXJA 1SGPI 2VRWB 1W3SA 1N13A 2ORVA 1Y1BA 1OVOA 2GKRI 2JZMA 2SGQI 1MT1A 1OMUA 2B8TA 2A20A 1PPFI 3E2IA 2DB6A 1BUSA 1RFHA 1V1HA 2J87A 2KMPA 3KY9A 3VDPA 1H0ZA 3QTLD 1CGII 1NUBA 2DIPA 5JHWC 1DS3I 2N1AB 3PDNA 2NU4I 1FAQA 2K9HA 1XA6A 3UEJA 1Y1CA 2V1CC 2JA1A 1BMOA 3RU0A 1CSOI 1LR7A 1FARA 1SGDI 5CCMA 1PCEA 2V53A 3B4VC 2LUYA 3GOXA 2L8EA 1KBEA 2KMOA 1CHOI 1R0RI 3OXLA 1OYVI 1TUSA 2NU1I 1SGQI 2YUUA 3BJIA 3TJQA 2P6AC 5FUWA 2ELIA 2N17A 5EX3A 1CE3A 2SGDI 2B0UC 2M5XA 1KMAA 2ENNA 1OMTA 2KCXA 2JXDA 1SGYI 2LEOA 2F3CI 4E1RA 2SGPI 3MEKA 3SGBI 4UXHA 2BUSA 1IY5A 3D00A 1PTRA 2GKTI 1R79A 3OL0A 2YQPA 1X4SA 1YU6C 4UXIA 1LR8A 2KMQA 2OVOA 1CT2I 1CGJI 3UGLA 5CCLA 4HGUA 1TBOA 2KMRA 2XRCA 4OVOA 1Y8FA 2SGFI 1W4RA 2NU3I 2UZ3A 2QQ0A 2QQCA 3VDUA 2L7XA 2WCYA 4SGBI 1U5KA 1HJAI 3OVOA 1VDDA 2E5RA 5EX0A 1SGRI 1FYBA 1PJUA 1X74A 3UEYA 1V1IA 3OXGA 1CT4I 3QWPA 4B6DA 1UVGA 1PTQA 2NU2I 4L9MA 4FKDA 1UUCA 2N71A 3VE5A 3SEKC 1TOTA 1IY6A 2SGEI 2QQDA 1TBQR 1TIHA 3E59A 2GKVA 3HH2C 2ENZA 3FC3A 1M8BA 2QQEA 5FUYA 5FUXA 1DS2I 1UVFA 1TBNA 1XX6A 2CJSC 5DAEA 2ARPF 1SGEI 1YTPA 3SGQI 1Z7KB 1TGSI 2ERWA 1CT0I 3UGDA 4A24A 1AN1I 1M8CA 2OD1A 4E1PA 1XBTA 1KBFA 1SGNI 5HI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UFF A;  2WVJ A;  3CXL A;  4UXH A;  2QPO A;  3UGI A;  1PTR A;  1FAQ A;  1R79 A;  1XA6 A;  3UEJ A;  3UEY A;  2J9R A;  2JA1 A;  1FAR A;  4UXI A;  2FNF X;  2ORW A;  5FUV A;  4B6D A;  3UGL A;  1PTQ A;  2GVI A;  4FKD A;  4L9M A;  1KBE A;  2ROW A;  4UXJ A;  2E73 A;  2VRW B;  2ORV A;  2YUU A;  1TBO A;  2ENZ A;  3BJI A;  2QQE A;  5FUY A;  5FUX A;  5FUW A;  1Y8F A;  1TBN A;  2ELI A;  1XX6 A;  1W4R A;  2B8T A;  2UZ3 A;  3UGD A;  3E2I A;  2DB6 A;  2QQ0 A;  1RFH A;  2J87 A;  1KBF A;  1XBT A;  2ENN A;  3KY9 A; 
#chains in the Genus database with same CATH topology
 2N52 A;  1LR9 A;  3OXF A;  2JYY A;  1HPT A;  2WVJ A;  2JW6 A;  3CXL A;  4WP4 A;  1WKX A;  2QPO A;  2V1C A;  2W0T A;  1IW4 A;  3UGI A;  5HQ8 A;  2DKV A;  1HDL A;  1K7U A;  2NU0 I;  1MJB A;  1P9Z A;  2J9R A;  1MJ9 A;  1ULK A;  2Y0M A;  5E3R A;  1TBR R;  2FNF X;  2ORW A;  1TUR A;  5FUV A;  2GVI A;  2RIJ A;  2ODD A;  2ROW A;  4GI3 C;  4JCV E;  2E73 A;  4UXJ A;  1SGP I;  2VRW B;  1W3S A;  1N13 A;  2LB7 A;  2ORV A;  1Y1B A;  3FSY A;  1OVO A;  2GKR I;  2JZM A;  2SGQ I;  1MT1 A;  7WGA A;  1OMU A;  4MPI A;  2B8T A;  2A20 A;  1PPF I;  3E2I A;  2DB6 A;  1WTJ A;  1BUS A;  1RFH A;  1V1H A;  1Z2I A;  2J87 A;  2KMP A;  3KY9 A;  3VDP A;  1H0Z A;  3QTL D;  1CGI I;  3R5C A;  5J8C A;  1NUB A;  2DIP A;  5JHW C;  1DS3 I;  2N1A B;  3PDN A;  1Q9B A;  2NU4 I;  2OZU A;  1FAQ A;  2K9H A;  1XA6 A;  3UEJ A;  1Y1C A;  2V1C C;  2JA1 A;  1BMO A;  3RU0 A;  1CSO I;  1LR7 A;  1FAR A;  1SGD I;  2X52 A;  5CCM A;  1PCE A;  2V53 A;  3B4V C;  4A24 A;  2LUY A;  5J8F A;  3GOX A;  2L8E A;  1KBE A;  2PQ8 A;  3R5D A;  3UFF A;  2KMO A;  1CHO I;  1R0R I;  3OXL A;  1OYV I;  1TUS A;  2NU1 I;  1SGQ I;  2YUU A;  3BJI A;  9WGA A;  3TJQ A;  2P6A C;  3R5B A;  5E3Q A;  5FUW A;  2ELI A;  3TO6 A;  2N17 A;  5EX3 A;  1CE3 A;  2SGD I;  2B0U C;  2M5X A;  1KMA A;  2ENN A;  1OMT A;  2KCX A;  2JXD A;  1SGY I;  2LEO A;  2F3C I;  4E1R A;  2SGP I;  3MEK A;  3SGB I;  3QAH A;  4UXH A;  2BUS A;  1IY5 A;  3D00 A;  5E3P A;  1PTR A;  2GKT I;  1R79 A;  3OL0 A;  2YQP A;  2OU2 A;  1WGC A;  1X4S A;  1YU6 C;  4UXI A;  1LR8 A;  2KMQ A;  2OVO A;  1CT2 I;  1CGJ I;  3TOB A;  3UGL A;  5CCL A;  4DNC A;  2CWH A;  4HGU A;  3TOA A;  1S20 A;  1TBO A;  2KMR A;  2XRC A;  2GIV A;  2X3T A;  4OVO A;  1Y8F A;  2SGF I;  1W4R A;  2NU3 I;  5FUX A;  2UZ3 A;  1K7T A;  2QQ0 A;  2QQC A;  2RC4 A;  3VDU A;  1NXU A;  4AML A;  2L7X A;  2WCY A;  1WGT A;  1P9G A;  3TO9 A;  4SGB I;  1U5K A;  2CWG A;  1HJA I;  3OVO A;  1VDD A;  2E5R A;  5EX0 A;  1SGR I;  1FYB A;  1PJU A;  1X74 A;  3UEY A;  1V1I A;  3FSX A;  3UOE A;  1FY7 A;  3OXG A;  1CT4 I;  1K7V A;  2UVO A;  2CWF A;  3QWP A;  1ULM A;  4B6D A;  1UVG A;  1PTQ A;  2NU2 I;  3R5A A;  4FKD A;  1UUC A;  2N71 A;  4L9M A;  3SEK C;  1TOT A;  3VE5 A;  1IY6 A;  2SGE I;  2QQD A;  1TBQ R;  1MJA A;  1TIH A;  2GKV A;  3E59 A;  2ENZ A;  3HH2 C;  1M8B A;  3FC3 A;  2QQE A;  5FUY A;  2WGC A;  1DS2 I;  1ULN A;  1TBN A;  1UVF A;  1XX6 A;  2CJS C;  5DAE A;  2ARP F;  1SGE I;  1UHA A;  1YTP A;  1Z7K B;  1TGS I;  2ERW A;  1CT0 I;  3SGQ I;  3TO7 A;  3UGD A;  1HEV A;  1AN1 I;  1M8C A;  2OD1 A;  4E1P A;  1XBT A;  1KBF A;  1SGN I;  5HI7 A; 
#chains in the Genus database with same CATH homology
 2N52 A;  1LR9 A;  3OXF A;  2JYY A;  1HPT A;  2WVJ A;  2JW6 A;  3CXL A;  3UFF A;  1IW4 A;  2QPO A;  2V1C A;  2W0T A;  3UGI A;  5HQ8 A;  1HDL A;  2NU0 I;  2J9R A;  1TBR R;  2FNF X;  2ORW A;  1TUR A;  5FUV A;  2GVI A;  2ODD A;  2ROW A;  4GI3 C;  4JCV E;  2E73 A;  4UXJ A;  1SGP I;  2VRW B;  1W3S A;  1N13 A;  2ORV A;  1Y1B A;  1OVO A;  2GKR I;  2JZM A;  2SGQ I;  1MT1 A;  1OMU A;  2B8T A;  2A20 A;  1PPF I;  3E2I A;  2DB6 A;  1BUS A;  1RFH A;  1V1H A;  2J87 A;  2KMP A;  3KY9 A;  3VDP A;  1H0Z A;  3QTL D;  1CGI I;  1NUB A;  2DIP A;  5JHW C;  1DS3 I;  2N1A B;  3PDN A;  2NU4 I;  1FAQ A;  2K9H A;  1XA6 A;  3UEJ A;  1Y1C A;  2V1C C;  2JA1 A;  1BMO A;  3RU0 A;  1CSO I;  1LR7 A;  1FAR A;  1SGD I;  5CCM A;  1PCE A;  2V53 A;  3B4V C;  2LUY A;  3GOX A;  2L8E A;  1KBE A;  2KMO A;  1CHO I;  1R0R I;  3OXL A;  1OYV I;  1TUS A;  2NU1 I;  1SGQ I;  2YUU A;  3BJI A;  3TJQ A;  2P6A C;  5FUW A;  2ELI A;  2N17 A;  5EX3 A;  1CE3 A;  2SGD I;  2B0U C;  2M5X A;  1KMA A;  2ENN A;  1OMT A;  2KCX A;  2JXD A;  1SGY I;  2LEO A;  2F3C I;  4E1R A;  2SGP I;  3MEK A;  3SGB I;  4UXH A;  2BUS A;  1IY5 A;  3D00 A;  1PTR A;  2GKT I;  1R79 A;  3OL0 A;  2YQP A;  1X4S A;  1YU6 C;  4UXI A;  1LR8 A;  2KMQ A;  2OVO A;  1CT2 I;  1CGJ I;  3UGL A;  5CCL A;  4HGU A;  1TBO A;  2KMR A;  2XRC A;  4OVO A;  1Y8F A;  2SGF I;  1W4R A;  2NU3 I;  2UZ3 A;  2QQ0 A;  2QQC A;  3VDU A;  2L7X A;  2WCY A;  4SGB I;  1U5K A;  1HJA I;  3OVO A;  1VDD A;  2E5R A;  5EX0 A;  1SGR I;  1FYB A;  1PJU A;  1X74 A;  3UEY A;  1V1I A;  3OXG A;  1CT4 I;  3QWP A;  4B6D A;  1UVG A;  1PTQ A;  2NU2 I;  4L9M A;  4FKD A;  1UUC A;  2N71 A;  3VE5 A;  3SEK C;  1TOT A;  1IY6 A;  2SGE I;  2QQD A;  1TBQ R;  1TIH A;  3E59 A;  2GKV A;  3HH2 C;  2ENZ A;  3FC3 A;  1M8B A;  2QQE A;  5FUY A;  5FUX A;  1DS2 I;  1UVF A;  1TBN A;  1XX6 A;  2CJS C;  5DAE A;  2ARP F;  1SGE I;  1YTP A;  3SGQ I;  1Z7K B;  1TGS I;  2ERW A;  1CT0 I;  3UGD A;  4A24 A;  1AN1 I;  1M8C A;  2OD1 A;  4E1P A;  1XBT A;  1KBF A;  1SGN I;  5HI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...