1TBNA

Nmr structure of a protein kinase c-g phorbol-binding domain, minimized average structure
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
66
structure length
66
Chain Sequence
QTDDPRNKHKFRLHSYSSPTFCDHCGSLLYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title NMR structure of a protein kinase C-gamma phorbol-binding domain and study of protein-lipid micelle interactions.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Calcium-binding protein
molecule keywords PROTEIN KINASE C, GAMMA TYPE
total genus 6
structure length 66
sequence length 66
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 1997-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1tbnA00
2WVJA 3UEJA 2UZ3A 3UFFA 2JA1A 1KBFA 2YUUA 2J9RA 1PTRA 1TBOA 2GVIA 2VRWB 3CXLA 1XBTA 2J87A 1W4RA 2QQEA 2ELIA 2QPOA 1R79A 1TBNA 2E73A 2DB6A 5FUXA 3UGDA 3UEYA 4UXIA 1FAQA 2ENZA 1XA6A 5FUVA 1XX6A 2ORWA 3BJIA 1RFHA 3UGLA 4L9MA 3UGIA 1KBEA 2ORVA 5FUYA 2ENNA 3E2IA 2ROWA 4B6DA 3KY9A 4FKDA 2FNFX 1PTQA 1Y8FA 4UXHA 4UXJA 2QQ0A 1FARA 2B8TA 5FUWA
chains in the Genus database with same CATH superfamily
1SGEI 2WVJA 1ULNA 1HDLA 1MJ9A 2JA1A 3PDNA 2J9RA 3VDUA 1HEVA 1V1HA 1N13A 1Y1CA 2B0UC 2NU4I 3FSYA 3FSXA 1VDDA 1CT0I 1OYVI 2K9HA 3RU0A 5CCMA 9WGAA 3GOXA 3UGDA 2CWHA 1IW4A 1CE3A 1UUCA 1CSOI 3BJIA 2WGCA 1K7VA 1RFHA 2W0TA 7WGAA 1KBEA 5FUYA 2KMQA 1Y1BA 1LR7A 1FYBA 3E2IA 2F3CI 2L7XA 4B6DA 3KY9A 3TO7A 2X52A 2FNFX 2DKVA 1K7UA 1MJBA 1M8BA 1Y8FA 1Z7KB 2KMRA 3OXFA 2B8TA 4HGUA 1H0ZA 5FUWA 3TOAA 1CGJI 3UEJA 2JXDA 3SGQI 1WGTA 2L8EA 3OXGA 3R5BA 1SGYI 2GVIA 3OL0A 3SGBI 1LR9A 1FARA 2SGPI 5EX0A 1XBTA 1BMOA 1LR8A 2M5XA 1UVGA 1SGPI 1W4RA 2ELIA 1SGQI 1PPFI 1FY7A 3QWPA 2LUYA 5E3RA 1WKXA 2E73A 2OZUA 2DB6A 3R5AA 2KCXA 3R5DA 1Q9BA 2OU2A 2SGEI 1FAQA 1XA6A 1CHOI 1W3SA 2QQDA 1PCEA 5DAEA 5E3QA 3B4VC 1BUSA 3UGIA 2N52A 3OXLA 2ENNA 1V1IA 3TJQA 2P6AC 2NU1I 1UVFA 1MT1A 2SGFI 3QTLD 1ULMA 4MPIA 5HI7A 1PTQA 4UXHA 4UXJA 1OVOA 2QQ0A 2WCYA 4AMLA 1TBQR 1CGII 3VDPA 3FC3A 2UZ3A 1AN1I 2QQCA 3TO6A 2LB7A 2GKVA 1PTRA 2NU0I 1K7TA 1TBOA 3CXLA 2VRWB 2X3TA 1ULKA 2KMOA 1TURA 2J87A 2V1CC 2A20A 1NUBA 1SGDI 2N1AB 4E1RA 1TBNA 1YTPA 1M8CA 2N17A 2CJSC 4DNCA 1IY6A 4A24A 3UEYA 1WGCA 4UXIA 1TGSI 1IY5A 2RC4A 1SGRI 3VE5A 2N71A 2JW6A 1S20A 1TIHA 3TOBA 1SGNI 4L9MA 4E1PA 1NXUA 2ORVA 2Y0MA 4GI3C 2BUSA 1PJUA 4FKDA 1OMUA 5EX3A 2DIPA 3E59A 1Z2IA 2OD1A 2YQPA 1HPTA 5J8CA 1XX6A 1CT2I 2YUUA 1CT4I 2PQ8A 1DS3I 1OMTA 1P9ZA 2CWFA 2JYYA 4OVOA 3UFFA 1KMAA 2NU2I 2SGQI 1KBFA 2OVOA 1WTJA 2GKRI 3R5CA 5CCLA 1DS2I 2V1CA 2ODDA 2QQEA 2ARPF 2KMPA 2QPOA 3QAHA 3D00A 3UOEA 2LEOA 1R79A 1UHAA 2GKTI 2SGDI 3SEKC 5HQ8A 1TOTA 5FUXA 2V53A 3HH2C 4SGBI 5JHWC 1TUSA 4WP4A 2UVOA 2ENZA 5FUVA 1HJAI 1YU6C 2GIVA 3OVOA 2ORWA 2JZMA 3TO9A 2E5RA 3UGLA 1P9GA 4JCVE 1U5KA 1X74A 2ROWA 5E3PA 5J8FA 1MJAA 1X4SA 2ERWA 2NU3I 2XRCA 2CWGA 1R0RI 2RIJA 1TBRR 3MEKA
chains in the Genus database with same CATH topology
1SGEI 2WVJA 1HDLA 2JA1A 3PDNA 2J9RA 3VDUA 1V1HA 1N13A 1Y1CA 2B0UC 2NU4I 1VDDA 1CT0I 1OYVI 2K9HA 3RU0A 5CCMA 3GOXA 3UGDA 1IW4A 1CE3A 1UUCA 1CSOI 3BJIA 1RFHA 2W0TA 1KBEA 5FUYA 2KMQA 1Y1BA 1LR7A 1FYBA 3E2IA 2F3CI 2L7XA 4B6DA 3KY9A 2FNFX 1M8BA 1Y8FA 1Z7KB 2KMRA 3OXFA 2B8TA 4HGUA 1H0ZA 5FUWA 1CGJI 3UEJA 2JXDA 3SGQI 2L8EA 3OXGA 1SGYI 2GVIA 3OL0A 3SGBI 1LR9A 1FARA 2SGPI 5EX0A 1XBTA 1BMOA 1LR8A 2M5XA 1UVGA 1SGPI 1W4RA 2ELIA 1SGQI 1PPFI 3QWPA 2LUYA 2E73A 2DB6A 2KCXA 2SGEI 1FAQA 1XA6A 1CHOI 1W3SA 2QQDA 1PCEA 5DAEA 1BUSA 3B4VC 3UGIA 2N52A 3OXLA 2ENNA 1V1IA 3TJQA 2P6AC 2NU1I 1UVFA 1MT1A 2SGFI 3QTLD 5HI7A 1PTQA 4UXHA 4UXJA 1OVOA 2QQ0A 2WCYA 1TBQR 1CGII 3VDPA 3FC3A 2UZ3A 1AN1I 2QQCA 2GKVA 1PTRA 2NU0I 1TBOA 3CXLA 2VRWB 2KMOA 1TURA 2J87A 2V1CC 2A20A 1NUBA 1SGDI 2N1AB 4E1RA 1TBNA 1YTPA 1M8CA 2N17A 2CJSC 1IY6A 4A24A 3UEYA 4UXIA 1TGSI 1IY5A 3VE5A 1SGRI 2N71A 2JW6A 4E1PA 1TIHA 1SGNI 4L9MA 2ORVA 4GI3C 2BUSA 1PJUA 4FKDA 1OMUA 5EX3A 2DIPA 3E59A 2OD1A 2YQPA 1HPTA 1XX6A 1CT2I 2YUUA 1CT4I 1DS3I 1OMTA 2JYYA 4OVOA 1KMAA 3UFFA 2NU2I 2SGQI 1KBFA 2OVOA 2GKRI 5CCLA 1DS2I 2V1CA 2ODDA 2QQEA 2ARPF 2KMPA 2QPOA 3D00A 2LEOA 1R79A 2GKTI 2SGDI 3SEKC 5HQ8A 1TOTA 5FUXA 2V53A 3HH2C 4SGBI 5JHWC 1TUSA 2ENZA 5FUVA 1HJAI 1YU6C 3OVOA 2ORWA 2JZMA 3UGLA 2E5RA 4JCVE 1U5KA 1X74A 2ROWA 1X4SA 2ERWA 2NU3I 2XRCA 1R0RI 1TBRR 3MEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WVJ A;  3UEJ A;  2UZ3 A;  3UFF A;  2JA1 A;  1KBF A;  2YUU A;  2J9R A;  1PTR A;  1TBO A;  2GVI A;  2VRW B;  3CXL A;  1XBT A;  2J87 A;  1W4R A;  2QQE A;  2ELI A;  2QPO A;  1R79 A;  1TBN A;  2E73 A;  2DB6 A;  5FUX A;  3UGD A;  3UEY A;  4UXI A;  1FAQ A;  2ENZ A;  1XA6 A;  5FUV A;  1XX6 A;  2ORW A;  3BJI A;  1RFH A;  3UGL A;  4L9M A;  3UGI A;  1KBE A;  2ORV A;  5FUY A;  2ENN A;  3E2I A;  2ROW A;  4B6D A;  3KY9 A;  4FKD A;  2FNF X;  1PTQ A;  1Y8F A;  4UXH A;  4UXJ A;  2QQ0 A;  1FAR A;  2B8T A;  5FUW A; 
#chains in the Genus database with same CATH topology
 1SGE I;  2WVJ A;  1ULN A;  1HDL A;  1MJ9 A;  2JA1 A;  3PDN A;  2J9R A;  3VDU A;  1HEV A;  1V1H A;  1N13 A;  1Y1C A;  2B0U C;  2NU4 I;  3FSY A;  3FSX A;  1VDD A;  1CT0 I;  1OYV I;  2K9H A;  3RU0 A;  5CCM A;  9WGA A;  3GOX A;  3UGD A;  2CWH A;  1IW4 A;  1CE3 A;  1UUC A;  1CSO I;  3BJI A;  2WGC A;  1K7V A;  1RFH A;  2W0T A;  7WGA A;  1KBE A;  5FUY A;  2KMQ A;  1Y1B A;  1LR7 A;  1FYB A;  3E2I A;  2F3C I;  2L7X A;  4B6D A;  3KY9 A;  3TO7 A;  2X52 A;  2FNF X;  2DKV A;  1K7U A;  1MJB A;  1M8B A;  1Y8F A;  1Z7K B;  2KMR A;  3OXF A;  2B8T A;  4HGU A;  1H0Z A;  5FUW A;  3TOA A;  1CGJ I;  3UEJ A;  2JXD A;  3SGQ I;  1WGT A;  2L8E A;  3OXG A;  3R5B A;  1SGY I;  2GVI A;  3OL0 A;  3SGB I;  1LR9 A;  1FAR A;  2SGP I;  5EX0 A;  1XBT A;  1BMO A;  1LR8 A;  2M5X A;  1UVG A;  1SGP I;  1W4R A;  2ELI A;  1SGQ I;  1PPF I;  1FY7 A;  3QWP A;  2LUY A;  5E3R A;  1WKX A;  2E73 A;  2OZU A;  2DB6 A;  3R5A A;  2KCX A;  3R5D A;  1Q9B A;  2OU2 A;  2SGE I;  1FAQ A;  1XA6 A;  1CHO I;  1W3S A;  2QQD A;  1PCE A;  5DAE A;  5E3Q A;  3B4V C;  1BUS A;  3UGI A;  2N52 A;  3OXL A;  2ENN A;  1V1I A;  3TJQ A;  2P6A C;  2NU1 I;  1UVF A;  1MT1 A;  2SGF I;  3QTL D;  1ULM A;  4MPI A;  5HI7 A;  1PTQ A;  4UXH A;  4UXJ A;  1OVO A;  2QQ0 A;  2WCY A;  4AML A;  1TBQ R;  1CGI I;  3VDP A;  3FC3 A;  2UZ3 A;  1AN1 I;  2QQC A;  3TO6 A;  2LB7 A;  2GKV A;  1PTR A;  2NU0 I;  1K7T A;  1TBO A;  3CXL A;  2VRW B;  2X3T A;  1ULK A;  2KMO A;  1TUR A;  2J87 A;  2V1C C;  2A20 A;  1NUB A;  1SGD I;  2N1A B;  4E1R A;  1TBN A;  1YTP A;  1M8C A;  2N17 A;  2CJS C;  4DNC A;  1IY6 A;  4A24 A;  3UEY A;  1WGC A;  4UXI A;  1TGS I;  1IY5 A;  2RC4 A;  1SGR I;  3VE5 A;  2N71 A;  2JW6 A;  1S20 A;  1TIH A;  3TOB A;  1SGN I;  4L9M A;  4E1P A;  1NXU A;  2ORV A;  2Y0M A;  4GI3 C;  2BUS A;  1PJU A;  4FKD A;  1OMU A;  5EX3 A;  2DIP A;  3E59 A;  1Z2I A;  2OD1 A;  2YQP A;  1HPT A;  5J8C A;  1XX6 A;  1CT2 I;  2YUU A;  1CT4 I;  2PQ8 A;  1DS3 I;  1OMT A;  1P9Z A;  2CWF A;  2JYY A;  4OVO A;  3UFF A;  1KMA A;  2NU2 I;  2SGQ I;  1KBF A;  2OVO A;  1WTJ A;  2GKR I;  3R5C A;  5CCL A;  1DS2 I;  2V1C A;  2ODD A;  2QQE A;  2ARP F;  2KMP A;  2QPO A;  3QAH A;  3D00 A;  3UOE A;  2LEO A;  1R79 A;  1UHA A;  2GKT I;  2SGD I;  3SEK C;  5HQ8 A;  1TOT A;  5FUX A;  2V53 A;  3HH2 C;  4SGB I;  5JHW C;  1TUS A;  4WP4 A;  2UVO A;  2ENZ A;  5FUV A;  1HJA I;  1YU6 C;  2GIV A;  3OVO A;  2ORW A;  2JZM A;  3TO9 A;  2E5R A;  3UGL A;  1P9G A;  4JCV E;  1U5K A;  1X74 A;  2ROW A;  5E3P A;  5J8F A;  1MJA A;  1X4S A;  2ERW A;  2NU3 I;  2XRC A;  2CWG A;  1R0R I;  2RIJ A;  1TBR R;  3MEK A; 
#chains in the Genus database with same CATH homology
 1SGE I;  2WVJ A;  1HDL A;  2JA1 A;  3PDN A;  2J9R A;  3VDU A;  1V1H A;  1N13 A;  1Y1C A;  2B0U C;  2NU4 I;  1VDD A;  1CT0 I;  1OYV I;  2K9H A;  3RU0 A;  5CCM A;  3GOX A;  3UGD A;  1IW4 A;  1CE3 A;  1UUC A;  1CSO I;  3BJI A;  1RFH A;  2W0T A;  1KBE A;  5FUY A;  2KMQ A;  1Y1B A;  1LR7 A;  1FYB A;  3E2I A;  2F3C I;  2L7X A;  4B6D A;  3KY9 A;  2FNF X;  1M8B A;  1Y8F A;  1Z7K B;  2KMR A;  3OXF A;  2B8T A;  4HGU A;  1H0Z A;  5FUW A;  1CGJ I;  3UEJ A;  2JXD A;  3SGQ I;  2L8E A;  3OXG A;  1SGY I;  2GVI A;  3OL0 A;  3SGB I;  1LR9 A;  1FAR A;  2SGP I;  5EX0 A;  1XBT A;  1BMO A;  1LR8 A;  2M5X A;  1UVG A;  1SGP I;  1W4R A;  2ELI A;  1SGQ I;  1PPF I;  3QWP A;  2LUY A;  2E73 A;  2DB6 A;  2KCX A;  2SGE I;  1FAQ A;  1XA6 A;  1CHO I;  1W3S A;  2QQD A;  1PCE A;  5DAE A;  1BUS A;  3B4V C;  3UGI A;  2N52 A;  3OXL A;  2ENN A;  1V1I A;  3TJQ A;  2P6A C;  2NU1 I;  1UVF A;  1MT1 A;  2SGF I;  3QTL D;  5HI7 A;  1PTQ A;  4UXH A;  4UXJ A;  1OVO A;  2QQ0 A;  2WCY A;  1TBQ R;  1CGI I;  3VDP A;  3FC3 A;  2UZ3 A;  1AN1 I;  2QQC A;  2GKV A;  1PTR A;  2NU0 I;  1TBO A;  3CXL A;  2VRW B;  2KMO A;  1TUR A;  2J87 A;  2V1C C;  2A20 A;  1NUB A;  1SGD I;  2N1A B;  4E1R A;  1TBN A;  1YTP A;  1M8C A;  2N17 A;  2CJS C;  1IY6 A;  4A24 A;  3UEY A;  4UXI A;  1TGS I;  1IY5 A;  3VE5 A;  1SGR I;  2N71 A;  2JW6 A;  4E1P A;  1TIH A;  1SGN I;  4L9M A;  2ORV A;  4GI3 C;  2BUS A;  1PJU A;  4FKD A;  1OMU A;  5EX3 A;  2DIP A;  3E59 A;  2OD1 A;  2YQP A;  1HPT A;  1XX6 A;  1CT2 I;  2YUU A;  1CT4 I;  1DS3 I;  1OMT A;  2JYY A;  4OVO A;  1KMA A;  3UFF A;  2NU2 I;  2SGQ I;  1KBF A;  2OVO A;  2GKR I;  5CCL A;  1DS2 I;  2V1C A;  2ODD A;  2QQE A;  2ARP F;  2KMP A;  2QPO A;  3D00 A;  2LEO A;  1R79 A;  2GKT I;  2SGD I;  3SEK C;  5HQ8 A;  1TOT A;  5FUX A;  2V53 A;  3HH2 C;  4SGB I;  5JHW C;  1TUS A;  2ENZ A;  5FUV A;  1HJA I;  1YU6 C;  3OVO A;  2ORW A;  2JZM A;  3UGL A;  2E5R A;  4JCV E;  1U5K A;  1X74 A;  2ROW A;  1X4S A;  2ERW A;  2NU3 I;  2XRC A;  1R0R I;  1TBR R;  3MEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...