1TBNA

Nmr structure of a protein kinase c-g phorbol-binding domain, minimized average structure
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
66
structure length
66
Chain Sequence
QTDDPRNKHKFRLHSYSSPTFCDHCGSLLYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN KINASE C, GAMMA TYPE
publication title NMR structure of a protein kinase C-gamma phorbol-binding domain and study of protein-lipid micelle interactions.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Calcium-binding protein
total genus 6
structure length 66
sequence length 66
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 1997-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1tbnA00
4UXHA 1TBOA 1R79A 3CXLA 1PTRA 2ELIA 2GVIA 5FUWA 3UEYA 2WVJA 3BJIA 4FKDA 2UZ3A 5FUVA 3KY9A 2VRWB 2ENZA 2ORVA 2YUUA 3E2IA 2QPOA 2FNFX 4B6DA 1RFHA 2ROWA 1XBTA 2JA1A 1Y8FA 2J87A 2E73A 1W4RA 3UGDA 2J9RA 1KBEA 3UGLA 1XA6A 3UEJA 3UGIA 2B8TA 5FUYA 1TBNA 3UFFA 4L9MA 1KBFA 4UXIA 1FARA 2DB6A 2ENNA 2QQEA 2QQ0A 5FUXA 1FAQA 1XX6A 2ORWA 4UXJA 1PTQA
chains in the Genus database with same CATH superfamily
2GKTI 1TBOA 1U5KA 3CXLA 5FUWA 2KMRA 1IY6A 1SGDI 2WVJA 3FSYA 1YTPA 2WGCA 5FUVA 2KMOA 4E1PA 3QTLD 1MJBA 1M8BA 2VRWB 1TURA 1SGYI 3MEKA 3E2IA 1LR8A 2PQ8A 1OMTA 2ROWA 1FYBA 2OU2A 1XBTA 2JA1A 1NXUA 1PPFI 1TBRR 2L8EA 1ULKA 4WP4A 2J9RA 5HI7A 1WKXA 1XA6A 3VDUA 2OD1A 2OZUA 1MT1A 2JZMA 2KCXA 3SEKC 3UEJA 3TO7A 2M5XA 3QWPA 3TO9A 3UFFA 1P9GA 1KBFA 2N1AB 1WTJA 4E1RA 4UXIA 3B4VC 1Y1BA 2CWFA 2JXDA 3OXLA 2UVOA 2DIPA 2GIVA 5EX3A 5FUXA 4A24A 4UXJA 3R5AA 1WGTA 1R79A 2CWGA 1M8CA 1PTRA 2ERWA 3QAHA 3UEYA 3R5DA 4FKDA 3VDPA 3HH2C 1IY5A 1Y1CA 3KY9A 2ENZA 3RU0A 1HJAI 1VDDA 1TBQR 2NU0I 2B0UC 4GI3C 1UVGA 2L7XA 1MJ9A 1HDLA 1TUSA 5HQ8A 1Y8FA 2WCYA 1P9ZA 2NU4I 2P6AC 3OXGA 3TOBA 4AMLA 1CT2I 2DKVA 2LB7A 1K7TA 2BUSA 4DNCA 4MPIA 5FUYA 1TBNA 3R5BA 2F3CI 4L9MA 1W3SA 4SGBI 3GOXA 2LEOA 1ULNA 2X3TA 1YU6C 5E3RA 1H0ZA 1MJAA 1SGQI 2KMQA 2RC4A 1SGRI 2V53A 5JHWC 5CCLA 1R0RI 1N13A 1CSOI 4UXHA 1CGII 5EX0A 4JCVE 1LR7A 2GVIA 2ARPF 1BUSA 1UHAA 2GKRI 3OXFA 9WGAA 3SGQI 3TJQA 1KMAA 2QPOA 1K7UA 2FNFX 1AN1I 3FSXA 1UVFA 2V1CC 3OVOA 1Q9BA 2J87A 1LR9A 1OMUA 1W4RA 2E73A 1CGJI 2GKVA 2ODDA 2OVOA 1PJUA 3E59A 5J8FA 5J8CA 1CHOI 2CJSC 4OVOA 3UGIA 3TO6A 1HPTA 2XRCA 2K9HA 1HEVA 1TOTA 5CCMA 3FC3A 1K7VA 2N17A 5E3PA 1S20A 1SGNI 1TIHA 1X4SA 1FARA 3OL0A 1IW4A 2N52A 3UOEA 2ENNA 1FAQA 1SGEI 1ULMA 2ORWA 2SGFI 2LUYA 1WGCA 1V1IA 2NU2I 1TGSI 2ELIA 2JYYA 2SGDI 2Y0MA 3BJIA 5E3QA 2UZ3A 7WGAA 1V1HA 1OVOA 2JW6A 2SGQI 2QQDA 2RIJA 2NU3I 2YUUA 2ORVA 1PCEA 1Z7KB 2V1CA 2YQPA 3TOAA 2NU1I 1CT0I 2CWHA 1RFHA 1X74A 4B6DA 2KMPA 1NUBA 1BMOA 1DS2I 1DS3I 2SGPI 2SGEI 2W0TA 3UGDA 2X52A 5DAEA 3VE5A 1CE3A 3UGLA 1KBEA 4HGUA 1FY7A 1OYVI 1CT4I 2B8TA 3R5CA 3D00A 2A20A 2E5RA 2N71A 2DB6A 2QQEA 1UUCA 2QQ0A 1XX6A 3PDNA 3SGBI 2QQCA 1PTQA 1Z2IA 1SGPI
chains in the Genus database with same CATH topology
2GKTI 1TBOA 1U5KA 3CXLA 5FUWA 2KMRA 1IY6A 1SGDI 2WVJA 1YTPA 5FUVA 2KMOA 4E1PA 3QTLD 1M8BA 2VRWB 1TURA 1SGYI 3MEKA 3E2IA 1LR8A 1OMTA 2ROWA 1FYBA 1XBTA 2JA1A 1PPFI 1TBRR 2L8EA 2J9RA 5HI7A 1XA6A 3VDUA 2OD1A 3SEKC 1MT1A 2JZMA 2KCXA 3UEJA 2M5XA 3QWPA 3UFFA 1KBFA 2N1AB 4E1RA 4UXIA 3B4VC 1Y1BA 2JXDA 3OXLA 5EX3A 5FUXA 2DIPA 4A24A 4UXJA 1R79A 2ERWA 1M8CA 1PTRA 3UEYA 4FKDA 3VDPA 3HH2C 1Y1CA 3KY9A 2ENZA 3RU0A 1HJAI 1VDDA 1TBQR 2NU0I 2B0UC 4GI3C 1UVGA 2L7XA 1HDLA 1TUSA 5HQ8A 1Y8FA 2WCYA 2NU4I 2P6AC 3OXGA 1CT2I 2BUSA 5FUYA 1TBNA 2F3CI 4L9MA 1W3SA 4SGBI 3GOXA 2LEOA 1H0ZA 1YU6C 1SGQI 2KMQA 2V53A 5JHWC 1SGRI 5CCLA 1R0RI 1N13A 1CSOI 4UXHA 1CGII 5EX0A 4JCVE 1LR7A 2GVIA 2ARPF 1BUSA 2GKRI 3OXFA 1KMAA 3SGQI 3TJQA 2QPOA 2FNFX 1AN1I 1UVFA 2V1CC 3OVOA 2J87A 1LR9A 1OMUA 1W4RA 2E73A 1CGJI 2GKVA 2ODDA 2OVOA 1PJUA 3E59A 1CHOI 2CJSC 4OVOA 3UGIA 1HPTA 2XRCA 2K9HA 1TOTA 5CCMA 3FC3A 2N17A 1IW4A 1SGNI 1TIHA 1X4SA 1FARA 3OL0A 2N52A 2ENNA 1FAQA 1SGEI 2ORWA 2SGFI 2LUYA 2NU2I 1V1IA 1TGSI 2ELIA 2JYYA 2SGDI 3BJIA 2UZ3A 1V1HA 1OVOA 2JW6A 2SGQI 2QQDA 2NU3I 2YUUA 2ORVA 1PCEA 1Z7KB 2V1CA 2YQPA 2NU1I 1CT0I 4B6DA 1RFHA 1X74A 2KMPA 1NUBA 1BMOA 1DS2I 1DS3I 2SGPI 2SGEI 2W0TA 3UGDA 3VE5A 5DAEA 1CE3A 3UGLA 1KBEA 4HGUA 1OYVI 1CT4I 2B8TA 3D00A 2A20A 2E5RA 2N71A 2DB6A 2QQEA 1UUCA 2QQ0A 1XX6A 3PDNA 3SGBI 2QQCA 1PTQA 1IY5A 1SGPI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UXH A;  1TBO A;  1R79 A;  3CXL A;  1PTR A;  2ELI A;  2GVI A;  5FUW A;  3UEY A;  2WVJ A;  3BJI A;  4FKD A;  2UZ3 A;  5FUV A;  3KY9 A;  2VRW B;  2ENZ A;  2ORV A;  2YUU A;  3E2I A;  2QPO A;  2FNF X;  4B6D A;  1RFH A;  2ROW A;  1XBT A;  2JA1 A;  1Y8F A;  2J87 A;  2E73 A;  1W4R A;  3UGD A;  2J9R A;  1KBE A;  3UGL A;  1XA6 A;  3UEJ A;  3UGI A;  2B8T A;  5FUY A;  1TBN A;  3UFF A;  4L9M A;  1KBF A;  4UXI A;  1FAR A;  2DB6 A;  2ENN A;  2QQE A;  2QQ0 A;  5FUX A;  1FAQ A;  1XX6 A;  2ORW A;  4UXJ A;  1PTQ A; 
#chains in the Genus database with same CATH topology
 2GKT I;  1TBO A;  1U5K A;  3CXL A;  5FUW A;  2KMR A;  1IY6 A;  1SGD I;  2WVJ A;  3FSY A;  1YTP A;  2WGC A;  5FUV A;  2KMO A;  4E1P A;  3QTL D;  1MJB A;  1M8B A;  2VRW B;  1TUR A;  1SGY I;  3MEK A;  3E2I A;  1LR8 A;  2PQ8 A;  1OMT A;  2ROW A;  1FYB A;  2OU2 A;  1XBT A;  2JA1 A;  1NXU A;  1PPF I;  1TBR R;  2L8E A;  1ULK A;  4WP4 A;  2J9R A;  5HI7 A;  1WKX A;  1XA6 A;  3VDU A;  2OD1 A;  2OZU A;  1MT1 A;  2JZM A;  2KCX A;  3SEK C;  3UEJ A;  3TO7 A;  2M5X A;  3QWP A;  3TO9 A;  3UFF A;  1P9G A;  1KBF A;  2N1A B;  1WTJ A;  4E1R A;  4UXI A;  3B4V C;  1Y1B A;  2CWF A;  2JXD A;  3OXL A;  2UVO A;  2DIP A;  2GIV A;  5EX3 A;  5FUX A;  4A24 A;  4UXJ A;  3R5A A;  1WGT A;  1R79 A;  2CWG A;  1M8C A;  1PTR A;  2ERW A;  3QAH A;  3UEY A;  3R5D A;  4FKD A;  3VDP A;  3HH2 C;  1IY5 A;  1Y1C A;  3KY9 A;  2ENZ A;  3RU0 A;  1HJA I;  1VDD A;  1TBQ R;  2NU0 I;  2B0U C;  4GI3 C;  1UVG A;  2L7X A;  1MJ9 A;  1HDL A;  1TUS A;  5HQ8 A;  1Y8F A;  2WCY A;  1P9Z A;  2NU4 I;  2P6A C;  3OXG A;  3TOB A;  4AML A;  1CT2 I;  2DKV A;  2LB7 A;  1K7T A;  2BUS A;  4DNC A;  4MPI A;  5FUY A;  1TBN A;  3R5B A;  2F3C I;  4L9M A;  1W3S A;  4SGB I;  3GOX A;  2LEO A;  1ULN A;  2X3T A;  1YU6 C;  5E3R A;  1H0Z A;  1MJA A;  1SGQ I;  2KMQ A;  2RC4 A;  1SGR I;  2V53 A;  5JHW C;  5CCL A;  1R0R I;  1N13 A;  1CSO I;  4UXH A;  1CGI I;  5EX0 A;  4JCV E;  1LR7 A;  2GVI A;  2ARP F;  1BUS A;  1UHA A;  2GKR I;  3OXF A;  9WGA A;  3SGQ I;  3TJQ A;  1KMA A;  2QPO A;  1K7U A;  2FNF X;  1AN1 I;  3FSX A;  1UVF A;  2V1C C;  3OVO A;  1Q9B A;  2J87 A;  1LR9 A;  1OMU A;  1W4R A;  2E73 A;  1CGJ I;  2GKV A;  2ODD A;  2OVO A;  1PJU A;  3E59 A;  5J8F A;  5J8C A;  1CHO I;  2CJS C;  4OVO A;  3UGI A;  3TO6 A;  1HPT A;  2XRC A;  2K9H A;  1HEV A;  1TOT A;  5CCM A;  3FC3 A;  1K7V A;  2N17 A;  5E3P A;  1S20 A;  1SGN I;  1TIH A;  1X4S A;  1FAR A;  3OL0 A;  1IW4 A;  2N52 A;  3UOE A;  2ENN A;  1FAQ A;  1SGE I;  1ULM A;  2ORW A;  2SGF I;  2LUY A;  1WGC A;  1V1I A;  2NU2 I;  1TGS I;  2ELI A;  2JYY A;  2SGD I;  2Y0M A;  3BJI A;  5E3Q A;  2UZ3 A;  7WGA A;  1V1H A;  1OVO A;  2JW6 A;  2SGQ I;  2QQD A;  2RIJ A;  2NU3 I;  2YUU A;  2ORV A;  1PCE A;  1Z7K B;  2V1C A;  2YQP A;  3TOA A;  2NU1 I;  1CT0 I;  2CWH A;  1RFH A;  1X74 A;  4B6D A;  2KMP A;  1NUB A;  1BMO A;  1DS2 I;  1DS3 I;  2SGP I;  2SGE I;  2W0T A;  3UGD A;  2X52 A;  5DAE A;  3VE5 A;  1CE3 A;  3UGL A;  1KBE A;  4HGU A;  1FY7 A;  1OYV I;  1CT4 I;  2B8T A;  3R5C A;  3D00 A;  2A20 A;  2E5R A;  2N71 A;  2DB6 A;  2QQE A;  1UUC A;  2QQ0 A;  1XX6 A;  3PDN A;  3SGB I;  2QQC A;  1PTQ A;  1Z2I A;  1SGP I; 
#chains in the Genus database with same CATH homology
 2GKT I;  1TBO A;  1U5K A;  3CXL A;  5FUW A;  2KMR A;  1IY6 A;  1SGD I;  2WVJ A;  1YTP A;  5FUV A;  2KMO A;  4E1P A;  3QTL D;  1M8B A;  2VRW B;  1TUR A;  1SGY I;  3MEK A;  3E2I A;  1LR8 A;  1OMT A;  2ROW A;  1FYB A;  1XBT A;  2JA1 A;  1PPF I;  1TBR R;  2L8E A;  2J9R A;  5HI7 A;  1XA6 A;  3VDU A;  2OD1 A;  3SEK C;  1MT1 A;  2JZM A;  2KCX A;  3UEJ A;  2M5X A;  3QWP A;  3UFF A;  1KBF A;  2N1A B;  4E1R A;  4UXI A;  3B4V C;  1Y1B A;  2JXD A;  3OXL A;  5EX3 A;  5FUX A;  2DIP A;  4A24 A;  4UXJ A;  1R79 A;  2ERW A;  1M8C A;  1PTR A;  3UEY A;  4FKD A;  3VDP A;  3HH2 C;  1Y1C A;  3KY9 A;  2ENZ A;  3RU0 A;  1HJA I;  1VDD A;  1TBQ R;  2NU0 I;  2B0U C;  4GI3 C;  1UVG A;  2L7X A;  1HDL A;  1TUS A;  5HQ8 A;  1Y8F A;  2WCY A;  2NU4 I;  2P6A C;  3OXG A;  1CT2 I;  2BUS A;  5FUY A;  1TBN A;  2F3C I;  4L9M A;  1W3S A;  4SGB I;  3GOX A;  2LEO A;  1H0Z A;  1YU6 C;  1SGQ I;  2KMQ A;  2V53 A;  5JHW C;  1SGR I;  5CCL A;  1R0R I;  1N13 A;  1CSO I;  4UXH A;  1CGI I;  5EX0 A;  4JCV E;  1LR7 A;  2GVI A;  2ARP F;  1BUS A;  2GKR I;  3OXF A;  1KMA A;  3SGQ I;  3TJQ A;  2QPO A;  2FNF X;  1AN1 I;  1UVF A;  2V1C C;  3OVO A;  2J87 A;  1LR9 A;  1OMU A;  1W4R A;  2E73 A;  1CGJ I;  2GKV A;  2ODD A;  2OVO A;  1PJU A;  3E59 A;  1CHO I;  2CJS C;  4OVO A;  3UGI A;  1HPT A;  2XRC A;  2K9H A;  1TOT A;  5CCM A;  3FC3 A;  2N17 A;  1IW4 A;  1SGN I;  1TIH A;  1X4S A;  1FAR A;  3OL0 A;  2N52 A;  2ENN A;  1FAQ A;  1SGE I;  2ORW A;  2SGF I;  2LUY A;  2NU2 I;  1V1I A;  1TGS I;  2ELI A;  2JYY A;  2SGD I;  3BJI A;  2UZ3 A;  1V1H A;  1OVO A;  2JW6 A;  2SGQ I;  2QQD A;  2NU3 I;  2YUU A;  2ORV A;  1PCE A;  1Z7K B;  2V1C A;  2YQP A;  2NU1 I;  1CT0 I;  4B6D A;  1RFH A;  1X74 A;  2KMP A;  1NUB A;  1BMO A;  1DS2 I;  1DS3 I;  2SGP I;  2SGE I;  2W0T A;  3UGD A;  3VE5 A;  5DAE A;  1CE3 A;  3UGL A;  1KBE A;  4HGU A;  1OYV I;  1CT4 I;  2B8T A;  3D00 A;  2A20 A;  2E5R A;  2N71 A;  2DB6 A;  2QQE A;  1UUC A;  2QQ0 A;  1XX6 A;  3PDN A;  3SGB I;  2QQC A;  1PTQ A;  1IY5 A;  1SGP I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...