1TBNA

Nmr structure of a protein kinase c-g phorbol-binding domain, minimized average structure
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
66
structure length
66
Chain Sequence
b'QTDDPRNKHKFRLHSYSSPTFCDHCGSLLYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN KINASE C, GAMMA TYPE
publication title NMR structure of a protein kinase C-gamma phorbol-binding domain and study of protein-lipid micelle interactions.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Calcium-binding protein
total genus 6
structure length 66
sequence length 66
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 1997-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1tbnA00
2QQ0A 4UXJA 1PTQA 2FNFX 2JA1A 5FUXA 1W4RA 3KY9A 2ENNA 2ELIA 4B6DA 1PTRA 1XX6A 2E73A 2GVIA 2ORVA 2DB6A 2ENZA 2ROWA 5FUYA 3E2IA 1FAQA 1KBEA 2QQEA 4FKDA 2ORWA 3UGLA 2VRWB 3UFFA 2B8TA 1KBFA 1TBOA 3UEYA 3UGIA 1FARA 2WVJA 2YUUA 1Y8FA 1XBTA 5FUWA 4L9MA 1TBNA 4UXIA 3CXLA 5FUVA 4UXHA 2J87A 3BJIA 3UEJA 1R79A 1XA6A 3UGDA 2UZ3A 1RFHA 2J9RA 2QPOA
chains in the Genus database with same CATH superfamily
2QQ0A 3R5DA 1PTQA 4UXJA 1TGSI 1PCEA 1CT0I 1SGPI 1PTRA 1SGNI 2E73A 2CWGA 2GVIA 1X74A 1NUBA 2M5XA 3B4VC 3QWPA 1DS2I 1Y1CA 3VDUA 2RIJA 1Q9BA 4FKDA 4HGUA 3E59A 5HI7A 1HEVA 5E3RA 7WGAA 3FSXA 1Y1BA 5JHWC 1V1HA 2WVJA 2CWFA 4L9MA 2B0UC 3GOXA 4UXHA 1HJAI 1VDDA 2N71A 3VDPA 1YTPA 1UHAA 2BUSA 1TURA 3UGDA 3TO6A 2UZ3A 1RFHA 5FUXA 1Z2IA 2LUYA 2E5RA 2GIVA 2N1AB 1UVFA 3TJQA 1M8CA 4AMLA 1W4RA 3KY9A 1K7TA 1WGTA 2ELIA 2KMOA 1ULNA 4SGBI 2V1CC 2NU1I 2SGFI 1CGJI 1SGYI 4B6DA 1XX6A 2JW6A 4E1PA 3FC3A 2ORVA 2OVOA 1YU6C 1MT1A 3OXLA 3RU0A 2ROWA 9WGAA 5FUYA 1LR8A 1X4SA 2JYYA 2L8EA 1N13A 5J8CA 1U5KA 2ORWA 1P9GA 1KBFA 2B8TA 1PPFI 1FYBA 1TOTA 1TBOA 1CT4I 2X52A 3FSYA 2KCXA 1DS3I 2LB7A 2SGDI 3D00A 2W0TA 1HPTA 1ULMA 3CXLA 1HDLA 3R5AA 2GKRI 4JCVE 1ULKA 3PDNA 5DAEA 3BJIA 3UEJA 1PJUA 1IY6A 1LR7A 1TBQR 2OD1A 2DIPA 3TO7A 2OZUA 2J9RA 3TO9A 1SGEI 2OU2A 4DNCA 3OXFA 1BUSA 1SGRI 2A20A 2JA1A 1UUCA 2ENNA 2GKVA 1WTJA 1LR9A 1TUSA 3UOEA 1FY7A 3R5CA 5EX0A 2K9HA 2DB6A 3VE5A 1SGDI 1P9ZA 1WGCA 5CCMA 1MJAA 4E1RA 5CCLA 1FAQA 2F3CI 2ODDA 2QQEA 3MEKA 2NU2I 3QTLD 2KMQA 1K7VA 2VRWB 1NXUA 3HH2C 2N17A 2LEOA 2N52A 1S20A 2CJSC 2WGCA 2Y0MA 5HQ8A 2L7XA 3UGIA 2QQCA 2YUUA 3TOAA 4GI3C 1CSOI 2XRCA 1TBNA 4UXIA 1MJ9A 2ERWA 2ARPF 5E3QA 2P6AC 2CWHA 1OMTA 1R79A 1XA6A 3OL0A 2JXDA 4OVOA 1AN1I 1OVOA 2QPOA 2V53A 3OVOA 2FNFX 1H0ZA 1UVGA 1MJBA 1R0RI 2KMPA 2DKVA 2PQ8A 3SEKC 1CGII 1OMUA 2NU4I 4MPIA 5EX3A 1SGQI 2V1CA 1OYVI 1CE3A 2RC4A 2ENZA 1M8BA 1IW4A 3E2IA 2JZMA 2SGQI 3R5BA 2X3TA 1KBEA 3SGBI 5E3PA 2NU3I 2SGPI 3UGLA 1IY5A 4WP4A 1TIHA 1CT2I 3TOBA 2YQPA 3UFFA 1KMAA 2SGEI 2UVOA 3UEYA 3OXGA 1BMOA 2KMRA 1FARA 5FUWA 1Y8FA 1XBTA 2QQDA 1K7UA 2WCYA 5FUVA 1CHOI 2J87A 5J8FA 3SGQI 3QAHA 1V1IA 1WKXA 2NU0I 4A24A 1TBRR 1Z7KB 2GKTI 1W3SA
chains in the Genus database with same CATH topology
2QQ0A 4UXJA 1PTQA 1TGSI 1PCEA 1CT0I 1SGPI 1PTRA 1SGNI 2E73A 2GVIA 1X74A 1NUBA 2M5XA 3B4VC 3QWPA 1DS2I 1Y1CA 3VDUA 4FKDA 4HGUA 3E59A 5HI7A 1Y1BA 1V1HA 2WVJA 4L9MA 2B0UC 3GOXA 4UXHA 1HJAI 1VDDA 2N71A 3VDPA 1YTPA 3UGDA 2BUSA 1TURA 2UZ3A 1RFHA 5FUXA 2LUYA 2E5RA 2N1AB 1UVFA 3TJQA 1M8CA 1W4RA 3KY9A 2KMOA 2ELIA 4SGBI 2V1CC 2NU1I 2SGFI 1CGJI 1SGYI 4B6DA 1XX6A 2JW6A 4E1PA 3FC3A 2ORVA 2OVOA 1YU6C 1MT1A 3OXLA 3RU0A 2ROWA 5FUYA 1LR8A 1X4SA 2JYYA 2L8EA 1N13A 1U5KA 2ORWA 1KBFA 2B8TA 1PPFI 1FYBA 1TOTA 1TBOA 1CT4I 2KCXA 1DS3I 2SGDI 3D00A 2W0TA 1HPTA 3CXLA 1HDLA 2GKRI 4JCVE 3PDNA 5DAEA 3BJIA 3UEJA 1PJUA 1IY6A 1LR7A 1TBQR 2OD1A 2DIPA 2J9RA 1SGEI 3OXFA 1BUSA 1SGRI 2A20A 2JA1A 1UUCA 2ENNA 2GKVA 1LR9A 1TUSA 5EX0A 2K9HA 2DB6A 3VE5A 1SGDI 5CCMA 4E1RA 5CCLA 1FAQA 2F3CI 2ODDA 2QQEA 3MEKA 2NU2I 3QTLD 2KMQA 2VRWB 3HH2C 2N17A 2LEOA 2N52A 2CJSC 5HQ8A 2L7XA 3UGIA 2QQCA 2YUUA 4GI3C 1CSOI 2XRCA 1TBNA 4UXIA 2ERWA 2ARPF 2P6AC 1OMTA 1R79A 1XA6A 3OL0A 2JXDA 4OVOA 1AN1I 1OVOA 2QPOA 2V53A 3OVOA 2FNFX 1H0ZA 1UVGA 5JHWC 1R0RI 2KMPA 3SEKC 1CGII 1OMUA 2NU4I 5EX3A 1SGQI 2V1CA 1OYVI 1CE3A 2ENZA 1M8BA 1IW4A 3E2IA 2JZMA 2SGQI 3SGBI 1KBEA 2NU3I 2SGPI 3UGLA 1IY5A 1TIHA 1CT2I 3UFFA 2YQPA 1KMAA 2SGEI 3UEYA 3OXGA 1BMOA 2KMRA 1FARA 5FUWA 1Y8FA 1XBTA 2QQDA 2WCYA 5FUVA 1CHOI 2J87A 3SGQI 1V1IA 2NU0I 4A24A 1TBRR 1Z7KB 2GKTI 1W3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQ0 A;  4UXJ A;  1PTQ A;  2FNF X;  2JA1 A;  5FUX A;  1W4R A;  3KY9 A;  2ENN A;  2ELI A;  4B6D A;  1PTR A;  1XX6 A;  2E73 A;  2GVI A;  2ORV A;  2DB6 A;  2ENZ A;  2ROW A;  5FUY A;  3E2I A;  1FAQ A;  1KBE A;  2QQE A;  4FKD A;  2ORW A;  3UGL A;  2VRW B;  3UFF A;  2B8T A;  1KBF A;  1TBO A;  3UEY A;  3UGI A;  1FAR A;  2WVJ A;  2YUU A;  1Y8F A;  1XBT A;  5FUW A;  4L9M A;  1TBN A;  4UXI A;  3CXL A;  5FUV A;  4UXH A;  2J87 A;  3BJI A;  3UEJ A;  1R79 A;  1XA6 A;  3UGD A;  2UZ3 A;  1RFH A;  2J9R A;  2QPO A; 
#chains in the Genus database with same CATH topology
 2QQ0 A;  3R5D A;  1PTQ A;  4UXJ A;  1TGS I;  1PCE A;  1CT0 I;  1SGP I;  1PTR A;  1SGN I;  2E73 A;  2CWG A;  2GVI A;  1X74 A;  1NUB A;  2M5X A;  3B4V C;  3QWP A;  1DS2 I;  1Y1C A;  3VDU A;  2RIJ A;  1Q9B A;  4FKD A;  4HGU A;  3E59 A;  5HI7 A;  1HEV A;  5E3R A;  7WGA A;  3FSX A;  1Y1B A;  5JHW C;  1V1H A;  2WVJ A;  2CWF A;  4L9M A;  2B0U C;  3GOX A;  4UXH A;  1HJA I;  1VDD A;  2N71 A;  3VDP A;  1YTP A;  1UHA A;  2BUS A;  1TUR A;  3UGD A;  3TO6 A;  2UZ3 A;  1RFH A;  5FUX A;  1Z2I A;  2LUY A;  2E5R A;  2GIV A;  2N1A B;  1UVF A;  3TJQ A;  1M8C A;  4AML A;  1W4R A;  3KY9 A;  1K7T A;  1WGT A;  2ELI A;  2KMO A;  1ULN A;  4SGB I;  2V1C C;  2NU1 I;  2SGF I;  1CGJ I;  1SGY I;  4B6D A;  1XX6 A;  2JW6 A;  4E1P A;  3FC3 A;  2ORV A;  2OVO A;  1YU6 C;  1MT1 A;  3OXL A;  3RU0 A;  2ROW A;  9WGA A;  5FUY A;  1LR8 A;  1X4S A;  2JYY A;  2L8E A;  1N13 A;  5J8C A;  1U5K A;  2ORW A;  1P9G A;  1KBF A;  2B8T A;  1PPF I;  1FYB A;  1TOT A;  1TBO A;  1CT4 I;  2X52 A;  3FSY A;  2KCX A;  1DS3 I;  2LB7 A;  2SGD I;  3D00 A;  2W0T A;  1HPT A;  1ULM A;  3CXL A;  1HDL A;  3R5A A;  2GKR I;  4JCV E;  1ULK A;  3PDN A;  5DAE A;  3BJI A;  3UEJ A;  1PJU A;  1IY6 A;  1LR7 A;  1TBQ R;  2OD1 A;  2DIP A;  3TO7 A;  2OZU A;  2J9R A;  3TO9 A;  1SGE I;  2OU2 A;  4DNC A;  3OXF A;  1BUS A;  1SGR I;  2A20 A;  2JA1 A;  1UUC A;  2ENN A;  2GKV A;  1WTJ A;  1LR9 A;  1TUS A;  3UOE A;  1FY7 A;  3R5C A;  5EX0 A;  2K9H A;  2DB6 A;  3VE5 A;  1SGD I;  1P9Z A;  1WGC A;  5CCM A;  1MJA A;  4E1R A;  5CCL A;  1FAQ A;  2F3C I;  2ODD A;  2QQE A;  3MEK A;  2NU2 I;  3QTL D;  2KMQ A;  1K7V A;  2VRW B;  1NXU A;  3HH2 C;  2N17 A;  2LEO A;  2N52 A;  1S20 A;  2CJS C;  2WGC A;  2Y0M A;  5HQ8 A;  2L7X A;  3UGI A;  2QQC A;  2YUU A;  3TOA A;  4GI3 C;  1CSO I;  2XRC A;  1TBN A;  4UXI A;  1MJ9 A;  2ERW A;  2ARP F;  5E3Q A;  2P6A C;  2CWH A;  1OMT A;  1R79 A;  1XA6 A;  3OL0 A;  2JXD A;  4OVO A;  1AN1 I;  1OVO A;  2QPO A;  2V53 A;  3OVO A;  2FNF X;  1H0Z A;  1UVG A;  1MJB A;  1R0R I;  2KMP A;  2DKV A;  2PQ8 A;  3SEK C;  1CGI I;  1OMU A;  2NU4 I;  4MPI A;  5EX3 A;  1SGQ I;  2V1C A;  1OYV I;  1CE3 A;  2RC4 A;  2ENZ A;  1M8B A;  1IW4 A;  3E2I A;  2JZM A;  2SGQ I;  3R5B A;  2X3T A;  1KBE A;  3SGB I;  5E3P A;  2NU3 I;  2SGP I;  3UGL A;  1IY5 A;  4WP4 A;  1TIH A;  1CT2 I;  3TOB A;  2YQP A;  3UFF A;  1KMA A;  2SGE I;  2UVO A;  3UEY A;  3OXG A;  1BMO A;  2KMR A;  1FAR A;  5FUW A;  1Y8F A;  1XBT A;  2QQD A;  1K7U A;  2WCY A;  5FUV A;  1CHO I;  2J87 A;  5J8F A;  3SGQ I;  3QAH A;  1V1I A;  1WKX A;  2NU0 I;  4A24 A;  1TBR R;  1Z7K B;  2GKT I;  1W3S A; 
#chains in the Genus database with same CATH homology
 2QQ0 A;  4UXJ A;  1PTQ A;  1TGS I;  1PCE A;  1CT0 I;  1SGP I;  1PTR A;  1SGN I;  2E73 A;  2GVI A;  1X74 A;  1NUB A;  2M5X A;  3B4V C;  3QWP A;  1DS2 I;  1Y1C A;  3VDU A;  4FKD A;  4HGU A;  3E59 A;  5HI7 A;  1Y1B A;  1V1H A;  2WVJ A;  4L9M A;  2B0U C;  3GOX A;  4UXH A;  1HJA I;  1VDD A;  2N71 A;  3VDP A;  1YTP A;  3UGD A;  2BUS A;  1TUR A;  2UZ3 A;  1RFH A;  5FUX A;  2LUY A;  2E5R A;  2N1A B;  1UVF A;  3TJQ A;  1M8C A;  1W4R A;  3KY9 A;  2KMO A;  2ELI A;  4SGB I;  2V1C C;  2NU1 I;  2SGF I;  1CGJ I;  1SGY I;  4B6D A;  1XX6 A;  2JW6 A;  4E1P A;  3FC3 A;  2ORV A;  2OVO A;  1YU6 C;  1MT1 A;  3OXL A;  3RU0 A;  2ROW A;  5FUY A;  1LR8 A;  1X4S A;  2JYY A;  2L8E A;  1N13 A;  1U5K A;  2ORW A;  1KBF A;  2B8T A;  1PPF I;  1FYB A;  1TOT A;  1TBO A;  1CT4 I;  2KCX A;  1DS3 I;  2SGD I;  3D00 A;  2W0T A;  1HPT A;  3CXL A;  1HDL A;  2GKR I;  4JCV E;  3PDN A;  5DAE A;  3BJI A;  3UEJ A;  1PJU A;  1IY6 A;  1LR7 A;  1TBQ R;  2OD1 A;  2DIP A;  2J9R A;  1SGE I;  3OXF A;  1BUS A;  1SGR I;  2A20 A;  2JA1 A;  1UUC A;  2ENN A;  2GKV A;  1LR9 A;  1TUS A;  5EX0 A;  2K9H A;  2DB6 A;  3VE5 A;  1SGD I;  5CCM A;  4E1R A;  5CCL A;  1FAQ A;  2F3C I;  2ODD A;  2QQE A;  3MEK A;  2NU2 I;  3QTL D;  2KMQ A;  2VRW B;  3HH2 C;  2N17 A;  2LEO A;  2N52 A;  2CJS C;  5HQ8 A;  2L7X A;  3UGI A;  2QQC A;  2YUU A;  4GI3 C;  1CSO I;  2XRC A;  1TBN A;  4UXI A;  2ERW A;  2ARP F;  2P6A C;  1OMT A;  1R79 A;  1XA6 A;  3OL0 A;  2JXD A;  4OVO A;  1AN1 I;  1OVO A;  2QPO A;  2V53 A;  3OVO A;  2FNF X;  1H0Z A;  1UVG A;  5JHW C;  1R0R I;  2KMP A;  3SEK C;  1CGI I;  1OMU A;  2NU4 I;  5EX3 A;  1SGQ I;  2V1C A;  1OYV I;  1CE3 A;  2ENZ A;  1M8B A;  1IW4 A;  3E2I A;  2JZM A;  2SGQ I;  3SGB I;  1KBE A;  2NU3 I;  2SGP I;  3UGL A;  1IY5 A;  1TIH A;  1CT2 I;  3UFF A;  2YQP A;  1KMA A;  2SGE I;  3UEY A;  3OXG A;  1BMO A;  2KMR A;  1FAR A;  5FUW A;  1Y8F A;  1XBT A;  2QQD A;  2WCY A;  5FUV A;  1CHO I;  2J87 A;  3SGQ I;  1V1I A;  2NU0 I;  4A24 A;  1TBR R;  1Z7K B;  2GKT I;  1W3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...