3B4VC

X-ray structure of activin in complex with fstl3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
210
structure length
206
Chain Sequence
GGVCWLQQGQEATCSLVLQTDVTRAECCASGNIDTAWSNLTHPGNKINLLGFLGLVHCLPCKDSCDGVECGPGKACRMPRCECAPDCSGLPARLQVCGSDGATYRDECELRAARCRGHPDLSVMYRGRCRKSCEHVVCPRPQSCVVDQTGSAHCVVCRAAPCPVPSSPGQELCGNNNVTYISSCHMRQATCFLGRSIGVRHAGSCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inhibin beta A chain
publication title The structure of FSTL3.activin A complex. Differential binding of N-terminal domains influences follistatin-type antagonist specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone regulator complex
total genus 37
structure length 206
sequence length 210
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2007-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
C PF09289 FOLN Follistatin/Osteonectin-like EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3b4vC02
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3b4vC03
3.90.290.10 Alpha Beta Alpha-Beta Complex Extracellular Matrix Fibrillin TGF-beta binding (TB) domain 3b4vC01
3TJQA 1HJAI 1SGQI 2W86A 1TBQR 1SGRI 1CGII 2KMRA 1UZQA 1UZKA 1DS2I 2GKVA 2WCYA 2JXDA 2NU4I 2GKTI 1OYVI 1BMOA 1SGYI 2LEOA 1UVFA 4HGUA 1IY6A 1PCEA 1PJUA 2ERWA 4OVOA 2BUSA 2QQCA 1CE3A 1TGSI 2SGDI 2SGEI 1PPFI 1BUSA 2ARPF 1UZJA 1TIHA 2N71A 1UVGA 1CT0I 1OVOA 1N13A 1AN1I 1YTPA 1CT2I 2B0UC 1KMAA 1APJA 1LR7A 1Y1CA 3SGQI 1OMUA 1SGPI 1TBRR 1DS3I 1SGEI 1CGJI 3QTLD 2GKRI 1IW4A 2N52A 4GI3C 1CHOI 1FYBA 2NU0I 2NU1I 1OMTA 3SEKC 2SGQI 1SGDI 5DAEA 2KCXA 2SGFI 2JZMA 1Y1BA 1CSOI 1M8CA 4SGBI 1MT1A 3SGBI 2KMPA 2V53A 1UZPA 2OVOA 1LR8A 2SGPI 1NUBA 3B4VC 1YU6C 1TUSA 5JHWC 2P6AC 2M5XA 1LR9A 1HDLA 2F3CI 1H0ZA 1IY5A 1TURA 1M8BA 2JYYA 2KMOA 3OVOA 1Z7KB 1R0RI 1CT4I 2NU3I 2N17A 2KMQA 2XRCA 2NU2I 1UUCA 1KSQA 1SGNI 2QQDA 3HH2C 1HPTA
chains in the Genus database with same CATH superfamily
3TJQA 1XA6A 3OL0A 1HJAI 1XX6A 2N1AB 3UEJA 1SGQI 2W86A 3FSYA 1TBQR 1SGRI 1CGII 3UGDA 1PTRA 2KMRA 1UZQA 2DKVA 1UZKA 1DS2I 2GKVA 2WCYA 2JXDA 2V1CC 4UXIA 1NXUA 2NU4I 5E3RA 3UFFA 3UOEA 2QQEA 3GOXA 1Q9BA 1WTJA 2GKTI 4UXHA 2Y0MA 3R5AA 1OYVI 2W0TA 5HQ8A 1BMOA 1SGYI 2LEOA 7WGAA 1UVFA 2CWFA 4HGUA 3TO7A 1IY6A 1PCEA 1PJUA 1K7TA 2ERWA 2OU2A 2BUSA 2QQCA 4OVOA 3VDUA 1CE3A 1TGSI 2SGDI 2SGEI 1ULKA 5FUVA 1PPFI 3PDNA 3OXLA 1BUSA 2RIJA 2ARPF 1W3SA 1UZJA 5FUWA 2ORVA 5J8CA 5CCMA 1TIHA 1ULMA 2CJSC 2N71A 1UVGA 3E2IA 3R5CA 1CT0I 1V1IA 5CCLA 1OVOA 2ODDA 1N13A 1AN1I 1YTPA 1CT2I 3QAHA 1V1HA 1PTQA 2B0UC 1P9ZA 2JA1A 5E3PA 1KMAA 1APJA 1LR7A 1Y1CA 3FSXA 3OXFA 2ELIA 3SGQI 2UZ3A 3TOAA 1OMUA 1SGPI 1TBRR 1FARA 1DS3I 1R79A 1SGEI 1X4SA 2X3TA 1CGJI 1W4RA 3QTLD 1WKXA 2GKRI 1UHAA 2N52A 2V1CA 3RU0A 1IW4A 4GI3C 3TOBA 1CHOI 1TBNA 1KBEA 1Z2IA 2NU0I 1FYBA 2UVOA 2NU1I 2GVIA 3CXLA 2GIVA 1U5KA 1OMTA 2L8EA 2WVJA 3SEKC 3VE5A 3OXGA 2ENZA 4FKDA 2SGQI 3KY9A 1SGDI 3TO9A 1FY7A 2J9RA 5DAEA 1KBFA 3TO6A 4B6DA 2KCXA 2SGFI 2WGCA 2JZMA 3VDPA 1Y1BA 5J8FA 2B8TA 5FUXA 2X52A 2QQ0A 1CSOI 2K9HA 2OZUA 1M8CA 4UXJA 5EX0A 4MPIA 2A20A 2FNFX 1MT1A 2PQ8A 2CWGA 4SGBI 2KMPA 2V53A 2YQPA 3SGBI 4A24A 1UZPA 2OVOA 1LR8A 2SGPI 1NUBA 2E5RA 2ROWA 3B4VC 1YU6C 2JW6A 3UGIA 2L7XA 1P9GA 1K7VA 3UGLA 1TUSA 5JHWC 1X74A 1MJBA 1MJ9A 1XBTA 2ENNA 2DB6A 2P6AC 4AMLA 2M5XA 4JCVE 1LR9A 1MJAA 2E73A 4E1RA 1HDLA 1WGCA 2F3CI 1K7UA 3D00A 4WP4A 5E3QA 4E1PA 9WGAA 2J87A 2DIPA 2RC4A 3R5BA 1IY5A 1TURA 1M8BA 1H0ZA 2JYYA 2KMOA 2VRWB 5FUYA 1HEVA 3UEYA 5EX3A 1HPTA 2ORWA 3OVOA 1Y8FA 3R5DA 1Z7KB 1R0RI 1CT4I 2QPOA 2LUYA 2NU3I 1TBOA 1TOTA 2N17A 2KMQA 3BJIA 4L9MA 1FAQA 2XRCA 2NU2I 4DNCA 3MEKA 1UUCA 1VDDA 3QWPA 1KSQA 2CWHA 1SGNI 1RFHA 2YUUA 2OD1A 5HI7A 3E59A 3FC3A 2QQDA 1S20A 3HH2C 1WGTA 2LB7A 1ULNA
chains in the Genus database with same CATH topology
3TJQA 1XA6A 3OL0A 1HJAI 1XX6A 2N1AB 3UEJA 1SGQI 2W86A 1TBQR 1SGRI 1CGII 3UGDA 1PTRA 2KMRA 1UZQA 1UZKA 1DS2I 2GKVA 2WCYA 2JXDA 2V1CC 4UXIA 2NU4I 3GOXA 3UFFA 2QQEA 2GKTI 4UXHA 1OYVI 2W0TA 5HQ8A 1BMOA 1SGYI 2LEOA 1UVFA 4HGUA 1IY6A 1PCEA 1PJUA 3VDUA 2ERWA 4OVOA 2BUSA 2QQCA 1CE3A 1TGSI 2SGDI 2SGEI 1PPFI 3PDNA 3OXLA 1BUSA 2ARPF 1W3SA 1UZJA 5FUWA 2ORVA 1TIHA 2CJSC 2N71A 1UVGA 3E2IA 1CT0I 1V1IA 5CCLA 1OVOA 2ODDA 1N13A 1AN1I 1YTPA 1CT2I 1V1HA 1PTQA 2B0UC 1KMAA 2JA1A 1APJA 1LR7A 1Y1CA 3OXFA 2ELIA 3SGQI 2UZ3A 1OMUA 1SGPI 1TBRR 1FARA 1DS3I 1R79A 1SGEI 1X4SA 1CGJI 1W4RA 3QTLD 2GKRI 3RU0A 2V1CA 2N52A 1IW4A 4GI3C 1CHOI 1TBNA 1KBEA 1FYBA 2NU0I 2NU1I 2GVIA 3CXLA 2L8EA 1U5KA 1OMTA 2WVJA 3SEKC 3VE5A 5CCMA 3OXGA 2ENZA 4FKDA 2SGQI 3KY9A 1SGDI 1KBFA 2J9RA 5DAEA 4B6DA 2KCXA 2SGFI 2JZMA 3VDPA 1Y1BA 2B8TA 5FUXA 2QQ0A 1CSOI 2K9HA 4UXJA 1M8CA 5EX0A 2A20A 2FNFX 1MT1A 4SGBI 3SGBI 4A24A 2KMPA 2V53A 2YQPA 1UZPA 2OVOA 1LR8A 2SGPI 1NUBA 2E5RA 2ROWA 3B4VC 1YU6C 2JW6A 3UGIA 2L7XA 3UGLA 1TUSA 5JHWC 1X74A 1XBTA 2ENNA 2P6AC 2DB6A 2M5XA 4JCVE 1LR9A 4E1RA 2E73A 1HDLA 2F3CI 3D00A 4E1PA 2J87A 2DIPA 1H0ZA 1IY5A 1TURA 1M8BA 2JYYA 2KMOA 2VRWB 5FUYA 3UEYA 5EX3A 2ORWA 3OVOA 1Y8FA 1Z7KB 1R0RI 1CT4I 2QPOA 2LUYA 2NU3I 1TBOA 1TOTA 2N17A 2KMQA 3BJIA 4L9MA 1FAQA 2XRCA 2NU2I 3MEKA 1UUCA 1VDDA 3QWPA 1KSQA 1SGNI 1RFHA 2YUUA 2OD1A 5HI7A 3E59A 3FC3A 2QQDA 3HH2C 5FUVA 1HPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TJQ A;  1HJA I;  1SGQ I;  2W86 A;  1TBQ R;  1SGR I;  1CGI I;  2KMR A;  1UZQ A;  1UZK A;  1DS2 I;  2GKV A;  2WCY A;  2JXD A;  2NU4 I;  2GKT I;  1OYV I;  1BMO A;  1SGY I;  2LEO A;  1UVF A;  4HGU A;  1IY6 A;  1PCE A;  1PJU A;  2ERW A;  4OVO A;  2BUS A;  2QQC A;  1CE3 A;  1TGS I;  2SGD I;  2SGE I;  1PPF I;  1BUS A;  2ARP F;  1UZJ A;  1TIH A;  2N71 A;  1UVG A;  1CT0 I;  1OVO A;  1N13 A;  1AN1 I;  1YTP A;  1CT2 I;  2B0U C;  1KMA A;  1APJ A;  1LR7 A;  1Y1C A;  3SGQ I;  1OMU A;  1SGP I;  1TBR R;  1DS3 I;  1SGE I;  1CGJ I;  3QTL D;  2GKR I;  1IW4 A;  2N52 A;  4GI3 C;  1CHO I;  1FYB A;  2NU0 I;  2NU1 I;  1OMT A;  3SEK C;  2SGQ I;  1SGD I;  5DAE A;  2KCX A;  2SGF I;  2JZM A;  1Y1B A;  1CSO I;  1M8C A;  4SGB I;  1MT1 A;  3SGB I;  2KMP A;  2V53 A;  1UZP A;  2OVO A;  1LR8 A;  2SGP I;  1NUB A;  3B4V C;  1YU6 C;  1TUS A;  5JHW C;  2P6A C;  2M5X A;  1LR9 A;  1HDL A;  2F3C I;  1H0Z A;  1IY5 A;  1TUR A;  1M8B A;  2JYY A;  2KMO A;  3OVO A;  1Z7K B;  1R0R I;  1CT4 I;  2NU3 I;  2N17 A;  2KMQ A;  2XRC A;  2NU2 I;  1UUC A;  1KSQ A;  1SGN I;  2QQD A;  3HH2 C;  1HPT A; 
#chains in the Genus database with same CATH topology
 3TJQ A;  1XA6 A;  3OL0 A;  1HJA I;  1XX6 A;  2N1A B;  3UEJ A;  1SGQ I;  2W86 A;  3FSY A;  1TBQ R;  1SGR I;  1CGI I;  3UGD A;  1PTR A;  2KMR A;  1UZQ A;  2DKV A;  1UZK A;  1DS2 I;  2GKV A;  2WCY A;  2JXD A;  2V1C C;  4UXI A;  1NXU A;  2NU4 I;  5E3R A;  3UFF A;  3UOE A;  2QQE A;  3GOX A;  1Q9B A;  1WTJ A;  2GKT I;  4UXH A;  2Y0M A;  3R5A A;  1OYV I;  2W0T A;  5HQ8 A;  1BMO A;  1SGY I;  2LEO A;  7WGA A;  1UVF A;  2CWF A;  4HGU A;  3TO7 A;  1IY6 A;  1PCE A;  1PJU A;  1K7T A;  2ERW A;  2OU2 A;  2BUS A;  2QQC A;  4OVO A;  3VDU A;  1CE3 A;  1TGS I;  2SGD I;  2SGE I;  1ULK A;  5FUV A;  1PPF I;  3PDN A;  3OXL A;  1BUS A;  2RIJ A;  2ARP F;  1W3S A;  1UZJ A;  5FUW A;  2ORV A;  5J8C A;  5CCM A;  1TIH A;  1ULM A;  2CJS C;  2N71 A;  1UVG A;  3E2I A;  3R5C A;  1CT0 I;  1V1I A;  5CCL A;  1OVO A;  2ODD A;  1N13 A;  1AN1 I;  1YTP A;  1CT2 I;  3QAH A;  1V1H A;  1PTQ A;  2B0U C;  1P9Z A;  2JA1 A;  5E3P A;  1KMA A;  1APJ A;  1LR7 A;  1Y1C A;  3FSX A;  3OXF A;  2ELI A;  3SGQ I;  2UZ3 A;  3TOA A;  1OMU A;  1SGP I;  1TBR R;  1FAR A;  1DS3 I;  1R79 A;  1SGE I;  1X4S A;  2X3T A;  1CGJ I;  1W4R A;  3QTL D;  1WKX A;  2GKR I;  1UHA A;  2N52 A;  2V1C A;  3RU0 A;  1IW4 A;  4GI3 C;  3TOB A;  1CHO I;  1TBN A;  1KBE A;  1Z2I A;  2NU0 I;  1FYB A;  2UVO A;  2NU1 I;  2GVI A;  3CXL A;  2GIV A;  1U5K A;  1OMT A;  2L8E A;  2WVJ A;  3SEK C;  3VE5 A;  3OXG A;  2ENZ A;  4FKD A;  2SGQ I;  3KY9 A;  1SGD I;  3TO9 A;  1FY7 A;  2J9R A;  5DAE A;  1KBF A;  3TO6 A;  4B6D A;  2KCX A;  2SGF I;  2WGC A;  2JZM A;  3VDP A;  1Y1B A;  5J8F A;  2B8T A;  5FUX A;  2X52 A;  2QQ0 A;  1CSO I;  2K9H A;  2OZU A;  1M8C A;  4UXJ A;  5EX0 A;  4MPI A;  2A20 A;  2FNF X;  1MT1 A;  2PQ8 A;  2CWG A;  4SGB I;  2KMP A;  2V53 A;  2YQP A;  3SGB I;  4A24 A;  1UZP A;  2OVO A;  1LR8 A;  2SGP I;  1NUB A;  2E5R A;  2ROW A;  3B4V C;  1YU6 C;  2JW6 A;  3UGI A;  2L7X A;  1P9G A;  1K7V A;  3UGL A;  1TUS A;  5JHW C;  1X74 A;  1MJB A;  1MJ9 A;  1XBT A;  2ENN A;  2DB6 A;  2P6A C;  4AML A;  2M5X A;  4JCV E;  1LR9 A;  1MJA A;  2E73 A;  4E1R A;  1HDL A;  1WGC A;  2F3C I;  1K7U A;  3D00 A;  4WP4 A;  5E3Q A;  4E1P A;  9WGA A;  2J87 A;  2DIP A;  2RC4 A;  3R5B A;  1IY5 A;  1TUR A;  1M8B A;  1H0Z A;  2JYY A;  2KMO A;  2VRW B;  5FUY A;  1HEV A;  3UEY A;  5EX3 A;  1HPT A;  2ORW A;  3OVO A;  1Y8F A;  3R5D A;  1Z7K B;  1R0R I;  1CT4 I;  2QPO A;  2LUY A;  2NU3 I;  1TBO A;  1TOT A;  2N17 A;  2KMQ A;  3BJI A;  4L9M A;  1FAQ A;  2XRC A;  2NU2 I;  4DNC A;  3MEK A;  1UUC A;  1VDD A;  3QWP A;  1KSQ A;  2CWH A;  1SGN I;  1RFH A;  2YUU A;  2OD1 A;  5HI7 A;  3E59 A;  3FC3 A;  2QQD A;  1S20 A;  3HH2 C;  1WGT A;  2LB7 A;  1ULN A; 
#chains in the Genus database with same CATH homology
 3TJQ A;  1XA6 A;  3OL0 A;  1HJA I;  1XX6 A;  2N1A B;  3UEJ A;  1SGQ I;  2W86 A;  1TBQ R;  1SGR I;  1CGI I;  3UGD A;  1PTR A;  2KMR A;  1UZQ A;  1UZK A;  1DS2 I;  2GKV A;  2WCY A;  2JXD A;  2V1C C;  4UXI A;  2NU4 I;  3GOX A;  3UFF A;  2QQE A;  2GKT I;  4UXH A;  1OYV I;  2W0T A;  5HQ8 A;  1BMO A;  1SGY I;  2LEO A;  1UVF A;  4HGU A;  1IY6 A;  1PCE A;  1PJU A;  3VDU A;  2ERW A;  4OVO A;  2BUS A;  2QQC A;  1CE3 A;  1TGS I;  2SGD I;  2SGE I;  1PPF I;  3PDN A;  3OXL A;  1BUS A;  2ARP F;  1W3S A;  1UZJ A;  5FUW A;  2ORV A;  1TIH A;  2CJS C;  2N71 A;  1UVG A;  3E2I A;  1CT0 I;  1V1I A;  5CCL A;  1OVO A;  2ODD A;  1N13 A;  1AN1 I;  1YTP A;  1CT2 I;  1V1H A;  1PTQ A;  2B0U C;  1KMA A;  2JA1 A;  1APJ A;  1LR7 A;  1Y1C A;  3OXF A;  2ELI A;  3SGQ I;  2UZ3 A;  1OMU A;  1SGP I;  1TBR R;  1FAR A;  1DS3 I;  1R79 A;  1SGE I;  1X4S A;  1CGJ I;  1W4R A;  3QTL D;  2GKR I;  3RU0 A;  2V1C A;  2N52 A;  1IW4 A;  4GI3 C;  1CHO I;  1TBN A;  1KBE A;  1FYB A;  2NU0 I;  2NU1 I;  2GVI A;  3CXL A;  2L8E A;  1U5K A;  1OMT A;  2WVJ A;  3SEK C;  3VE5 A;  5CCM A;  3OXG A;  2ENZ A;  4FKD A;  2SGQ I;  3KY9 A;  1SGD I;  1KBF A;  2J9R A;  5DAE A;  4B6D A;  2KCX A;  2SGF I;  2JZM A;  3VDP A;  1Y1B A;  2B8T A;  5FUX A;  2QQ0 A;  1CSO I;  2K9H A;  4UXJ A;  1M8C A;  5EX0 A;  2A20 A;  2FNF X;  1MT1 A;  4SGB I;  3SGB I;  4A24 A;  2KMP A;  2V53 A;  2YQP A;  1UZP A;  2OVO A;  1LR8 A;  2SGP I;  1NUB A;  2E5R A;  2ROW A;  3B4V C;  1YU6 C;  2JW6 A;  3UGI A;  2L7X A;  3UGL A;  1TUS A;  5JHW C;  1X74 A;  1XBT A;  2ENN A;  2P6A C;  2DB6 A;  2M5X A;  4JCV E;  1LR9 A;  4E1R A;  2E73 A;  1HDL A;  2F3C I;  3D00 A;  4E1P A;  2J87 A;  2DIP A;  1H0Z A;  1IY5 A;  1TUR A;  1M8B A;  2JYY A;  2KMO A;  2VRW B;  5FUY A;  3UEY A;  5EX3 A;  2ORW A;  3OVO A;  1Y8F A;  1Z7K B;  1R0R I;  1CT4 I;  2QPO A;  2LUY A;  2NU3 I;  1TBO A;  1TOT A;  2N17 A;  2KMQ A;  3BJI A;  4L9M A;  1FAQ A;  2XRC A;  2NU2 I;  3MEK A;  1UUC A;  1VDD A;  3QWP A;  1KSQ A;  1SGN I;  1RFH A;  2YUU A;  2OD1 A;  5HI7 A;  3E59 A;  3FC3 A;  2QQD A;  3HH2 C;  5FUV A;  1HPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...