3B4VC

X-ray structure of activin in complex with fstl3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
210
structure length
206
Chain Sequence
b'GGVCWLQQGQEATCSLVLQTDVTRAECCASGNIDTAWSNLTHPGNKINLLGFLGLVHCLPCKDSCDGVECGPGKACRMPRCECAPDCSGLPARLQVCGSDGATYRDECELRAARCRGHPDLSVMYRGRCRKSCEHVVCPRPQSCVVDQTGSAHCVVCRAAPCPVPSSPGQELCGNNNVTYISSCHMRQATCFLGRSIGVRHAGSCA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inhibin beta A chain
publication title The structure of FSTL3.activin A complex. Differential binding of N-terminal domains influences follistatin-type antagonist specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone regulator complex
total genus 37
structure length 206
sequence length 210
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2007-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
C PF09289 FOLN Follistatin/Osteonectin-like EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3b4vC02
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3b4vC03
3.90.290.10 Alpha Beta Alpha-Beta Complex Extracellular Matrix Fibrillin TGF-beta binding (TB) domain 3b4vC01
1OMTA 1BUSA 2WCYA 1R0RI 2NU0I 2JYYA 4GI3C 1NUBA 2KMPA 2XRCA 1OMUA 2SGQI 3TJQA 1UZPA 2NU4I 1UZQA 1TGSI 2N71A 1TURA 2OVOA 1N13A 1SGPI 1UZJA 2GKTI 2KMQA 5JHWC 1YU6C 1OYVI 2N52A 3B4VC 1SGNI 3SGQI 1PPFI 1Y1BA 1H0ZA 2NU2I 2ARPF 3HH2C 2BUSA 1PJUA 1TBRR 1DS2I 2KMRA 1IW4A 1KSQA 2M5XA 1MT1A 2JZMA 1SGQI 2SGFI 1OVOA 2P6AC 1CGJI 2N17A 1TIHA 1LR9A 1SGDI 1HPTA 1PCEA 2W86A 2ERWA 1TUSA 2NU1I 1CT4I 3SEKC 2NU3I 2SGEI 1SGEI 2B0UC 2F3CI 1CE3A 1UUCA 1M8BA 1SGRI 1DS3I 1KMAA 1CHOI 2V53A 1IY5A 2KMOA 1Z7KB 5DAEA 1FYBA 3QTLD 1UZKA 2LEOA 2SGPI 3SGBI 2SGDI 1CGII 1HDLA 1Y1CA 4SGBI 1CT2I 2GKVA 1HJAI 2GKRI 1CSOI 1IY6A 1CT0I 1UVFA 1YTPA 1BMOA 1TBQR 1SGYI 1APJA 3OVOA 2JXDA 4OVOA 1LR7A 1M8CA 1AN1I 2QQCA 1LR8A 1UVGA 2KCXA 2QQDA 4HGUA
chains in the Genus database with same CATH superfamily
1XBTA 1WKXA 1ULKA 2CJSC 1S20A 2W0TA 3UGDA 2UVOA 1MJ9A 1KBFA 2JA1A 1OMTA 5FUVA 2L7XA 2WCYA 1R0RI 1TOTA 4B6DA 1BUSA 2NU0I 3FSYA 4L9MA 3RU0A 3OL0A 2JYYA 1VDDA 1ULMA 2WGCA 4GI3C 2ODDA 1NUBA 2KMPA 2XRCA 3TOBA 1OMUA 5EX3A 3VDPA 2K9HA 2SGQI 1XX6A 2CWGA 3TJQA 1WTJA 2NU4I 1UZPA 1UZQA 1TGSI 4AMLA 2J87A 2N71A 2GVIA 2E73A 1TURA 1N13A 1SGPI 2OVOA 9WGAA 1UZJA 2GKTI 2J9RA 2KMQA 5JHWC 3TO6A 1YU6C 2QQ0A 5FUXA 1OYVI 2Y0MA 3UOEA 2N52A 2WVJA 3B4VC 2CWHA 1SGNI 2RC4A 3SGQI 1NXUA 1PPFI 1Y1BA 3FC3A 1H0ZA 2FNFX 2NU2I 2ENNA 2ARPF 3D00A 1MJAA 3HH2C 2DB6A 2BUSA 1PJUA 1TBRR 1ULNA 4FKDA 4JCVE 1X4SA 1TBNA 3GOXA 1DS2I 2V1CC 2KMRA 1IW4A 1KSQA 2LB7A 2PQ8A 5EX0A 1P9ZA 2M5XA 1UHAA 1MT1A 3TO9A 5E3QA 1V1IA 2ENZA 2JZMA 5HI7A 3UGLA 1FARA 2ELIA 5J8FA 1K7VA 1SGQI 1OVOA 2A20A 1CGJI 2P6AC 2SGFI 3R5DA 3UEYA 1HEVA 2N17A 3QAHA 1TIHA 5FUYA 3UGIA 2ORVA 1LR9A 3E2IA 5J8CA 2QPOA 1SGDI 1HPTA 4MPIA 1PCEA 2V1CA 2OU2A 2CWFA 2W86A 2ERWA 1Z2IA 3PDNA 1TUSA 2NU1I 1CT4I 3SEKC 2NU3I 5CCMA 3MEKA 4WP4A 2SGEI 1K7UA 7WGAA 1Q9BA 3QWPA 2ROWA 1SGEI 3OXFA 2YUUA 3FSXA 2B0UC 2DIPA 3VDUA 5HQ8A 2F3CI 1CE3A 1PTRA 1P9GA 1UUCA 1M8BA 1SGRI 2QQEA 2X3TA 3UEJA 2VRWB 1DS3I 1KMAA 1CHOI 3E59A 2V53A 3CXLA 4E1RA 1IY5A 2KMOA 2L8EA 1Z7KB 3VE5A 1TBOA 4UXHA 5FUWA 2JW6A 5DAEA 1FAQA 3R5BA 1FYBA 4DNCA 3QTLD 1V1HA 1UZKA 3BJIA 1X74A 2LEOA 2SGPI 3SGBI 1KBEA 1RFHA 2SGDI 1CGII 2LUYA 3OXLA 3KY9A 1HDLA 2UZ3A 2X52A 1Y1CA 4SGBI 1CT2I 2OZUA 2B8TA 1WGTA 2GKVA 1HJAI 1K7TA 1R79A 1CSOI 2GKRI 2RIJA 1FY7A 1W4RA 5E3PA 3TO7A 2YQPA 5CCLA 1CT0I 1UVFA 1IY6A 1YTPA 3R5CA 1WGCA 1BMOA 1TBQR 1SGYI 4E1PA 3UFFA 1U5KA 1Y8FA 1APJA 3OVOA 2ORWA 2JXDA 4OVOA 5E3RA 1LR7A 1M8CA 3OXGA 1PTQA 2GIVA 4A24A 1AN1I 2N1AB 2QQCA 1LR8A 1MJBA 4UXIA 2OD1A 4UXJA 3TOAA 1XA6A 1UVGA 2KCXA 2QQDA 4HGUA 3R5AA 2DKVA 2E5RA 1W3SA
chains in the Genus database with same CATH topology
1XBTA 2CJSC 2W0TA 1KBFA 2JA1A 1OMTA 5FUVA 2L7XA 2WCYA 1R0RI 1TOTA 4B6DA 1BUSA 2NU0I 4L9MA 3RU0A 3OL0A 2JYYA 1VDDA 4GI3C 2ODDA 1NUBA 2KMPA 2XRCA 1OMUA 5EX3A 3VDPA 2K9HA 2SGQI 1XX6A 3TJQA 1UZPA 2NU4I 1UZQA 1TGSI 2J87A 2N71A 2GVIA 2E73A 1TURA 1N13A 1SGPI 2OVOA 1UZJA 2GKTI 2J9RA 2KMQA 5JHWC 1YU6C 2QQ0A 5FUXA 1OYVI 2N52A 2WVJA 3B4VC 1SGNI 3SGQI 1PPFI 1Y1BA 3FC3A 1H0ZA 2FNFX 2NU2I 2ENNA 2ARPF 3D00A 3HH2C 2DB6A 2BUSA 1PJUA 1TBRR 4FKDA 4JCVE 1X4SA 1TBNA 3GOXA 1DS2I 2V1CC 2KMRA 1IW4A 1KSQA 5EX0A 2M5XA 1MT1A 1V1IA 2ENZA 2JZMA 5HI7A 3UGLA 1FARA 2ELIA 1SGQI 2A20A 1OVOA 2P6AC 1CGJI 2SGFI 3UEYA 2N17A 1TIHA 5FUYA 3UGIA 2ORVA 1LR9A 3E2IA 2QPOA 1SGDI 1HPTA 1PCEA 2V1CA 2W86A 2ERWA 3PDNA 1TUSA 2NU1I 1CT4I 3SEKC 2NU3I 5CCMA 3MEKA 2SGEI 3QWPA 2ROWA 1SGEI 3OXFA 2YUUA 2B0UC 2DIPA 3VDUA 5HQ8A 2F3CI 1CE3A 1PTRA 1UUCA 1M8BA 1SGRI 2QQEA 3UEJA 2VRWB 1DS3I 1KMAA 1CHOI 3E59A 2V53A 3CXLA 4E1RA 1IY5A 2KMOA 2L8EA 1Z7KB 3VE5A 1TBOA 4UXHA 5FUWA 2JW6A 5DAEA 1FAQA 1FYBA 3QTLD 1V1HA 1UZKA 3BJIA 1X74A 2LEOA 2SGPI 3SGBI 1KBEA 1RFHA 2SGDI 1CGII 2LUYA 3OXLA 3KY9A 1HDLA 2UZ3A 1Y1CA 4SGBI 1CT2I 2B8TA 2GKVA 1HJAI 1R79A 2GKRI 1CSOI 1W4RA 1IY6A 2YQPA 5CCLA 1CT0I 1UVFA 1YTPA 1BMOA 1TBQR 1SGYI 4E1PA 3UFFA 1U5KA 1Y8FA 1APJA 3OVOA 2ORWA 2JXDA 4OVOA 1LR7A 1M8CA 3OXGA 1PTQA 4A24A 1AN1I 2N1AB 2QQCA 1LR8A 4UXIA 2OD1A 4UXJA 1XA6A 1UVGA 2KCXA 2QQDA 4HGUA 3UGDA 2E5RA 1W3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OMT A;  1BUS A;  2WCY A;  1R0R I;  2NU0 I;  2JYY A;  4GI3 C;  1NUB A;  2KMP A;  2XRC A;  1OMU A;  2SGQ I;  3TJQ A;  1UZP A;  2NU4 I;  1UZQ A;  1TGS I;  2N71 A;  1TUR A;  2OVO A;  1N13 A;  1SGP I;  1UZJ A;  2GKT I;  2KMQ A;  5JHW C;  1YU6 C;  1OYV I;  2N52 A;  3B4V C;  1SGN I;  3SGQ I;  1PPF I;  1Y1B A;  1H0Z A;  2NU2 I;  2ARP F;  3HH2 C;  2BUS A;  1PJU A;  1TBR R;  1DS2 I;  2KMR A;  1IW4 A;  1KSQ A;  2M5X A;  1MT1 A;  2JZM A;  1SGQ I;  2SGF I;  1OVO A;  2P6A C;  1CGJ I;  2N17 A;  1TIH A;  1LR9 A;  1SGD I;  1HPT A;  1PCE A;  2W86 A;  2ERW A;  1TUS A;  2NU1 I;  1CT4 I;  3SEK C;  2NU3 I;  2SGE I;  1SGE I;  2B0U C;  2F3C I;  1CE3 A;  1UUC A;  1M8B A;  1SGR I;  1DS3 I;  1KMA A;  1CHO I;  2V53 A;  1IY5 A;  2KMO A;  1Z7K B;  5DAE A;  1FYB A;  3QTL D;  1UZK A;  2LEO A;  2SGP I;  3SGB I;  2SGD I;  1CGI I;  1HDL A;  1Y1C A;  4SGB I;  1CT2 I;  2GKV A;  1HJA I;  2GKR I;  1CSO I;  1IY6 A;  1CT0 I;  1UVF A;  1YTP A;  1BMO A;  1TBQ R;  1SGY I;  1APJ A;  3OVO A;  2JXD A;  4OVO A;  1LR7 A;  1M8C A;  1AN1 I;  2QQC A;  1LR8 A;  1UVG A;  2KCX A;  2QQD A;  4HGU A; 
#chains in the Genus database with same CATH topology
 1XBT A;  1WKX A;  1ULK A;  2CJS C;  1S20 A;  2W0T A;  3UGD A;  2UVO A;  1MJ9 A;  1KBF A;  2JA1 A;  1OMT A;  5FUV A;  2L7X A;  2WCY A;  1R0R I;  1TOT A;  4B6D A;  1BUS A;  2NU0 I;  3FSY A;  4L9M A;  3RU0 A;  3OL0 A;  2JYY A;  1VDD A;  1ULM A;  2WGC A;  4GI3 C;  2ODD A;  1NUB A;  2KMP A;  2XRC A;  3TOB A;  1OMU A;  5EX3 A;  3VDP A;  2K9H A;  2SGQ I;  1XX6 A;  2CWG A;  3TJQ A;  1WTJ A;  2NU4 I;  1UZP A;  1UZQ A;  1TGS I;  4AML A;  2J87 A;  2N71 A;  2GVI A;  2E73 A;  1TUR A;  1N13 A;  1SGP I;  2OVO A;  9WGA A;  1UZJ A;  2GKT I;  2J9R A;  2KMQ A;  5JHW C;  3TO6 A;  1YU6 C;  2QQ0 A;  5FUX A;  1OYV I;  2Y0M A;  3UOE A;  2N52 A;  2WVJ A;  3B4V C;  2CWH A;  1SGN I;  2RC4 A;  3SGQ I;  1NXU A;  1PPF I;  1Y1B A;  3FC3 A;  1H0Z A;  2FNF X;  2NU2 I;  2ENN A;  2ARP F;  3D00 A;  1MJA A;  3HH2 C;  2DB6 A;  2BUS A;  1PJU A;  1TBR R;  1ULN A;  4FKD A;  4JCV E;  1X4S A;  1TBN A;  3GOX A;  1DS2 I;  2V1C C;  2KMR A;  1IW4 A;  1KSQ A;  2LB7 A;  2PQ8 A;  5EX0 A;  1P9Z A;  2M5X A;  1UHA A;  1MT1 A;  3TO9 A;  5E3Q A;  1V1I A;  2ENZ A;  2JZM A;  5HI7 A;  3UGL A;  1FAR A;  2ELI A;  5J8F A;  1K7V A;  1SGQ I;  1OVO A;  2A20 A;  1CGJ I;  2P6A C;  2SGF I;  3R5D A;  3UEY A;  1HEV A;  2N17 A;  3QAH A;  1TIH A;  5FUY A;  3UGI A;  2ORV A;  1LR9 A;  3E2I A;  5J8C A;  2QPO A;  1SGD I;  1HPT A;  4MPI A;  1PCE A;  2V1C A;  2OU2 A;  2CWF A;  2W86 A;  2ERW A;  1Z2I A;  3PDN A;  1TUS A;  2NU1 I;  1CT4 I;  3SEK C;  2NU3 I;  5CCM A;  3MEK A;  4WP4 A;  2SGE I;  1K7U A;  7WGA A;  1Q9B A;  3QWP A;  2ROW A;  1SGE I;  3OXF A;  2YUU A;  3FSX A;  2B0U C;  2DIP A;  3VDU A;  5HQ8 A;  2F3C I;  1CE3 A;  1PTR A;  1P9G A;  1UUC A;  1M8B A;  1SGR I;  2QQE A;  2X3T A;  3UEJ A;  2VRW B;  1DS3 I;  1KMA A;  1CHO I;  3E59 A;  2V53 A;  3CXL A;  4E1R A;  1IY5 A;  2KMO A;  2L8E A;  1Z7K B;  3VE5 A;  1TBO A;  4UXH A;  5FUW A;  2JW6 A;  5DAE A;  1FAQ A;  3R5B A;  1FYB A;  4DNC A;  3QTL D;  1V1H A;  1UZK A;  3BJI A;  1X74 A;  2LEO A;  2SGP I;  3SGB I;  1KBE A;  1RFH A;  2SGD I;  1CGI I;  2LUY A;  3OXL A;  3KY9 A;  1HDL A;  2UZ3 A;  2X52 A;  1Y1C A;  4SGB I;  1CT2 I;  2OZU A;  2B8T A;  1WGT A;  2GKV A;  1HJA I;  1K7T A;  1R79 A;  1CSO I;  2GKR I;  2RIJ A;  1FY7 A;  1W4R A;  5E3P A;  3TO7 A;  2YQP A;  5CCL A;  1CT0 I;  1UVF A;  1IY6 A;  1YTP A;  3R5C A;  1WGC A;  1BMO A;  1TBQ R;  1SGY I;  4E1P A;  3UFF A;  1U5K A;  1Y8F A;  1APJ A;  3OVO A;  2ORW A;  2JXD A;  4OVO A;  5E3R A;  1LR7 A;  1M8C A;  3OXG A;  1PTQ A;  2GIV A;  4A24 A;  1AN1 I;  2N1A B;  2QQC A;  1LR8 A;  1MJB A;  4UXI A;  2OD1 A;  4UXJ A;  3TOA A;  1XA6 A;  1UVG A;  2KCX A;  2QQD A;  4HGU A;  3R5A A;  2DKV A;  2E5R A;  1W3S A; 
#chains in the Genus database with same CATH homology
 1XBT A;  2CJS C;  2W0T A;  1KBF A;  2JA1 A;  1OMT A;  5FUV A;  2L7X A;  2WCY A;  1R0R I;  1TOT A;  4B6D A;  1BUS A;  2NU0 I;  4L9M A;  3RU0 A;  3OL0 A;  2JYY A;  1VDD A;  4GI3 C;  2ODD A;  1NUB A;  2KMP A;  2XRC A;  1OMU A;  5EX3 A;  3VDP A;  2K9H A;  2SGQ I;  1XX6 A;  3TJQ A;  1UZP A;  2NU4 I;  1UZQ A;  1TGS I;  2J87 A;  2N71 A;  2GVI A;  2E73 A;  1TUR A;  1N13 A;  1SGP I;  2OVO A;  1UZJ A;  2GKT I;  2J9R A;  2KMQ A;  5JHW C;  1YU6 C;  2QQ0 A;  5FUX A;  1OYV I;  2N52 A;  2WVJ A;  3B4V C;  1SGN I;  3SGQ I;  1PPF I;  1Y1B A;  3FC3 A;  1H0Z A;  2FNF X;  2NU2 I;  2ENN A;  2ARP F;  3D00 A;  3HH2 C;  2DB6 A;  2BUS A;  1PJU A;  1TBR R;  4FKD A;  4JCV E;  1X4S A;  1TBN A;  3GOX A;  1DS2 I;  2V1C C;  2KMR A;  1IW4 A;  1KSQ A;  5EX0 A;  2M5X A;  1MT1 A;  1V1I A;  2ENZ A;  2JZM A;  5HI7 A;  3UGL A;  1FAR A;  2ELI A;  1SGQ I;  2A20 A;  1OVO A;  2P6A C;  1CGJ I;  2SGF I;  3UEY A;  2N17 A;  1TIH A;  5FUY A;  3UGI A;  2ORV A;  1LR9 A;  3E2I A;  2QPO A;  1SGD I;  1HPT A;  1PCE A;  2V1C A;  2W86 A;  2ERW A;  3PDN A;  1TUS A;  2NU1 I;  1CT4 I;  3SEK C;  2NU3 I;  5CCM A;  3MEK A;  2SGE I;  3QWP A;  2ROW A;  1SGE I;  3OXF A;  2YUU A;  2B0U C;  2DIP A;  3VDU A;  5HQ8 A;  2F3C I;  1CE3 A;  1PTR A;  1UUC A;  1M8B A;  1SGR I;  2QQE A;  3UEJ A;  2VRW B;  1DS3 I;  1KMA A;  1CHO I;  3E59 A;  2V53 A;  3CXL A;  4E1R A;  1IY5 A;  2KMO A;  2L8E A;  1Z7K B;  3VE5 A;  1TBO A;  4UXH A;  5FUW A;  2JW6 A;  5DAE A;  1FAQ A;  1FYB A;  3QTL D;  1V1H A;  1UZK A;  3BJI A;  1X74 A;  2LEO A;  2SGP I;  3SGB I;  1KBE A;  1RFH A;  2SGD I;  1CGI I;  2LUY A;  3OXL A;  3KY9 A;  1HDL A;  2UZ3 A;  1Y1C A;  4SGB I;  1CT2 I;  2B8T A;  2GKV A;  1HJA I;  1R79 A;  2GKR I;  1CSO I;  1W4R A;  1IY6 A;  2YQP A;  5CCL A;  1CT0 I;  1UVF A;  1YTP A;  1BMO A;  1TBQ R;  1SGY I;  4E1P A;  3UFF A;  1U5K A;  1Y8F A;  1APJ A;  3OVO A;  2ORW A;  2JXD A;  4OVO A;  1LR7 A;  1M8C A;  3OXG A;  1PTQ A;  4A24 A;  1AN1 I;  2N1A B;  2QQC A;  1LR8 A;  4UXI A;  2OD1 A;  4UXJ A;  1XA6 A;  1UVG A;  2KCX A;  2QQD A;  4HGU A;  3UGD A;  2E5R A;  1W3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...