2SGPI

Pro 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 6.5
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
51
structure length
51
Chain Sequence
b'VDCSEYPKPACTPEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE B
publication title Contribution of peptide bonds to inhibitor-protease binding: crystal structures of the turkey ovomucoid third domain backbone variants OMTKY3-Pro18I and OMTKY3-psi[COO]-Leu18I in complex with Streptomyces griseus proteinase B (SGPB) and the structure of the free inhibitor, OMTKY-3-psi[CH2NH2+]-Asp19I
pubmed doi rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/inhibitor
total genus 11
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2sgpI00
2XRCA 2N17A 4HGUA 2N71A 1SGEI 2JZMA 3SGQI 1TBRR 4OVOA 5DAEA 1CT2I 1SGYI 1TIHA 1FYBA 3SEKC 1BUSA 1HDLA 2GKRI 1MT1A 1AN1I 1SGPI 1SGRI 1LR7A 2NU2I 2P6AC 4GI3C 3OVOA 2SGDI 1YU6C 1SGDI 1IY6A 2SGEI 2NU4I 1CSOI 2LEOA 2NU1I 2SGPI 1LR9A 2JXDA 2SGQI 1HPTA 1CGJI 1NUBA 2N52A 1H0ZA 1M8CA 1M8BA 2KCXA 2SGFI 1OMUA 1CHOI 1OYVI 2WCYA 3TJQA 1CE3A 2OVOA 2KMRA 1OVOA 1Y1BA 1TGSI 2QQCA 2QQDA 5JHWC 1PPFI 3HH2C 2F3CI 1BMOA 2GKTI 1KMAA 1HJAI 1UVGA 1Y1CA 3B4VC 1SGQI 2NU0I 3QTLD 1PCEA 1TBQR 2NU3I 3SGBI 1CGII 1DS2I 2KMQA 2B0UC 1UVFA 1R0RI 1OMTA 1IW4A 2ERWA 1TUSA 1UUCA 1CT4I 2V53A 1N13A 2ARPF 2GKVA 1YTPA 1PJUA 1SGNI 2BUSA 2M5XA 1DS3I 2KMOA 1IY5A 2KMPA 1LR8A 4SGBI 1Z7KB 1TURA 2JYYA 1CT0I
chains in the Genus database with same CATH superfamily
2XRCA 2DIPA 1Z2IA 2L8EA 2N17A 3D00A 3OXLA 4HGUA 4UXHA 1K7UA 2N71A 1SGEI 2JZMA 3QAHA 3SGQI 1H0ZA 1NXUA 1TBRR 3OXFA 9WGAA 1P9ZA 4OVOA 5DAEA 3VE5A 3R5BA 2ENZA 2QPOA 1CT2I 5E3PA 1SGYI 1TIHA 5HI7A 1MJ9A 1FYBA 2L7XA 3SEKC 2CWFA 2WVJA 1BUSA 1UHAA 1HDLA 5HQ8A 2ENNA 2GKRI 4E1PA 2E5RA 1MT1A 2LUYA 1X74A 1AN1I 1SGPI 3R5DA 3UGIA 1W3SA 1SGRI 1LR7A 2NU2I 2P6AC 2Y0MA 4GI3C 4JCVE 4MPIA 3OVOA 2SGDI 3UGDA 1YU6C 1TBNA 3PDNA 1TOTA 3TOBA 1ULNA 4A24A 1SGDI 5FUWA 1WGTA 2ELIA 2QQEA 3UEJA 2X52A 4UXIA 4L9MA 2V1CA 2ORVA 1U5KA 1X4SA 2J9RA 1VDDA 2SGEI 2UVOA 4B6DA 1FY7A 2NU4I 1CSOI 5FUYA 3R5AA 2CWGA 2LEOA 2NU1I 2SGPI 3UFFA 1LR9A 3TO6A 3E59A 2JXDA 2SGQI 1HPTA 1CGJI 2RC4A 1NUBA 2N1AB 1TBOA 3MEKA 2N52A 2K9HA 1M8CA 1M8BA 2KCXA 2SGFI 2CWHA 5EX3A 1OMUA 1CHOI 3RU0A 1R79A 5J8FA 1OYVI 3QWPA 2WCYA 2OD1A 2E73A 1V1IA 3TJQA 1KBFA 5E3RA 2GIVA 1CE3A 3UEYA 1Q9BA 3FC3A 2ODDA 2JA1A 3OXGA 2YUUA 2ROWA 1ULKA 1XA6A 2OVOA 1K7VA 5E3QA 1Y8FA 3UGLA 3FSXA 3VDPA 2KMRA 1WTJA 1OVOA 2FNFX 1FARA 1Y1BA 3BJIA 1XBTA 1TGSI 2QQCA 3TO9A 2QQDA 2WGCA 5JHWC 4E1RA 1PPFI 2V1CC 3HH2C 3KY9A 3VDUA 2ORWA 1WGCA 5FUXA 2CJSC 2A20A 2GVIA 1PTQA 7WGAA 4FKDA 2F3CI 3E2IA 4WP4A 1KBEA 1BMOA 2DKVA 2GKTI 1MJAA 1KMAA 1HJAI 2LB7A 3OL0A 1RFHA 1UVGA 1Y1CA 1FAQA 3B4VC 1ULMA 2X3TA 2QQ0A 1XX6A 3TO7A 1P9GA 1SGQI 2NU0I 1IY6A 3QTLD 1WKXA 1PCEA 1TBQR 2W0TA 2NU3I 2PQ8A 3SGBI 5CCLA 2VRWB 1CGII 2B8TA 1DS2I 2KMQA 2B0UC 4UXJA 1UVFA 1R0RI 1V1HA 2DB6A 1OMTA 1W4RA 2JW6A 3FSYA 2ERWA 1TUSA 1IW4A 1UUCA 3GOXA 1CT4I 1K7TA 1HEVA 2V53A 5CCMA 1S20A 1N13A 2ARPF 2GKVA 3TOAA 4DNCA 1YTPA 3CXLA 1PTRA 1PJUA 1SGNI 3R5CA 2BUSA 2M5XA 1MJBA 1DS3I 2KMOA 1IY5A 2KMPA 2YQPA 5J8CA 3UOEA 1LR8A 2J87A 4SGBI 2OZUA 2UZ3A 5EX0A 2RIJA 4AMLA 1Z7KB 2OU2A 5FUVA 1TURA 2JYYA 1CT0I
chains in the Genus database with same CATH topology
2XRCA 2DIPA 2L8EA 2N17A 3D00A 3OXLA 4HGUA 4UXHA 2N71A 1SGEI 2JZMA 3SGQI 1TBRR 3OXFA 4OVOA 5DAEA 3VE5A 2ENZA 2QPOA 1CT2I 1SGYI 1TIHA 5HI7A 1FYBA 2L7XA 3SEKC 2WVJA 1BUSA 1HDLA 5HQ8A 2ENNA 2GKRI 4E1PA 2E5RA 1MT1A 2LUYA 1X74A 1AN1I 1SGPI 3UGIA 1W3SA 1SGRI 1LR7A 2NU2I 2P6AC 4GI3C 4JCVE 3OVOA 2SGDI 3UGDA 1YU6C 1TBNA 3PDNA 1TOTA 4A24A 1SGDI 5FUWA 2ELIA 2QQEA 3UEJA 4UXIA 4L9MA 2V1CA 2ORVA 1U5KA 1X4SA 2J9RA 1VDDA 2SGEI 4B6DA 1IY6A 2NU4I 1CSOI 5FUYA 2LEOA 2NU1I 2SGPI 3UFFA 1LR9A 3E59A 2JXDA 2SGQI 1HPTA 1CGJI 1NUBA 2N1AB 1TBOA 3MEKA 2N52A 2K9HA 1M8CA 1M8BA 2KCXA 2SGFI 5EX3A 3RU0A 1OMUA 1CHOI 1H0ZA 1R79A 1OYVI 3QWPA 2WCYA 2OD1A 2E73A 1V1IA 3TJQA 1KBFA 1CE3A 3UEYA 3FC3A 2ODDA 2JA1A 3OXGA 2YUUA 2ROWA 1XA6A 2OVOA 3UGLA 1Y8FA 3VDPA 2KMRA 1OVOA 2FNFX 1FARA 1Y1BA 3BJIA 1XBTA 1TGSI 2QQCA 2QQDA 5JHWC 4E1RA 1PPFI 2V1CC 3HH2C 3KY9A 3VDUA 2ORWA 5FUXA 2CJSC 2A20A 2GVIA 1PTQA 4FKDA 2F3CI 3E2IA 1KBEA 1BMOA 2GKTI 1KMAA 1HJAI 3OL0A 1RFHA 1UVGA 1Y1CA 1FAQA 3B4VC 2QQ0A 1XX6A 1SGQI 2NU0I 3QTLD 1PCEA 1TBQR 2W0TA 2NU3I 3SGBI 5CCLA 2VRWB 1CGII 2B8TA 1DS2I 2KMQA 2B0UC 4UXJA 1UVFA 1R0RI 1V1HA 2DB6A 1OMTA 1W4RA 2JW6A 1IW4A 2ERWA 1TUSA 1UUCA 3GOXA 1CT4I 2V53A 5CCMA 1N13A 2ARPF 2GKVA 1YTPA 3CXLA 1PTRA 1PJUA 1SGNI 2BUSA 2M5XA 1DS3I 2KMOA 1IY5A 2KMPA 2YQPA 1LR8A 2J87A 4SGBI 2UZ3A 5EX0A 1Z7KB 5FUVA 1TURA 2JYYA 1CT0I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XRC A;  2N17 A;  4HGU A;  2N71 A;  1SGE I;  2JZM A;  3SGQ I;  1TBR R;  4OVO A;  5DAE A;  1CT2 I;  1SGY I;  1TIH A;  1FYB A;  3SEK C;  1BUS A;  1HDL A;  2GKR I;  1MT1 A;  1AN1 I;  1SGP I;  1SGR I;  1LR7 A;  2NU2 I;  2P6A C;  4GI3 C;  3OVO A;  2SGD I;  1YU6 C;  1SGD I;  1IY6 A;  2SGE I;  2NU4 I;  1CSO I;  2LEO A;  2NU1 I;  2SGP I;  1LR9 A;  2JXD A;  2SGQ I;  1HPT A;  1CGJ I;  1NUB A;  2N52 A;  1H0Z A;  1M8C A;  1M8B A;  2KCX A;  2SGF I;  1OMU A;  1CHO I;  1OYV I;  2WCY A;  3TJQ A;  1CE3 A;  2OVO A;  2KMR A;  1OVO A;  1Y1B A;  1TGS I;  2QQC A;  2QQD A;  5JHW C;  1PPF I;  3HH2 C;  2F3C I;  1BMO A;  2GKT I;  1KMA A;  1HJA I;  1UVG A;  1Y1C A;  3B4V C;  1SGQ I;  2NU0 I;  3QTL D;  1PCE A;  1TBQ R;  2NU3 I;  3SGB I;  1CGI I;  1DS2 I;  2KMQ A;  2B0U C;  1UVF A;  1R0R I;  1OMT A;  1IW4 A;  2ERW A;  1TUS A;  1UUC A;  1CT4 I;  2V53 A;  1N13 A;  2ARP F;  2GKV A;  1YTP A;  1PJU A;  1SGN I;  2BUS A;  2M5X A;  1DS3 I;  2KMO A;  1IY5 A;  2KMP A;  1LR8 A;  4SGB I;  1Z7K B;  1TUR A;  2JYY A;  1CT0 I; 
#chains in the Genus database with same CATH topology
 2XRC A;  2DIP A;  1Z2I A;  2L8E A;  2N17 A;  3D00 A;  3OXL A;  4HGU A;  4UXH A;  1K7U A;  2N71 A;  1SGE I;  2JZM A;  3QAH A;  3SGQ I;  1H0Z A;  1NXU A;  1TBR R;  3OXF A;  9WGA A;  1P9Z A;  4OVO A;  5DAE A;  3VE5 A;  3R5B A;  2ENZ A;  2QPO A;  1CT2 I;  5E3P A;  1SGY I;  1TIH A;  5HI7 A;  1MJ9 A;  1FYB A;  2L7X A;  3SEK C;  2CWF A;  2WVJ A;  1BUS A;  1UHA A;  1HDL A;  5HQ8 A;  2ENN A;  2GKR I;  4E1P A;  2E5R A;  1MT1 A;  2LUY A;  1X74 A;  1AN1 I;  1SGP I;  3R5D A;  3UGI A;  1W3S A;  1SGR I;  1LR7 A;  2NU2 I;  2P6A C;  2Y0M A;  4GI3 C;  4JCV E;  4MPI A;  3OVO A;  2SGD I;  3UGD A;  1YU6 C;  1TBN A;  3PDN A;  1TOT A;  3TOB A;  1ULN A;  4A24 A;  1SGD I;  5FUW A;  1WGT A;  2ELI A;  2QQE A;  3UEJ A;  2X52 A;  4UXI A;  4L9M A;  2V1C A;  2ORV A;  1U5K A;  1X4S A;  2J9R A;  1VDD A;  2SGE I;  2UVO A;  4B6D A;  1FY7 A;  2NU4 I;  1CSO I;  5FUY A;  3R5A A;  2CWG A;  2LEO A;  2NU1 I;  2SGP I;  3UFF A;  1LR9 A;  3TO6 A;  3E59 A;  2JXD A;  2SGQ I;  1HPT A;  1CGJ I;  2RC4 A;  1NUB A;  2N1A B;  1TBO A;  3MEK A;  2N52 A;  2K9H A;  1M8C A;  1M8B A;  2KCX A;  2SGF I;  2CWH A;  5EX3 A;  1OMU A;  1CHO I;  3RU0 A;  1R79 A;  5J8F A;  1OYV I;  3QWP A;  2WCY A;  2OD1 A;  2E73 A;  1V1I A;  3TJQ A;  1KBF A;  5E3R A;  2GIV A;  1CE3 A;  3UEY A;  1Q9B A;  3FC3 A;  2ODD A;  2JA1 A;  3OXG A;  2YUU A;  2ROW A;  1ULK A;  1XA6 A;  2OVO A;  1K7V A;  5E3Q A;  1Y8F A;  3UGL A;  3FSX A;  3VDP A;  2KMR A;  1WTJ A;  1OVO A;  2FNF X;  1FAR A;  1Y1B A;  3BJI A;  1XBT A;  1TGS I;  2QQC A;  3TO9 A;  2QQD A;  2WGC A;  5JHW C;  4E1R A;  1PPF I;  2V1C C;  3HH2 C;  3KY9 A;  3VDU A;  2ORW A;  1WGC A;  5FUX A;  2CJS C;  2A20 A;  2GVI A;  1PTQ A;  7WGA A;  4FKD A;  2F3C I;  3E2I A;  4WP4 A;  1KBE A;  1BMO A;  2DKV A;  2GKT I;  1MJA A;  1KMA A;  1HJA I;  2LB7 A;  3OL0 A;  1RFH A;  1UVG A;  1Y1C A;  1FAQ A;  3B4V C;  1ULM A;  2X3T A;  2QQ0 A;  1XX6 A;  3TO7 A;  1P9G A;  1SGQ I;  2NU0 I;  1IY6 A;  3QTL D;  1WKX A;  1PCE A;  1TBQ R;  2W0T A;  2NU3 I;  2PQ8 A;  3SGB I;  5CCL A;  2VRW B;  1CGI I;  2B8T A;  1DS2 I;  2KMQ A;  2B0U C;  4UXJ A;  1UVF A;  1R0R I;  1V1H A;  2DB6 A;  1OMT A;  1W4R A;  2JW6 A;  3FSY A;  2ERW A;  1TUS A;  1IW4 A;  1UUC A;  3GOX A;  1CT4 I;  1K7T A;  1HEV A;  2V53 A;  5CCM A;  1S20 A;  1N13 A;  2ARP F;  2GKV A;  3TOA A;  4DNC A;  1YTP A;  3CXL A;  1PTR A;  1PJU A;  1SGN I;  3R5C A;  2BUS A;  2M5X A;  1MJB A;  1DS3 I;  2KMO A;  1IY5 A;  2KMP A;  2YQP A;  5J8C A;  3UOE A;  1LR8 A;  2J87 A;  4SGB I;  2OZU A;  2UZ3 A;  5EX0 A;  2RIJ A;  4AML A;  1Z7K B;  2OU2 A;  5FUV A;  1TUR A;  2JYY A;  1CT0 I; 
#chains in the Genus database with same CATH homology
 2XRC A;  2DIP A;  2L8E A;  2N17 A;  3D00 A;  3OXL A;  4HGU A;  4UXH A;  2N71 A;  1SGE I;  2JZM A;  3SGQ I;  1TBR R;  3OXF A;  4OVO A;  5DAE A;  3VE5 A;  2ENZ A;  2QPO A;  1CT2 I;  1SGY I;  1TIH A;  5HI7 A;  1FYB A;  2L7X A;  3SEK C;  2WVJ A;  1BUS A;  1HDL A;  5HQ8 A;  2ENN A;  2GKR I;  4E1P A;  2E5R A;  1MT1 A;  2LUY A;  1X74 A;  1AN1 I;  1SGP I;  3UGI A;  1W3S A;  1SGR I;  1LR7 A;  2NU2 I;  2P6A C;  4GI3 C;  4JCV E;  3OVO A;  2SGD I;  3UGD A;  1YU6 C;  1TBN A;  3PDN A;  1TOT A;  4A24 A;  1SGD I;  5FUW A;  2ELI A;  2QQE A;  3UEJ A;  4UXI A;  4L9M A;  2V1C A;  2ORV A;  1U5K A;  1X4S A;  2J9R A;  1VDD A;  2SGE I;  4B6D A;  1IY6 A;  2NU4 I;  1CSO I;  5FUY A;  2LEO A;  2NU1 I;  2SGP I;  3UFF A;  1LR9 A;  3E59 A;  2JXD A;  2SGQ I;  1HPT A;  1CGJ I;  1NUB A;  2N1A B;  1TBO A;  3MEK A;  2N52 A;  2K9H A;  1M8C A;  1M8B A;  2KCX A;  2SGF I;  5EX3 A;  3RU0 A;  1OMU A;  1CHO I;  1H0Z A;  1R79 A;  1OYV I;  3QWP A;  2WCY A;  2OD1 A;  2E73 A;  1V1I A;  3TJQ A;  1KBF A;  1CE3 A;  3UEY A;  3FC3 A;  2ODD A;  2JA1 A;  3OXG A;  2YUU A;  2ROW A;  1XA6 A;  2OVO A;  3UGL A;  1Y8F A;  3VDP A;  2KMR A;  1OVO A;  2FNF X;  1FAR A;  1Y1B A;  3BJI A;  1XBT A;  1TGS I;  2QQC A;  2QQD A;  5JHW C;  4E1R A;  1PPF I;  2V1C C;  3HH2 C;  3KY9 A;  3VDU A;  2ORW A;  5FUX A;  2CJS C;  2A20 A;  2GVI A;  1PTQ A;  4FKD A;  2F3C I;  3E2I A;  1KBE A;  1BMO A;  2GKT I;  1KMA A;  1HJA I;  3OL0 A;  1RFH A;  1UVG A;  1Y1C A;  1FAQ A;  3B4V C;  2QQ0 A;  1XX6 A;  1SGQ I;  2NU0 I;  3QTL D;  1PCE A;  1TBQ R;  2W0T A;  2NU3 I;  3SGB I;  5CCL A;  2VRW B;  1CGI I;  2B8T A;  1DS2 I;  2KMQ A;  2B0U C;  4UXJ A;  1UVF A;  1R0R I;  1V1H A;  2DB6 A;  1OMT A;  1W4R A;  2JW6 A;  1IW4 A;  2ERW A;  1TUS A;  1UUC A;  3GOX A;  1CT4 I;  2V53 A;  5CCM A;  1N13 A;  2ARP F;  2GKV A;  1YTP A;  3CXL A;  1PTR A;  1PJU A;  1SGN I;  2BUS A;  2M5X A;  1DS3 I;  2KMO A;  1IY5 A;  2KMP A;  2YQP A;  1LR8 A;  2J87 A;  4SGB I;  2UZ3 A;  5EX0 A;  1Z7K B;  5FUV A;  1TUR A;  2JYY A;  1CT0 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...