2SGPI

Pro 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 6.5
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTPEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE B
publication title Contribution of peptide bonds to inhibitor-protease binding: crystal structures of the turkey ovomucoid third domain backbone variants OMTKY3-Pro18I and OMTKY3-psi[COO]-Leu18I in complex with Streptomyces griseus proteinase B (SGPB) and the structure of the free inhibitor, OMTKY-3-psi[CH2NH2+]-Asp19I
pubmed doi rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/inhibitor
total genus 11
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2sgpI00
1R0RI 2SGFI 1DS2I 1M8CA 1SGNI 1LR8A 1YTPA 4SGBI 1MT1A 2V53A 2GKTI 2NU3I 2SGEI 4GI3C 2NU0I 2ARPF 1UVGA 2KMOA 2JXDA 1H0ZA 1PCEA 1TUSA 1SGYI 1CT0I 1TIHA 1TBRR 3SEKC 3TJQA 2GKVA 1PPFI 2WCYA 2N71A 2QQCA 2KMQA 1CHOI 3SGQI 2N17A 1TURA 1AN1I 1IY6A 2NU4I 5JHWC 1YU6C 2JZMA 2KMRA 1UVFA 1SGRI 5DAEA 1HJAI 2KMPA 2SGDI 3OVOA 2SGPI 2QQDA 1Y1CA 2N52A 1SGQI 1IY5A 4HGUA 3QTLD 2GKRI 1CT4I 1CGII 2LEOA 1BMOA 4OVOA 1IW4A 2B0UC 1OYVI 3B4VC 1CSOI 2BUSA 1M8BA 1OMUA 2NU2I 1FYBA 1SGPI 1SGEI 1TBQR 1TGSI 2F3CI 1CT2I 2NU1I 1SGDI 2JYYA 1LR7A 1NUBA 1Z7KB 1PJUA 2M5XA 1CGJI 1Y1BA 2XRCA 2SGQI 1N13A 2ERWA 1OVOA 1BUSA 1KMAA 3SGBI 1CE3A 2KCXA 1OMTA 2OVOA 1HPTA 1HDLA 3HH2C 1UUCA 1LR9A 1DS3I 2P6AC
chains in the Genus database with same CATH superfamily
2N1AB 1R0RI 1XBTA 1DS2I 2SGFI 1M8CA 1SGNI 4E1PA 3TOBA 1LR8A 3CXLA 1YTPA 3D00A 5J8FA 2J87A 2A20A 2ORWA 2LUYA 4SGBI 1MT1A 2V53A 4B6DA 2GKTI 2CJSC 2DKVA 4E1RA 5HQ8A 1MJ9A 1Q9BA 3E2IA 3BJIA 1UHAA 2LB7A 3FSXA 3TO9A 2NU3I 1W4RA 3GOXA 2SGEI 4GI3C 2NU0I 2ARPF 2W0TA 1UVGA 1K7VA 4MPIA 2KMOA 2JXDA 5E3RA 7WGAA 2OD1A 2OU2A 2QQ0A 3MEKA 3TO7A 1H0ZA 3VDUA 4JCVE 4UXJA 3UEYA 1K7TA 2WVJA 3R5BA 5E3PA 1PCEA 1TUSA 2E5RA 4UXHA 2UZ3A 1SGYI 1CT0I 1TIHA 2V1CC 1TBRR 2WGCA 3SEKC 1XX6A 2GKVA 1PPFI 2WCYA 3TJQA 3TOAA 2N71A 2FNFX 2QQCA 5E3QA 4A24A 5J8CA 2RC4A 3RU0A 3UGIA 1TBNA 1CHOI 1ULKA 2KMQA 2ORVA 2N17A 3SGQI 1KBEA 1TURA 3OXLA 1WGTA 1AN1I 4L9MA 3UEJA 2QQEA 2L8EA 1IY6A 2JW6A 2NU4I 5JHWC 2V1CA 1YU6C 2JZMA 1K7UA 2KMRA 3QWPA 1UVFA 3QAHA 1SGRI 5DAEA 1HJAI 2JA1A 2KMPA 3FSYA 4UXIA 1RFHA 2SGDI 3E59A 1PTRA 3OVOA 3VDPA 1U5KA 2SGPI 2QQDA 1WTJA 1Y1CA 2GVIA 3FC3A 1ULNA 2N52A 1SGQI 2YQPA 1IY5A 2DIPA 4HGUA 1P9ZA 2DB6A 3UGLA 1WGCA 1FAQA 3R5CA 1ULMA 2QPOA 1FY7A 2GKRI 3QTLD 5EX0A 1CT4I 9WGAA 3PDNA 1CGII 2J9RA 2RIJA 3R5DA 1X74A 3KY9A 2LEOA 1BMOA 4OVOA 1IW4A 5FUXA 1HEVA 2B0UC 1FARA 1OYVI 2E73A 2PQ8A 2Y0MA 1CSOI 2B8TA 3B4VC 1WKXA 2BUSA 1M8BA 1OMUA 2NU2I 2YUUA 1FYBA 1SGPI 2ENNA 5EX3A 1SGEI 5HI7A 3OXFA 2ELIA 1V1IA 2CWGA 1TBQR 1TGSI 3UOEA 5FUWA 2F3CI 2L7XA 3R5AA 1CT2I 1SGDI 1NUBA 2JYYA 1LR7A 1NXUA 1Z7KB 2NU1I 5FUYA 3VE5A 1PJUA 2M5XA 4FKDA 1CGJI 1XA6A 2OZUA 1Y1BA 1MJBA 2UVOA 2CWHA 3OL0A 5CCLA 2VRWB 2XRCA 3UFFA 4DNCA 1TBOA 1W3SA 2K9HA 1PTQA 2GIVA 2SGQI 5FUVA 1N13A 2ODDA 4AMLA 2ERWA 1P9GA 1V1HA 1Y8FA 1MJAA 2ENZA 2ROWA 1OVOA 1R79A 1TOTA 2X3TA 1BUSA 2CWFA 5CCMA 3TO6A 3UGDA 1KMAA 3SGBI 1CE3A 2KCXA 1OMTA 2X52A 1KBFA 2OVOA 1HPTA 1HDLA 1X4SA 3HH2C 1UUCA 1LR9A 1Z2IA 1DS3I 4WP4A 3OXGA 1S20A 2P6AC 1VDDA
chains in the Genus database with same CATH topology
2N1AB 1R0RI 1XBTA 1DS2I 2SGFI 1M8CA 1SGNI 4E1PA 1LR8A 3CXLA 1YTPA 3D00A 2J87A 2A20A 2ORWA 2LUYA 4SGBI 1MT1A 2V53A 4B6DA 2GKTI 2CJSC 4E1RA 5HQ8A 3E2IA 3BJIA 2NU3I 1W4RA 3GOXA 2SGEI 4GI3C 2NU0I 2ARPF 2W0TA 1UVGA 2KMOA 2JXDA 2OD1A 2QQ0A 3MEKA 1H0ZA 3VDUA 4JCVE 4UXJA 3UEYA 2WVJA 1PCEA 1TUSA 2E5RA 4UXHA 2UZ3A 1SGYI 1CT0I 1TIHA 2V1CC 1TBRR 3SEKC 1XX6A 2GKVA 1PPFI 2WCYA 3TJQA 2N71A 2FNFX 2QQCA 4A24A 3RU0A 3UGIA 1TBNA 1CHOI 2KMQA 2ORVA 3SGQI 2N17A 1KBEA 1TURA 3OXLA 4L9MA 1AN1I 3UEJA 2QQEA 2L8EA 1IY6A 2JW6A 2NU4I 5JHWC 2V1CA 1YU6C 2JZMA 2KMRA 3QWPA 1UVFA 1SGRI 5DAEA 1HJAI 2JA1A 2KMPA 4UXIA 1RFHA 2SGDI 3OVOA 1PTRA 3VDPA 1U5KA 2SGPI 2QQDA 1Y1CA 2GVIA 3FC3A 2N52A 1SGQI 2YQPA 1IY5A 2DIPA 4HGUA 2DB6A 3UGLA 1FAQA 2QPOA 3QTLD 5EX0A 2GKRI 1CT4I 3PDNA 1CGII 2J9RA 1X74A 3KY9A 2LEOA 1BMOA 4OVOA 1IW4A 5FUXA 2B0UC 1FARA 1OYVI 2E73A 3B4VC 1CSOI 2B8TA 2BUSA 2YUUA 1M8BA 1OMUA 2NU2I 1FYBA 1SGPI 2ENNA 5EX3A 1SGEI 5HI7A 3OXFA 2ELIA 1V1IA 1TBQR 1TGSI 5FUWA 2F3CI 2L7XA 1CT2I 1SGDI 1NUBA 2JYYA 1LR7A 2NU1I 1Z7KB 5FUYA 3VE5A 1PJUA 2M5XA 4FKDA 1CGJI 1XA6A 1Y1BA 3OL0A 5CCLA 2VRWB 2XRCA 3UFFA 1TBOA 1W3SA 2K9HA 1PTQA 2SGQI 5FUVA 1N13A 2ODDA 2ERWA 1V1HA 3E59A 1Y8FA 2ENZA 2ROWA 1OVOA 1R79A 1TOTA 1BUSA 5CCMA 3UGDA 1KMAA 3SGBI 1CE3A 2KCXA 1OMTA 1KBFA 2OVOA 1HPTA 1HDLA 1X4SA 3HH2C 1UUCA 1LR9A 1DS3I 3OXGA 2P6AC 1VDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R0R I;  2SGF I;  1DS2 I;  1M8C A;  1SGN I;  1LR8 A;  1YTP A;  4SGB I;  1MT1 A;  2V53 A;  2GKT I;  2NU3 I;  2SGE I;  4GI3 C;  2NU0 I;  2ARP F;  1UVG A;  2KMO A;  2JXD A;  1H0Z A;  1PCE A;  1TUS A;  1SGY I;  1CT0 I;  1TIH A;  1TBR R;  3SEK C;  3TJQ A;  2GKV A;  1PPF I;  2WCY A;  2N71 A;  2QQC A;  2KMQ A;  1CHO I;  3SGQ I;  2N17 A;  1TUR A;  1AN1 I;  1IY6 A;  2NU4 I;  5JHW C;  1YU6 C;  2JZM A;  2KMR A;  1UVF A;  1SGR I;  5DAE A;  1HJA I;  2KMP A;  2SGD I;  3OVO A;  2SGP I;  2QQD A;  1Y1C A;  2N52 A;  1SGQ I;  1IY5 A;  4HGU A;  3QTL D;  2GKR I;  1CT4 I;  1CGI I;  2LEO A;  1BMO A;  4OVO A;  1IW4 A;  2B0U C;  1OYV I;  3B4V C;  1CSO I;  2BUS A;  1M8B A;  1OMU A;  2NU2 I;  1FYB A;  1SGP I;  1SGE I;  1TBQ R;  1TGS I;  2F3C I;  1CT2 I;  2NU1 I;  1SGD I;  2JYY A;  1LR7 A;  1NUB A;  1Z7K B;  1PJU A;  2M5X A;  1CGJ I;  1Y1B A;  2XRC A;  2SGQ I;  1N13 A;  2ERW A;  1OVO A;  1BUS A;  1KMA A;  3SGB I;  1CE3 A;  2KCX A;  1OMT A;  2OVO A;  1HPT A;  1HDL A;  3HH2 C;  1UUC A;  1LR9 A;  1DS3 I;  2P6A C; 
#chains in the Genus database with same CATH topology
 2N1A B;  1R0R I;  1XBT A;  1DS2 I;  2SGF I;  1M8C A;  1SGN I;  4E1P A;  3TOB A;  1LR8 A;  3CXL A;  1YTP A;  3D00 A;  5J8F A;  2J87 A;  2A20 A;  2ORW A;  2LUY A;  4SGB I;  1MT1 A;  2V53 A;  4B6D A;  2GKT I;  2CJS C;  2DKV A;  4E1R A;  5HQ8 A;  1MJ9 A;  1Q9B A;  3E2I A;  3BJI A;  1UHA A;  2LB7 A;  3FSX A;  3TO9 A;  2NU3 I;  1W4R A;  3GOX A;  2SGE I;  4GI3 C;  2NU0 I;  2ARP F;  2W0T A;  1UVG A;  1K7V A;  4MPI A;  2KMO A;  2JXD A;  5E3R A;  7WGA A;  2OD1 A;  2OU2 A;  2QQ0 A;  3MEK A;  3TO7 A;  1H0Z A;  3VDU A;  4JCV E;  4UXJ A;  3UEY A;  1K7T A;  2WVJ A;  3R5B A;  5E3P A;  1PCE A;  1TUS A;  2E5R A;  4UXH A;  2UZ3 A;  1SGY I;  1CT0 I;  1TIH A;  2V1C C;  1TBR R;  2WGC A;  3SEK C;  1XX6 A;  2GKV A;  1PPF I;  2WCY A;  3TJQ A;  3TOA A;  2N71 A;  2FNF X;  2QQC A;  5E3Q A;  4A24 A;  5J8C A;  2RC4 A;  3RU0 A;  3UGI A;  1TBN A;  1CHO I;  1ULK A;  2KMQ A;  2ORV A;  2N17 A;  3SGQ I;  1KBE A;  1TUR A;  3OXL A;  1WGT A;  1AN1 I;  4L9M A;  3UEJ A;  2QQE A;  2L8E A;  1IY6 A;  2JW6 A;  2NU4 I;  5JHW C;  2V1C A;  1YU6 C;  2JZM A;  1K7U A;  2KMR A;  3QWP A;  1UVF A;  3QAH A;  1SGR I;  5DAE A;  1HJA I;  2JA1 A;  2KMP A;  3FSY A;  4UXI A;  1RFH A;  2SGD I;  3E59 A;  1PTR A;  3OVO A;  3VDP A;  1U5K A;  2SGP I;  2QQD A;  1WTJ A;  1Y1C A;  2GVI A;  3FC3 A;  1ULN A;  2N52 A;  1SGQ I;  2YQP A;  1IY5 A;  2DIP A;  4HGU A;  1P9Z A;  2DB6 A;  3UGL A;  1WGC A;  1FAQ A;  3R5C A;  1ULM A;  2QPO A;  1FY7 A;  2GKR I;  3QTL D;  5EX0 A;  1CT4 I;  9WGA A;  3PDN A;  1CGI I;  2J9R A;  2RIJ A;  3R5D A;  1X74 A;  3KY9 A;  2LEO A;  1BMO A;  4OVO A;  1IW4 A;  5FUX A;  1HEV A;  2B0U C;  1FAR A;  1OYV I;  2E73 A;  2PQ8 A;  2Y0M A;  1CSO I;  2B8T A;  3B4V C;  1WKX A;  2BUS A;  1M8B A;  1OMU A;  2NU2 I;  2YUU A;  1FYB A;  1SGP I;  2ENN A;  5EX3 A;  1SGE I;  5HI7 A;  3OXF A;  2ELI A;  1V1I A;  2CWG A;  1TBQ R;  1TGS I;  3UOE A;  5FUW A;  2F3C I;  2L7X A;  3R5A A;  1CT2 I;  1SGD I;  1NUB A;  2JYY A;  1LR7 A;  1NXU A;  1Z7K B;  2NU1 I;  5FUY A;  3VE5 A;  1PJU A;  2M5X A;  4FKD A;  1CGJ I;  1XA6 A;  2OZU A;  1Y1B A;  1MJB A;  2UVO A;  2CWH A;  3OL0 A;  5CCL A;  2VRW B;  2XRC A;  3UFF A;  4DNC A;  1TBO A;  1W3S A;  2K9H A;  1PTQ A;  2GIV A;  2SGQ I;  5FUV A;  1N13 A;  2ODD A;  4AML A;  2ERW A;  1P9G A;  1V1H A;  1Y8F A;  1MJA A;  2ENZ A;  2ROW A;  1OVO A;  1R79 A;  1TOT A;  2X3T A;  1BUS A;  2CWF A;  5CCM A;  3TO6 A;  3UGD A;  1KMA A;  3SGB I;  1CE3 A;  2KCX A;  1OMT A;  2X52 A;  1KBF A;  2OVO A;  1HPT A;  1HDL A;  1X4S A;  3HH2 C;  1UUC A;  1LR9 A;  1Z2I A;  1DS3 I;  4WP4 A;  3OXG A;  1S20 A;  2P6A C;  1VDD A; 
#chains in the Genus database with same CATH homology
 2N1A B;  1R0R I;  1XBT A;  1DS2 I;  2SGF I;  1M8C A;  1SGN I;  4E1P A;  1LR8 A;  3CXL A;  1YTP A;  3D00 A;  2J87 A;  2A20 A;  2ORW A;  2LUY A;  4SGB I;  1MT1 A;  2V53 A;  4B6D A;  2GKT I;  2CJS C;  4E1R A;  5HQ8 A;  3E2I A;  3BJI A;  2NU3 I;  1W4R A;  3GOX A;  2SGE I;  4GI3 C;  2NU0 I;  2ARP F;  2W0T A;  1UVG A;  2KMO A;  2JXD A;  2OD1 A;  2QQ0 A;  3MEK A;  1H0Z A;  3VDU A;  4JCV E;  4UXJ A;  3UEY A;  2WVJ A;  1PCE A;  1TUS A;  2E5R A;  4UXH A;  2UZ3 A;  1SGY I;  1CT0 I;  1TIH A;  2V1C C;  1TBR R;  3SEK C;  1XX6 A;  2GKV A;  1PPF I;  2WCY A;  3TJQ A;  2N71 A;  2FNF X;  2QQC A;  4A24 A;  3RU0 A;  3UGI A;  1TBN A;  1CHO I;  2KMQ A;  2ORV A;  3SGQ I;  2N17 A;  1KBE A;  1TUR A;  3OXL A;  4L9M A;  1AN1 I;  3UEJ A;  2QQE A;  2L8E A;  1IY6 A;  2JW6 A;  2NU4 I;  5JHW C;  2V1C A;  1YU6 C;  2JZM A;  2KMR A;  3QWP A;  1UVF A;  1SGR I;  5DAE A;  1HJA I;  2JA1 A;  2KMP A;  4UXI A;  1RFH A;  2SGD I;  3OVO A;  1PTR A;  3VDP A;  1U5K A;  2SGP I;  2QQD A;  1Y1C A;  2GVI A;  3FC3 A;  2N52 A;  1SGQ I;  2YQP A;  1IY5 A;  2DIP A;  4HGU A;  2DB6 A;  3UGL A;  1FAQ A;  2QPO A;  3QTL D;  5EX0 A;  2GKR I;  1CT4 I;  3PDN A;  1CGI I;  2J9R A;  1X74 A;  3KY9 A;  2LEO A;  1BMO A;  4OVO A;  1IW4 A;  5FUX A;  2B0U C;  1FAR A;  1OYV I;  2E73 A;  3B4V C;  1CSO I;  2B8T A;  2BUS A;  2YUU A;  1M8B A;  1OMU A;  2NU2 I;  1FYB A;  1SGP I;  2ENN A;  5EX3 A;  1SGE I;  5HI7 A;  3OXF A;  2ELI A;  1V1I A;  1TBQ R;  1TGS I;  5FUW A;  2F3C I;  2L7X A;  1CT2 I;  1SGD I;  1NUB A;  2JYY A;  1LR7 A;  2NU1 I;  1Z7K B;  5FUY A;  3VE5 A;  1PJU A;  2M5X A;  4FKD A;  1CGJ I;  1XA6 A;  1Y1B A;  3OL0 A;  5CCL A;  2VRW B;  2XRC A;  3UFF A;  1TBO A;  1W3S A;  2K9H A;  1PTQ A;  2SGQ I;  5FUV A;  1N13 A;  2ODD A;  2ERW A;  1V1H A;  3E59 A;  1Y8F A;  2ENZ A;  2ROW A;  1OVO A;  1R79 A;  1TOT A;  1BUS A;  5CCM A;  3UGD A;  1KMA A;  3SGB I;  1CE3 A;  2KCX A;  1OMT A;  1KBF A;  2OVO A;  1HPT A;  1HDL A;  1X4S A;  3HH2 C;  1UUC A;  1LR9 A;  1DS3 I;  3OXG A;  2P6A C;  1VDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...