2SGPI

Pro 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 6.5
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTPEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/inhibitor
molecule keywords PROTEINASE B
publication title Contribution of peptide bonds to inhibitor-protease binding: crystal structures of the turkey ovomucoid third domain backbone variants OMTKY3-Pro18I and OMTKY3-psi[COO]-Leu18I in complex with Streptomyces griseus proteinase B (SGPB) and the structure of the free inhibitor, OMTKY-3-psi[CH2NH2+]-Asp19I
pubmed doi rcsb
source organism Meleagris gallopavo
total genus 11
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2sgpI00
2BUSA 1OMUA 2B0UC 2JZMA 1TIHA 2V53A 1TBRR 2GKVA 2NU2I 4OVOA 1UUCA 1OYVI 1BUSA 1MT1A 1SGQI 3SEKC 1SGYI 1Z7KB 2NU3I 3QTLD 1Y1BA 1AN1I 1HPTA 2KMRA 1SGNI 2F3CI 1IY6A 1CSOI 1M8CA 1OMTA 4SGBI 2N17A 1SGDI 2P6AC 3SGBI 1UVFA 1TBQR 5DAEA 1Y1CA 4GI3C 1IW4A 2GKTI 2OVOA 3TJQA 1HJAI 2JYYA 2NU1I 1CT0I 1YU6C 2WCYA 1BMOA 1CGII 4HGUA 2XRCA 2JXDA 1KMAA 3SGQI 1SGPI 1SGRI 1HDLA 1PPFI 1IY5A 1CE3A 3OVOA 3HH2C 2QQCA 2KMOA 1DS3I 1N13A 2SGQI 1R0RI 2M5XA 1TGSI 1LR7A 1TUSA 2KMPA 2SGPI 1SGEI 5JHWC 1CGJI 2NU4I 1UVGA 2QQDA 2SGDI 2ERWA 2SGEI 2GKRI 2N71A 1M8BA 2ARPF 1TURA 1PCEA 1CT4I 1FYBA 2SGFI 1H0ZA 2NU0I 1LR8A 1PJUA 3B4VC 2KMQA 1YTPA 1NUBA 1CHOI 1LR9A 1OVOA 2N52A 2LEOA 1CT2I 1DS2I 2KCXA
chains in the Genus database with same CATH superfamily
2OZUA 2BUSA 1V1IA 2L7XA 3UGLA 1OMUA 1ULMA 2B0UC 2ODDA 2JZMA 1TBOA 1TIHA 2J87A 2OD1A 1TBRR 2V53A 4B6DA 2JW6A 1XX6A 2QQEA 1WGTA 1V1HA 1K7UA 1WGCA 2GKVA 2NU2I 4OVOA 1UUCA 1OYVI 1BUSA 1MT1A 1SGQI 2ENZA 3SEKC 2QPOA 3FSYA 1PTQA 5J8FA 1Y8FA 1SGYI 2DIPA 3OXLA 2YQPA 1Z7KB 1PTRA 2NU3I 3D00A 3QTLD 4AMLA 4JCVE 1Y1BA 1AN1I 1HPTA 2KMRA 1SGNI 2PQ8A 3FSXA 3FC3A 1R79A 1UHAA 2F3CI 1CSOI 3UGIA 1IY6A 5E3RA 1M8CA 1Q9BA 1OMTA 4SGBI 2N17A 2E5RA 3E59A 1SGDI 4FKDA 2P6AC 3R5DA 3SGBI 3UFFA 1UVFA 1WTJA 1TBQR 5DAEA 1Y1CA 4GI3C 3TO6A 1XA6A 1IW4A 2E73A 2J9RA 5CCMA 2GKTI 2OVOA 3TJQA 3TOAA 7WGAA 3UGDA 1HJAI 2JYYA 3TOBA 2RIJA 2NU1I 1CT0I 4A24A 3OL0A 1YU6C 1MJBA 2WCYA 3CXLA 1BMOA 2K9HA 1CGII 4WP4A 4HGUA 2XRCA 2JXDA 2UZ3A 5E3QA 1K7VA 1KMAA 3SGQI 2CJSC 1SGPI 3UOEA 2ROWA 3QWPA 3R5AA 1SGRI 2CWGA 1HDLA 2LUYA 4DNCA 1PPFI 4UXHA 1TOTA 2ENNA 1W4RA 2YUUA 3OXGA 3TO9A 3VDPA 5CCLA 5HQ8A 3OVOA 1FARA 1IY5A 1CE3A 3HH2C 2QQCA 2V1CC 2LB7A 1ULNA 2KMOA 1DS3I 2ORWA 3R5BA 1Z2IA 2A20A 2RC4A 1N13A 1KBEA 4UXIA 2SGQI 1ULKA 1FY7A 2GIVA 3KY9A 1P9ZA 2ELIA 1R0RI 2M5XA 1TGSI 1LR7A 1TUSA 1U5KA 2KMPA 2SGPI 1XBTA 2JA1A 2OU2A 2QQ0A 2DB6A 2KCXA 5FUWA 1HEVA 5J8CA 5FUXA 2UVOA 3RU0A 1P9GA 3VDUA 1SGEI 2GVIA 1CGJI 5JHWC 1KBFA 5FUYA 2NU4I 1X74A 2WVJA 5E3PA 1UVGA 2QQDA 2SGDI 2VRWB 3OXFA 3TO7A 4UXJA 2CWFA 2V1CA 2ERWA 2SGEI 3QAHA 4L9MA 4E1PA 1VDDA 2GKRI 3UEJA 2N71A 1S20A 3UEYA 3E2IA 1M8BA 3PDNA 2ARPF 2X3TA 1TURA 1PCEA 2FNFX 1CT4I 3GOXA 1X4SA 2CWHA 1FYBA 2SGFI 1H0ZA 1MJ9A 3BJIA 2NU0I 1LR8A 1PJUA 1K7TA 1TBNA 2X52A 2Y0MA 3B4VC 2DKVA 2KMQA 3VE5A 1RFHA 1YTPA 1WKXA 1NUBA 5EX3A 1W3SA 1CHOI 1LR9A 5FUVA 2WGCA 1OVOA 2N1AB 3MEKA 9WGAA 1NXUA 2W0TA 3R5CA 2N52A 5EX0A 5HI7A 2B8TA 2LEOA 1CT2I 4MPIA 1FAQA 1DS2I 4E1RA 1MJAA 2L8EA 2ORVA
chains in the Genus database with same CATH topology
2BUSA 1V1IA 2L7XA 3UGLA 1OMUA 2B0UC 2ODDA 2JZMA 1TBOA 1TIHA 2J87A 2OD1A 1TBRR 2V53A 4B6DA 2JW6A 1XX6A 2QQEA 1V1HA 2GKVA 2NU2I 4OVOA 1UUCA 1OYVI 1BUSA 1MT1A 1SGQI 2ENZA 3SEKC 2QPOA 1PTQA 1Y8FA 1SGYI 2DIPA 3OXLA 2YQPA 1Z7KB 1PTRA 2NU3I 3D00A 3QTLD 4JCVE 1Y1BA 1AN1I 1HPTA 2KMRA 1SGNI 3FC3A 1R79A 2F3CI 3UGIA 1CSOI 1IY6A 1M8CA 1OMTA 4SGBI 2N17A 2E5RA 3E59A 1SGDI 4FKDA 2P6AC 3UFFA 3SGBI 1UVFA 1TBQR 5DAEA 1Y1CA 4GI3C 1IW4A 1XA6A 2E73A 2J9RA 5CCMA 2GKTI 2OVOA 3TJQA 3UGDA 1HJAI 2JYYA 2NU1I 1CT0I 4A24A 3OL0A 1YU6C 2WCYA 3CXLA 1BMOA 2K9HA 1CGII 4HGUA 2XRCA 2JXDA 2UZ3A 1KMAA 3SGQI 2CJSC 1SGPI 2ROWA 3QWPA 1SGRI 1HDLA 2LUYA 1PPFI 4UXHA 1TOTA 2ENNA 1W4RA 2YUUA 3OXGA 3VDPA 5CCLA 5HQ8A 1IY5A 3OVOA 1FARA 1CE3A 3HH2C 2QQCA 2V1CC 2KMOA 1DS3I 2ORWA 2A20A 1N13A 1KBEA 4UXIA 2SGQI 3KY9A 2ELIA 1R0RI 2M5XA 1TGSI 1LR7A 1TUSA 1U5KA 2KMPA 2SGPI 1XBTA 2JA1A 2QQ0A 2DB6A 5FUWA 5FUXA 3RU0A 3VDUA 1SGEI 2GVIA 1CGJI 5JHWC 1KBFA 5FUYA 2NU4I 1X74A 2WVJA 1UVGA 2QQDA 2SGDI 2VRWB 3OXFA 4UXJA 2V1CA 2ERWA 2SGEI 4L9MA 4E1PA 1VDDA 2GKRI 3UEJA 2N71A 3UEYA 3E2IA 1M8BA 3PDNA 2ARPF 1TURA 1PCEA 2FNFX 1CT4I 3GOXA 1X4SA 1FYBA 2SGFI 1H0ZA 3BJIA 2NU0I 1LR8A 1PJUA 1TBNA 3B4VC 2KMQA 3VE5A 1RFHA 1YTPA 5EX3A 1NUBA 1W3SA 1CHOI 1LR9A 5FUVA 1OVOA 2N1AB 3MEKA 2W0TA 2N52A 5EX0A 5HI7A 2B8TA 2LEOA 1CT2I 1FAQA 1DS2I 4E1RA 2KCXA 2L8EA 2ORVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BUS A;  1OMU A;  2B0U C;  2JZM A;  1TIH A;  2V53 A;  1TBR R;  2GKV A;  2NU2 I;  4OVO A;  1UUC A;  1OYV I;  1BUS A;  1MT1 A;  1SGQ I;  3SEK C;  1SGY I;  1Z7K B;  2NU3 I;  3QTL D;  1Y1B A;  1AN1 I;  1HPT A;  2KMR A;  1SGN I;  2F3C I;  1IY6 A;  1CSO I;  1M8C A;  1OMT A;  4SGB I;  2N17 A;  1SGD I;  2P6A C;  3SGB I;  1UVF A;  1TBQ R;  5DAE A;  1Y1C A;  4GI3 C;  1IW4 A;  2GKT I;  2OVO A;  3TJQ A;  1HJA I;  2JYY A;  2NU1 I;  1CT0 I;  1YU6 C;  2WCY A;  1BMO A;  1CGI I;  4HGU A;  2XRC A;  2JXD A;  1KMA A;  3SGQ I;  1SGP I;  1SGR I;  1HDL A;  1PPF I;  1IY5 A;  1CE3 A;  3OVO A;  3HH2 C;  2QQC A;  2KMO A;  1DS3 I;  1N13 A;  2SGQ I;  1R0R I;  2M5X A;  1TGS I;  1LR7 A;  1TUS A;  2KMP A;  2SGP I;  1SGE I;  5JHW C;  1CGJ I;  2NU4 I;  1UVG A;  2QQD A;  2SGD I;  2ERW A;  2SGE I;  2GKR I;  2N71 A;  1M8B A;  2ARP F;  1TUR A;  1PCE A;  1CT4 I;  1FYB A;  2SGF I;  1H0Z A;  2NU0 I;  1LR8 A;  1PJU A;  3B4V C;  2KMQ A;  1YTP A;  1NUB A;  1CHO I;  1LR9 A;  1OVO A;  2N52 A;  2LEO A;  1CT2 I;  1DS2 I;  2KCX A; 
#chains in the Genus database with same CATH topology
 2OZU A;  2BUS A;  1V1I A;  2L7X A;  3UGL A;  1OMU A;  1ULM A;  2B0U C;  2ODD A;  2JZM A;  1TBO A;  1TIH A;  2J87 A;  2OD1 A;  1TBR R;  2V53 A;  4B6D A;  2JW6 A;  1XX6 A;  2QQE A;  1WGT A;  1V1H A;  1K7U A;  1WGC A;  2GKV A;  2NU2 I;  4OVO A;  1UUC A;  1OYV I;  1BUS A;  1MT1 A;  1SGQ I;  2ENZ A;  3SEK C;  2QPO A;  3FSY A;  1PTQ A;  5J8F A;  1Y8F A;  1SGY I;  2DIP A;  3OXL A;  2YQP A;  1Z7K B;  1PTR A;  2NU3 I;  3D00 A;  3QTL D;  4AML A;  4JCV E;  1Y1B A;  1AN1 I;  1HPT A;  2KMR A;  1SGN I;  2PQ8 A;  3FSX A;  3FC3 A;  1R79 A;  1UHA A;  2F3C I;  1CSO I;  3UGI A;  1IY6 A;  5E3R A;  1M8C A;  1Q9B A;  1OMT A;  4SGB I;  2N17 A;  2E5R A;  3E59 A;  1SGD I;  4FKD A;  2P6A C;  3R5D A;  3SGB I;  3UFF A;  1UVF A;  1WTJ A;  1TBQ R;  5DAE A;  1Y1C A;  4GI3 C;  3TO6 A;  1XA6 A;  1IW4 A;  2E73 A;  2J9R A;  5CCM A;  2GKT I;  2OVO A;  3TJQ A;  3TOA A;  7WGA A;  3UGD A;  1HJA I;  2JYY A;  3TOB A;  2RIJ A;  2NU1 I;  1CT0 I;  4A24 A;  3OL0 A;  1YU6 C;  1MJB A;  2WCY A;  3CXL A;  1BMO A;  2K9H A;  1CGI I;  4WP4 A;  4HGU A;  2XRC A;  2JXD A;  2UZ3 A;  5E3Q A;  1K7V A;  1KMA A;  3SGQ I;  2CJS C;  1SGP I;  3UOE A;  2ROW A;  3QWP A;  3R5A A;  1SGR I;  2CWG A;  1HDL A;  2LUY A;  4DNC A;  1PPF I;  4UXH A;  1TOT A;  2ENN A;  1W4R A;  2YUU A;  3OXG A;  3TO9 A;  3VDP A;  5CCL A;  5HQ8 A;  3OVO A;  1FAR A;  1IY5 A;  1CE3 A;  3HH2 C;  2QQC A;  2V1C C;  2LB7 A;  1ULN A;  2KMO A;  1DS3 I;  2ORW A;  3R5B A;  1Z2I A;  2A20 A;  2RC4 A;  1N13 A;  1KBE A;  4UXI A;  2SGQ I;  1ULK A;  1FY7 A;  2GIV A;  3KY9 A;  1P9Z A;  2ELI A;  1R0R I;  2M5X A;  1TGS I;  1LR7 A;  1TUS A;  1U5K A;  2KMP A;  2SGP I;  1XBT A;  2JA1 A;  2OU2 A;  2QQ0 A;  2DB6 A;  2KCX A;  5FUW A;  1HEV A;  5J8C A;  5FUX A;  2UVO A;  3RU0 A;  1P9G A;  3VDU A;  1SGE I;  2GVI A;  1CGJ I;  5JHW C;  1KBF A;  5FUY A;  2NU4 I;  1X74 A;  2WVJ A;  5E3P A;  1UVG A;  2QQD A;  2SGD I;  2VRW B;  3OXF A;  3TO7 A;  4UXJ A;  2CWF A;  2V1C A;  2ERW A;  2SGE I;  3QAH A;  4L9M A;  4E1P A;  1VDD A;  2GKR I;  3UEJ A;  2N71 A;  1S20 A;  3UEY A;  3E2I A;  1M8B A;  3PDN A;  2ARP F;  2X3T A;  1TUR A;  1PCE A;  2FNF X;  1CT4 I;  3GOX A;  1X4S A;  2CWH A;  1FYB A;  2SGF I;  1H0Z A;  1MJ9 A;  3BJI A;  2NU0 I;  1LR8 A;  1PJU A;  1K7T A;  1TBN A;  2X52 A;  2Y0M A;  3B4V C;  2DKV A;  2KMQ A;  3VE5 A;  1RFH A;  1YTP A;  1WKX A;  1NUB A;  5EX3 A;  1W3S A;  1CHO I;  1LR9 A;  5FUV A;  2WGC A;  1OVO A;  2N1A B;  3MEK A;  9WGA A;  1NXU A;  2W0T A;  3R5C A;  2N52 A;  5EX0 A;  5HI7 A;  2B8T A;  2LEO A;  1CT2 I;  4MPI A;  1FAQ A;  1DS2 I;  4E1R A;  1MJA A;  2L8E A;  2ORV A; 
#chains in the Genus database with same CATH homology
 2BUS A;  1V1I A;  2L7X A;  3UGL A;  1OMU A;  2B0U C;  2ODD A;  2JZM A;  1TBO A;  1TIH A;  2J87 A;  2OD1 A;  1TBR R;  2V53 A;  4B6D A;  2JW6 A;  1XX6 A;  2QQE A;  1V1H A;  2GKV A;  2NU2 I;  4OVO A;  1UUC A;  1OYV I;  1BUS A;  1MT1 A;  1SGQ I;  2ENZ A;  3SEK C;  2QPO A;  1PTQ A;  1Y8F A;  1SGY I;  2DIP A;  3OXL A;  2YQP A;  1Z7K B;  1PTR A;  2NU3 I;  3D00 A;  3QTL D;  4JCV E;  1Y1B A;  1AN1 I;  1HPT A;  2KMR A;  1SGN I;  3FC3 A;  1R79 A;  2F3C I;  3UGI A;  1CSO I;  1IY6 A;  1M8C A;  1OMT A;  4SGB I;  2N17 A;  2E5R A;  3E59 A;  1SGD I;  4FKD A;  2P6A C;  3UFF A;  3SGB I;  1UVF A;  1TBQ R;  5DAE A;  1Y1C A;  4GI3 C;  1IW4 A;  1XA6 A;  2E73 A;  2J9R A;  5CCM A;  2GKT I;  2OVO A;  3TJQ A;  3UGD A;  1HJA I;  2JYY A;  2NU1 I;  1CT0 I;  4A24 A;  3OL0 A;  1YU6 C;  2WCY A;  3CXL A;  1BMO A;  2K9H A;  1CGI I;  4HGU A;  2XRC A;  2JXD A;  2UZ3 A;  1KMA A;  3SGQ I;  2CJS C;  1SGP I;  2ROW A;  3QWP A;  1SGR I;  1HDL A;  2LUY A;  1PPF I;  4UXH A;  1TOT A;  2ENN A;  1W4R A;  2YUU A;  3OXG A;  3VDP A;  5CCL A;  5HQ8 A;  1IY5 A;  3OVO A;  1FAR A;  1CE3 A;  3HH2 C;  2QQC A;  2V1C C;  2KMO A;  1DS3 I;  2ORW A;  2A20 A;  1N13 A;  1KBE A;  4UXI A;  2SGQ I;  3KY9 A;  2ELI A;  1R0R I;  2M5X A;  1TGS I;  1LR7 A;  1TUS A;  1U5K A;  2KMP A;  2SGP I;  1XBT A;  2JA1 A;  2QQ0 A;  2DB6 A;  5FUW A;  5FUX A;  3RU0 A;  3VDU A;  1SGE I;  2GVI A;  1CGJ I;  5JHW C;  1KBF A;  5FUY A;  2NU4 I;  1X74 A;  2WVJ A;  1UVG A;  2QQD A;  2SGD I;  2VRW B;  3OXF A;  4UXJ A;  2V1C A;  2ERW A;  2SGE I;  4L9M A;  4E1P A;  1VDD A;  2GKR I;  3UEJ A;  2N71 A;  3UEY A;  3E2I A;  1M8B A;  3PDN A;  2ARP F;  1TUR A;  1PCE A;  2FNF X;  1CT4 I;  3GOX A;  1X4S A;  1FYB A;  2SGF I;  1H0Z A;  3BJI A;  2NU0 I;  1LR8 A;  1PJU A;  1TBN A;  3B4V C;  2KMQ A;  3VE5 A;  1RFH A;  1YTP A;  5EX3 A;  1NUB A;  1W3S A;  1CHO I;  1LR9 A;  5FUV A;  1OVO A;  2N1A B;  3MEK A;  2W0T A;  2N52 A;  5EX0 A;  5HI7 A;  2B8T A;  2LEO A;  1CT2 I;  1FAQ A;  1DS2 I;  4E1R A;  2KCX A;  2L8E A;  2ORV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...