2SGQI

Gln 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 6.5
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTQEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pH's
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2sgqI00
1CT2I 2JYYA 1SGQI 1CSOI 2KMQA 1HDLA 2NU4I 1R0RI 2NU1I 1NUBA 2GKVA 1YTPA 1PJUA 3B4VC 3TJQA 1IW4A 2SGDI 1OVOA 4HGUA 1OMTA 1UVFA 1TUSA 3OVOA 3SGQI 1OYVI 1DS2I 1IY5A 2NU3I 2NU2I 2XRCA 1CGJI 2JXDA 1FYBA 1CT4I 4OVOA 1CT0I 2N52A 2JZMA 4GI3C 1M8BA 2KMOA 1Y1CA 2ARPF 2SGFI 1UUCA 2QQCA 1LR8A 5DAEA 1LR7A 1BUSA 1KMAA 1H0ZA 1MT1A 4SGBI 2M5XA 1SGNI 2SGPI 1TIHA 1SGDI 1TBQR 1Z7KB 1DS3I 1SGEI 1TGSI 1SGYI 2V53A 3SEKC 3QTLD 1SGRI 2SGEI 1TBRR 5JHWC 1HJAI 2KCXA 1YU6C 2KMPA 3HH2C 2NU0I 2BUSA 1PCEA 1CGII 1BMOA 2KMRA 2OVOA 2GKRI 1PPFI 2LEOA 1SGPI 1LR9A 1OMUA 2N17A 1CE3A 2QQDA 1UVGA 1AN1I 2ERWA 2SGQI 1Y1BA 1TURA 1IY6A 1CHOI 2B0UC 2F3CI 2GKTI 2N71A 2WCYA 1M8CA 2P6AC 3SGBI 1HPTA 1N13A
chains in the Genus database with same CATH superfamily
1CT2I 2JYYA 4MPIA 4E1RA 1SGQI 2X52A 2J87A 3UFFA 3MEKA 2YUUA 1WGTA 2ENZA 1CSOI 1ULNA 2B8TA 2KMQA 1WGCA 2L7XA 1KBEA 5FUVA 4AMLA 2NU4I 5EX3A 1HDLA 1R0RI 2WGCA 2NU1I 1FAQA 3UGIA 1FARA 5HQ8A 3UGLA 4E1PA 1NUBA 1S20A 2GKVA 1YTPA 1PJUA 3BJIA 1P9ZA 3B4VC 3TJQA 2SGDI 1OVOA 1TBOA 2DIPA 2ENNA 4HGUA 1OMTA 3TO6A 4DNCA 2V1CA 3R5BA 1UVFA 1TUSA 2ROWA 4L9MA 3VDPA 2LB7A 2RIJA 2OU2A 3FC3A 1X74A 3OVOA 2WVJA 5FUYA 3SGQI 1HEVA 2L8EA 1UHAA 1OYVI 1DS2I 3GOXA 2JW6A 1IY5A 2E5RA 2JA1A 2NU3I 1W3SA 2A20A 5FUWA 3PDNA 2K9HA 2NU2I 2XRCA 3E59A 3OXGA 1CGJI 1TBNA 2JXDA 1FYBA 1RFHA 2J9RA 2CWFA 3UOEA 1CT4I 4OVOA 1CT0I 2QQ0A 2VRWB 1XA6A 2DKVA 2N52A 3OXLA 1K7TA 2X3TA 2JZMA 2Y0MA 3E2IA 4GI3C 1M8BA 2KMOA 1KBFA 3FSYA 2UVOA 3VDUA 1PTRA 2N1AB 1Y1CA 3UEYA 2ARPF 4B6DA 2QQEA 2OD1A 2LUYA 1VDDA 2ORVA 2SGFI 2FNFX 1UUCA 2QQCA 1LR8A 2GVIA 1LR7A 5DAEA 5J8CA 1BUSA 1KMAA 1H0ZA 1K7UA 2ELIA 3R5AA 2DB6A 1MT1A 1R79A 4SGBI 2M5XA 9WGAA 1IW4A 5HI7A 7WGAA 5E3QA 1SGNI 2SGPI 1TIHA 3OL0A 1SGDI 1TBQR 3UEJA 3QAHA 1Z7KB 3R5DA 4UXJA 4WP4A 2ODDA 1K7VA 1DS3I 1V1HA 1TOTA 1SGEI 1TGSI 3KY9A 3TOBA 1WKXA 1SGYI 5CCLA 2V53A 3SEKC 1XX6A 1P9GA 4UXIA 2YQPA 3QTLD 3QWPA 1SGRI 4A24A 2CJSC 2SGEI 5E3PA 1TBRR 5JHWC 2W0TA 2CWHA 3OXFA 1HJAI 2KCXA 1XBTA 1FY7A 1V1IA 1YU6C 3CXLA 2KMPA 3HH2C 1WTJA 2BUSA 2NU0I 1PCEA 1CGII 1BMOA 2KMRA 1MJAA 3UGDA 2OVOA 1MJBA 1Q9BA 2GKRI 1PPFI 2LEOA 1SGPI 3FSXA 2V1CC 3R5CA 5CCMA 4FKDA 1MJ9A 1LR9A 1W4RA 1OMUA 1X4SA 2N17A 2UZ3A 5E3RA 5FUXA 2PQ8A 2QQDA 1CE3A 2ORWA 1UVGA 1AN1I 2ERWA 2SGQI 1PTQA 3TO7A 3TO9A 1Y1BA 2E73A 1TURA 1Y8FA 4JCVE 3VE5A 1ULMA 2QPOA 3TOAA 1IY6A 1CHOI 1NXUA 4UXHA 2B0UC 2F3CI 2GKTI 2N71A 3D00A 2WCYA 2GIVA 1M8CA 2P6AC 2CWGA 2RC4A 5EX0A 3RU0A 3SGBI 1HPTA 1Z2IA 1ULKA 1U5KA 5J8FA 2OZUA 1N13A
chains in the Genus database with same CATH topology
1CT2I 2JYYA 4E1RA 1SGQI 2J87A 3UFFA 3MEKA 2YUUA 2ENZA 1CSOI 2B8TA 2KMQA 2L7XA 5FUVA 1KBEA 1HDLA 2NU4I 5EX3A 1R0RI 2NU1I 1FAQA 3UGIA 1FARA 5HQ8A 3UGLA 4E1PA 1NUBA 2GKVA 3BJIA 1YTPA 1PJUA 3FC3A 3B4VC 3TJQA 4B6DA 2SGDI 1OVOA 1TBOA 2DIPA 2ENNA 4HGUA 1OMTA 1IW4A 2V1CA 1UVFA 1TUSA 2ROWA 4L9MA 3VDPA 1X74A 3OVOA 2WVJA 5FUYA 3SGQI 2L8EA 1OYVI 1DS2I 3GOXA 2JW6A 1IY5A 2E5RA 2JA1A 2NU3I 1W3SA 2A20A 5FUWA 3PDNA 2K9HA 2NU2I 2XRCA 3E59A 3OXGA 1CGJI 1TBNA 2JXDA 1FYBA 1RFHA 2J9RA 1CT4I 4OVOA 1CT0I 2QQ0A 2VRWB 1XA6A 2N52A 3OXLA 2JZMA 3E2IA 4GI3C 1M8BA 2KMOA 1KBFA 3VDUA 1PTRA 2N1AB 1Y1CA 3UEYA 2ARPF 2QQEA 2OD1A 2LUYA 1VDDA 2ORVA 2SGFI 2FNFX 1UUCA 2QQCA 1LR8A 2GVIA 1LR7A 5DAEA 1BUSA 1KMAA 1H0ZA 2ELIA 2DB6A 1MT1A 1R79A 4SGBI 2M5XA 5HI7A 1SGNI 2SGPI 1TIHA 3OL0A 1SGDI 1TBQR 3UEJA 1Z7KB 4UXJA 2ODDA 1DS3I 1V1HA 1TOTA 1SGEI 1TGSI 3KY9A 1SGYI 5CCLA 2V53A 3SEKC 1XX6A 4UXIA 2YQPA 3QTLD 3QWPA 1SGRI 4A24A 2CJSC 2SGEI 1TBRR 5JHWC 2W0TA 3OXFA 1HJAI 2KCXA 1XBTA 1V1IA 1YU6C 3CXLA 2KMPA 3HH2C 2NU0I 2BUSA 1PCEA 1CGII 1BMOA 2KMRA 3UGDA 2OVOA 2GKRI 1PPFI 2LEOA 1SGPI 2V1CC 5CCMA 4FKDA 1LR9A 1W4RA 1OMUA 1X4SA 2N17A 2UZ3A 5FUXA 2QQDA 1CE3A 2ORWA 1UVGA 1AN1I 2ERWA 2SGQI 1PTQA 1Y1BA 2E73A 1TURA 1Y8FA 4JCVE 3VE5A 2QPOA 1IY6A 1CHOI 4UXHA 2B0UC 2F3CI 2GKTI 2N71A 3D00A 2WCYA 5EX0A 1M8CA 2P6AC 3RU0A 3SGBI 1HPTA 1U5KA 1N13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CT2 I;  2JYY A;  1SGQ I;  1CSO I;  2KMQ A;  1HDL A;  2NU4 I;  1R0R I;  2NU1 I;  1NUB A;  2GKV A;  1YTP A;  1PJU A;  3B4V C;  3TJQ A;  1IW4 A;  2SGD I;  1OVO A;  4HGU A;  1OMT A;  1UVF A;  1TUS A;  3OVO A;  3SGQ I;  1OYV I;  1DS2 I;  1IY5 A;  2NU3 I;  2NU2 I;  2XRC A;  1CGJ I;  2JXD A;  1FYB A;  1CT4 I;  4OVO A;  1CT0 I;  2N52 A;  2JZM A;  4GI3 C;  1M8B A;  2KMO A;  1Y1C A;  2ARP F;  2SGF I;  1UUC A;  2QQC A;  1LR8 A;  5DAE A;  1LR7 A;  1BUS A;  1KMA A;  1H0Z A;  1MT1 A;  4SGB I;  2M5X A;  1SGN I;  2SGP I;  1TIH A;  1SGD I;  1TBQ R;  1Z7K B;  1DS3 I;  1SGE I;  1TGS I;  1SGY I;  2V53 A;  3SEK C;  3QTL D;  1SGR I;  2SGE I;  1TBR R;  5JHW C;  1HJA I;  2KCX A;  1YU6 C;  2KMP A;  3HH2 C;  2NU0 I;  2BUS A;  1PCE A;  1CGI I;  1BMO A;  2KMR A;  2OVO A;  2GKR I;  1PPF I;  2LEO A;  1SGP I;  1LR9 A;  1OMU A;  2N17 A;  1CE3 A;  2QQD A;  1UVG A;  1AN1 I;  2ERW A;  2SGQ I;  1Y1B A;  1TUR A;  1IY6 A;  1CHO I;  2B0U C;  2F3C I;  2GKT I;  2N71 A;  2WCY A;  1M8C A;  2P6A C;  3SGB I;  1HPT A;  1N13 A; 
#chains in the Genus database with same CATH topology
 1CT2 I;  2JYY A;  4MPI A;  4E1R A;  1SGQ I;  2X52 A;  2J87 A;  3UFF A;  3MEK A;  2YUU A;  1WGT A;  2ENZ A;  1CSO I;  1ULN A;  2B8T A;  2KMQ A;  1WGC A;  2L7X A;  1KBE A;  5FUV A;  4AML A;  2NU4 I;  5EX3 A;  1HDL A;  1R0R I;  2WGC A;  2NU1 I;  1FAQ A;  3UGI A;  1FAR A;  5HQ8 A;  3UGL A;  4E1P A;  1NUB A;  1S20 A;  2GKV A;  1YTP A;  1PJU A;  3BJI A;  1P9Z A;  3B4V C;  3TJQ A;  2SGD I;  1OVO A;  1TBO A;  2DIP A;  2ENN A;  4HGU A;  1OMT A;  3TO6 A;  4DNC A;  2V1C A;  3R5B A;  1UVF A;  1TUS A;  2ROW A;  4L9M A;  3VDP A;  2LB7 A;  2RIJ A;  2OU2 A;  3FC3 A;  1X74 A;  3OVO A;  2WVJ A;  5FUY A;  3SGQ I;  1HEV A;  2L8E A;  1UHA A;  1OYV I;  1DS2 I;  3GOX A;  2JW6 A;  1IY5 A;  2E5R A;  2JA1 A;  2NU3 I;  1W3S A;  2A20 A;  5FUW A;  3PDN A;  2K9H A;  2NU2 I;  2XRC A;  3E59 A;  3OXG A;  1CGJ I;  1TBN A;  2JXD A;  1FYB A;  1RFH A;  2J9R A;  2CWF A;  3UOE A;  1CT4 I;  4OVO A;  1CT0 I;  2QQ0 A;  2VRW B;  1XA6 A;  2DKV A;  2N52 A;  3OXL A;  1K7T A;  2X3T A;  2JZM A;  2Y0M A;  3E2I A;  4GI3 C;  1M8B A;  2KMO A;  1KBF A;  3FSY A;  2UVO A;  3VDU A;  1PTR A;  2N1A B;  1Y1C A;  3UEY A;  2ARP F;  4B6D A;  2QQE A;  2OD1 A;  2LUY A;  1VDD A;  2ORV A;  2SGF I;  2FNF X;  1UUC A;  2QQC A;  1LR8 A;  2GVI A;  1LR7 A;  5DAE A;  5J8C A;  1BUS A;  1KMA A;  1H0Z A;  1K7U A;  2ELI A;  3R5A A;  2DB6 A;  1MT1 A;  1R79 A;  4SGB I;  2M5X A;  9WGA A;  1IW4 A;  5HI7 A;  7WGA A;  5E3Q A;  1SGN I;  2SGP I;  1TIH A;  3OL0 A;  1SGD I;  1TBQ R;  3UEJ A;  3QAH A;  1Z7K B;  3R5D A;  4UXJ A;  4WP4 A;  2ODD A;  1K7V A;  1DS3 I;  1V1H A;  1TOT A;  1SGE I;  1TGS I;  3KY9 A;  3TOB A;  1WKX A;  1SGY I;  5CCL A;  2V53 A;  3SEK C;  1XX6 A;  1P9G A;  4UXI A;  2YQP A;  3QTL D;  3QWP A;  1SGR I;  4A24 A;  2CJS C;  2SGE I;  5E3P A;  1TBR R;  5JHW C;  2W0T A;  2CWH A;  3OXF A;  1HJA I;  2KCX A;  1XBT A;  1FY7 A;  1V1I A;  1YU6 C;  3CXL A;  2KMP A;  3HH2 C;  1WTJ A;  2BUS A;  2NU0 I;  1PCE A;  1CGI I;  1BMO A;  2KMR A;  1MJA A;  3UGD A;  2OVO A;  1MJB A;  1Q9B A;  2GKR I;  1PPF I;  2LEO A;  1SGP I;  3FSX A;  2V1C C;  3R5C A;  5CCM A;  4FKD A;  1MJ9 A;  1LR9 A;  1W4R A;  1OMU A;  1X4S A;  2N17 A;  2UZ3 A;  5E3R A;  5FUX A;  2PQ8 A;  2QQD A;  1CE3 A;  2ORW A;  1UVG A;  1AN1 I;  2ERW A;  2SGQ I;  1PTQ A;  3TO7 A;  3TO9 A;  1Y1B A;  2E73 A;  1TUR A;  1Y8F A;  4JCV E;  3VE5 A;  1ULM A;  2QPO A;  3TOA A;  1IY6 A;  1CHO I;  1NXU A;  4UXH A;  2B0U C;  2F3C I;  2GKT I;  2N71 A;  3D00 A;  2WCY A;  2GIV A;  1M8C A;  2P6A C;  2CWG A;  2RC4 A;  5EX0 A;  3RU0 A;  3SGB I;  1HPT A;  1Z2I A;  1ULK A;  1U5K A;  5J8F A;  2OZU A;  1N13 A; 
#chains in the Genus database with same CATH homology
 1CT2 I;  2JYY A;  4E1R A;  1SGQ I;  2J87 A;  3UFF A;  3MEK A;  2YUU A;  2ENZ A;  1CSO I;  2B8T A;  2KMQ A;  2L7X A;  5FUV A;  1KBE A;  1HDL A;  2NU4 I;  5EX3 A;  1R0R I;  2NU1 I;  1FAQ A;  3UGI A;  1FAR A;  5HQ8 A;  3UGL A;  4E1P A;  1NUB A;  2GKV A;  3BJI A;  1YTP A;  1PJU A;  3FC3 A;  3B4V C;  3TJQ A;  4B6D A;  2SGD I;  1OVO A;  1TBO A;  2DIP A;  2ENN A;  4HGU A;  1OMT A;  1IW4 A;  2V1C A;  1UVF A;  1TUS A;  2ROW A;  4L9M A;  3VDP A;  1X74 A;  3OVO A;  2WVJ A;  5FUY A;  3SGQ I;  2L8E A;  1OYV I;  1DS2 I;  3GOX A;  2JW6 A;  1IY5 A;  2E5R A;  2JA1 A;  2NU3 I;  1W3S A;  2A20 A;  5FUW A;  3PDN A;  2K9H A;  2NU2 I;  2XRC A;  3E59 A;  3OXG A;  1CGJ I;  1TBN A;  2JXD A;  1FYB A;  1RFH A;  2J9R A;  1CT4 I;  4OVO A;  1CT0 I;  2QQ0 A;  2VRW B;  1XA6 A;  2N52 A;  3OXL A;  2JZM A;  3E2I A;  4GI3 C;  1M8B A;  2KMO A;  1KBF A;  3VDU A;  1PTR A;  2N1A B;  1Y1C A;  3UEY A;  2ARP F;  2QQE A;  2OD1 A;  2LUY A;  1VDD A;  2ORV A;  2SGF I;  2FNF X;  1UUC A;  2QQC A;  1LR8 A;  2GVI A;  1LR7 A;  5DAE A;  1BUS A;  1KMA A;  1H0Z A;  2ELI A;  2DB6 A;  1MT1 A;  1R79 A;  4SGB I;  2M5X A;  5HI7 A;  1SGN I;  2SGP I;  1TIH A;  3OL0 A;  1SGD I;  1TBQ R;  3UEJ A;  1Z7K B;  4UXJ A;  2ODD A;  1DS3 I;  1V1H A;  1TOT A;  1SGE I;  1TGS I;  3KY9 A;  1SGY I;  5CCL A;  2V53 A;  3SEK C;  1XX6 A;  4UXI A;  2YQP A;  3QTL D;  3QWP A;  1SGR I;  4A24 A;  2CJS C;  2SGE I;  1TBR R;  5JHW C;  2W0T A;  3OXF A;  1HJA I;  2KCX A;  1XBT A;  1V1I A;  1YU6 C;  3CXL A;  2KMP A;  3HH2 C;  2NU0 I;  2BUS A;  1PCE A;  1CGI I;  1BMO A;  2KMR A;  3UGD A;  2OVO A;  2GKR I;  1PPF I;  2LEO A;  1SGP I;  2V1C C;  5CCM A;  4FKD A;  1LR9 A;  1W4R A;  1OMU A;  1X4S A;  2N17 A;  2UZ3 A;  5FUX A;  2QQD A;  1CE3 A;  2ORW A;  1UVG A;  1AN1 I;  2ERW A;  2SGQ I;  1PTQ A;  1Y1B A;  2E73 A;  1TUR A;  1Y8F A;  4JCV E;  3VE5 A;  2QPO A;  1IY6 A;  1CHO I;  4UXH A;  2B0U C;  2F3C I;  2GKT I;  2N71 A;  3D00 A;  2WCY A;  5EX0 A;  1M8C A;  2P6A C;  3RU0 A;  3SGB I;  1HPT A;  1U5K A;  1N13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...