2SGQI

Gln 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 6.5
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
b'VDCSEYPKPACTQEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pH's
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2sgqI00
2GKTI 1SGRI 1MT1A 1OMTA 1OVOA 3HH2C 2SGDI 1Y1BA 2JZMA 1PPFI 2XRCA 4SGBI 1SGYI 1CGII 2SGQI 2KMRA 1FYBA 1CT4I 2SGEI 1OMUA 1OYVI 1DS2I 1CT2I 3OVOA 1N13A 1M8BA 2N17A 3TJQA 1TBRR 1Y1CA 2ARPF 2NU3I 2OVOA 1UVFA 1LR9A 1PCEA 1NUBA 1YU6C 1HDLA 3B4VC 1SGNI 1SGEI 1H0ZA 1KMAA 3SGQI 2NU0I 2P6AC 2N71A 2KMOA 4HGUA 1Z7KB 2NU2I 2N52A 1LR8A 2KCXA 2QQCA 1CT0I 1TIHA 4GI3C 2SGFI 5JHWC 1CHOI 4OVOA 2JXDA 1SGDI 1R0RI 2BUSA 1TURA 1TGSI 1TUSA 2V53A 1LR7A 2GKRI 2LEOA 3QTLD 2SGPI 1DS3I 1CGJI 1PJUA 1M8CA 2GKVA 1SGPI 1HPTA 1UUCA 2M5XA 1TBQR 1AN1I 1IY6A 1IW4A 5DAEA 1CE3A 1HJAI 1YTPA 1UVGA 3SGBI 2F3CI 3SEKC 2JYYA 1IY5A 2B0UC 2WCYA 2KMQA 1CSOI 2NU1I 2KMPA 1BUSA 1SGQI 1BMOA 2QQDA 2NU4I 2ERWA
chains in the Genus database with same CATH superfamily
3TO7A 2RC4A 2GKTI 1SGRI 1MT1A 1OMTA 1OVOA 1X74A 3KY9A 2L7XA 3UFFA 3HH2C 2CWFA 2SGDI 1FY7A 5E3PA 1Y1BA 2JZMA 4JCVE 1PPFI 2XRCA 3TOBA 3MEKA 5E3RA 3UEYA 4SGBI 2DIPA 1SGYI 1CGII 2SGQI 3UGDA 2ELIA 2KMRA 2ODDA 5J8CA 3QAHA 1FYBA 2RIJA 1CT4I 4E1RA 2DKVA 2SGEI 1OMUA 1OYVI 1DS2I 2YQPA 2JA1A 3VE5A 2CWHA 3OL0A 4DNCA 1KBFA 1CT2I 1MJAA 5HQ8A 2WGCA 2X52A 4WP4A 3OVOA 1V1IA 1N13A 1M8BA 1R79A 1ULKA 1WGCA 2L8EA 2N17A 1TBRR 1TBNA 1Y1CA 2ARPF 1MJ9A 2CJSC 2NU3I 2OVOA 1UVFA 2X3TA 3CXLA 4AMLA 2ORWA 3OXLA 1P9GA 1LR9A 2YUUA 5HI7A 2A20A 1PCEA 1NUBA 7WGAA 1YU6C 1HDLA 3B4VC 5EX0A 1SGNI 1VDDA 2ENZA 1K7TA 2V1CC 2LUYA 2VRWB 1Z2IA 3E59A 5CCLA 1SGEI 1H0ZA 1KMAA 2OD1A 3SGQI 1ULMA 2ENNA 2NU0I 2P6AC 2PQ8A 2N71A 2E5RA 5FUWA 1V1HA 1XA6A 2WVJA 2J87A 3VDUA 1FARA 2KMOA 4HGUA 1Z7KB 1UHAA 3TO9A 4UXJA 3UEJA 2NU2I 2N52A 2QQEA 5E3QA 3R5CA 1LR8A 3R5DA 3E2IA 1W4RA 1MJBA 2KCXA 2QQCA 1CT0I 1TIHA 3R5BA 4L9MA 4GI3C 2OU2A 2SGFI 2W0TA 5JHWC 2N1AB 3VDPA 1U5KA 3OXGA 1CHOI 3TOAA 4OVOA 1PTQA 3FSYA 1XX6A 2J9RA 1KBEA 2JXDA 2K9HA 1SGDI 1HEVA 3GOXA 1Q9BA 2B8TA 3RU0A 4E1PA 1S20A 2QQ0A 2E73A 2JW6A 1R0RI 5FUXA 2BUSA 1TURA 2GIVA 1TBOA 1TGSI 1TUSA 2V53A 3FC3A 1LR7A 2GKRI 2LB7A 2LEOA 3R5AA 3QTLD 4UXHA 2SGPI 3UOEA 2DB6A 1DS3I 1CGJI 2Y0MA 1PTRA 2UVOA 2V1CA 9WGAA 1RFHA 1PJUA 3TJQA 1M8CA 2GKVA 1SGPI 5CCMA 1NXUA 3QWPA 5J8FA 5FUVA 1HPTA 4FKDA 1XBTA 1UUCA 2M5XA 1TBQR 3OXFA 1AN1I 3TO6A 1TOTA 1IW4A 1IY6A 2UZ3A 2ROWA 5DAEA 1CE3A 3FSXA 1WKXA 3D00A 4A24A 4UXIA 1HJAI 2GVIA 1FAQA 1YTPA 2OZUA 1P9ZA 1UVGA 1Y8FA 5EX3A 3SGBI 3UGLA 2F3CI 2QPOA 2FNFX 1WGTA 2JYYA 3SEKC 3UGIA 1IY5A 2B0UC 2WCYA 3PDNA 2KMQA 1CSOI 4MPIA 1W3SA 2NU1I 2KMPA 2CWGA 1WTJA 1ULNA 1BUSA 1SGQI 4B6DA 1BMOA 3BJIA 1X4SA 1K7VA 2NU4I 2QQDA 2ERWA 5FUYA 1K7UA 2ORVA
chains in the Genus database with same CATH topology
2GKTI 1SGRI 1MT1A 1OMTA 1OVOA 1X74A 3KY9A 3UFFA 3HH2C 2SGDI 1Y1BA 2JZMA 4JCVE 1PPFI 2XRCA 3UEYA 3MEKA 4A24A 4SGBI 2DIPA 1SGYI 1CGII 2SGQI 3UGDA 2ELIA 2KMRA 2ODDA 1FYBA 1CT4I 4E1RA 2SGEI 1OMUA 1OYVI 1DS2I 2YQPA 2JA1A 3VE5A 3OL0A 1KBFA 1CT2I 5HQ8A 3OVOA 1V1IA 1N13A 1M8BA 1R79A 2L8EA 2N17A 3TJQA 1TBRR 1TBNA 1Y1CA 2ARPF 2NU3I 2CJSC 3CXLA 2OVOA 1UVFA 2ORWA 3OXLA 5HI7A 1LR9A 2YUUA 2A20A 1PCEA 1NUBA 1YU6C 1HDLA 3B4VC 5EX0A 1SGNI 1VDDA 2ENZA 2V1CC 2LUYA 2VRWB 3E59A 5CCLA 1SGEI 1H0ZA 1KMAA 2OD1A 3SGQI 2ENNA 2NU0I 2P6AC 2N71A 2E5RA 5FUWA 1V1HA 1XA6A 2WVJA 2J87A 3VDUA 1FARA 2KMOA 4HGUA 1Z7KB 4UXJA 3UEJA 2NU2I 2N52A 2QQEA 1LR8A 3E2IA 1W4RA 2KCXA 2QQCA 1CT0I 1TIHA 4L9MA 4GI3C 2SGFI 2W0TA 5JHWC 2N1AB 3VDPA 1U5KA 3OXGA 1CHOI 4OVOA 1PTQA 1XX6A 2J9RA 1KBEA 2JXDA 2K9HA 1SGDI 3GOXA 2B8TA 3RU0A 4E1PA 2QQ0A 2E73A 2JW6A 1R0RI 5FUXA 2BUSA 1TURA 1TBOA 1TGSI 1TUSA 2V53A 3FC3A 1LR7A 2GKRI 2LEOA 4UXHA 3QTLD 2SGPI 2DB6A 1DS3I 1CGJI 1PTRA 2V1CA 1RFHA 1PJUA 1M8CA 2GKVA 1SGPI 5CCMA 3QWPA 5FUVA 1HPTA 4FKDA 1XBTA 1UUCA 2M5XA 1TBQR 3OXFA 1AN1I 1TOTA 1IW4A 1IY6A 2UZ3A 2ROWA 5DAEA 1CE3A 3D00A 4UXIA 1HJAI 2GVIA 1FAQA 1YTPA 1UVGA 1Y8FA 5EX3A 3SGBI 3UGLA 2F3CI 2QPOA 2FNFX 2JYYA 3SEKC 3UGIA 1IY5A 2B0UC 2WCYA 3PDNA 2KMQA 1CSOI 1W3SA 2NU1I 2KMPA 1BUSA 1SGQI 4B6DA 1BMOA 3BJIA 1X4SA 2QQDA 2NU4I 2ERWA 5FUYA 2L7XA 2ORVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GKT I;  1SGR I;  1MT1 A;  1OMT A;  1OVO A;  3HH2 C;  2SGD I;  1Y1B A;  2JZM A;  1PPF I;  2XRC A;  4SGB I;  1SGY I;  1CGI I;  2SGQ I;  2KMR A;  1FYB A;  1CT4 I;  2SGE I;  1OMU A;  1OYV I;  1DS2 I;  1CT2 I;  3OVO A;  1N13 A;  1M8B A;  2N17 A;  3TJQ A;  1TBR R;  1Y1C A;  2ARP F;  2NU3 I;  2OVO A;  1UVF A;  1LR9 A;  1PCE A;  1NUB A;  1YU6 C;  1HDL A;  3B4V C;  1SGN I;  1SGE I;  1H0Z A;  1KMA A;  3SGQ I;  2NU0 I;  2P6A C;  2N71 A;  2KMO A;  4HGU A;  1Z7K B;  2NU2 I;  2N52 A;  1LR8 A;  2KCX A;  2QQC A;  1CT0 I;  1TIH A;  4GI3 C;  2SGF I;  5JHW C;  1CHO I;  4OVO A;  2JXD A;  1SGD I;  1R0R I;  2BUS A;  1TUR A;  1TGS I;  1TUS A;  2V53 A;  1LR7 A;  2GKR I;  2LEO A;  3QTL D;  2SGP I;  1DS3 I;  1CGJ I;  1PJU A;  1M8C A;  2GKV A;  1SGP I;  1HPT A;  1UUC A;  2M5X A;  1TBQ R;  1AN1 I;  1IY6 A;  1IW4 A;  5DAE A;  1CE3 A;  1HJA I;  1YTP A;  1UVG A;  3SGB I;  2F3C I;  3SEK C;  2JYY A;  1IY5 A;  2B0U C;  2WCY A;  2KMQ A;  1CSO I;  2NU1 I;  2KMP A;  1BUS A;  1SGQ I;  1BMO A;  2QQD A;  2NU4 I;  2ERW A; 
#chains in the Genus database with same CATH topology
 3TO7 A;  2RC4 A;  2GKT I;  1SGR I;  1MT1 A;  1OMT A;  1OVO A;  1X74 A;  3KY9 A;  2L7X A;  3UFF A;  3HH2 C;  2CWF A;  2SGD I;  1FY7 A;  5E3P A;  1Y1B A;  2JZM A;  4JCV E;  1PPF I;  2XRC A;  3TOB A;  3MEK A;  5E3R A;  3UEY A;  4SGB I;  2DIP A;  1SGY I;  1CGI I;  2SGQ I;  3UGD A;  2ELI A;  2KMR A;  2ODD A;  5J8C A;  3QAH A;  1FYB A;  2RIJ A;  1CT4 I;  4E1R A;  2DKV A;  2SGE I;  1OMU A;  1OYV I;  1DS2 I;  2YQP A;  2JA1 A;  3VE5 A;  2CWH A;  3OL0 A;  4DNC A;  1KBF A;  1CT2 I;  1MJA A;  5HQ8 A;  2WGC A;  2X52 A;  4WP4 A;  3OVO A;  1V1I A;  1N13 A;  1M8B A;  1R79 A;  1ULK A;  1WGC A;  2L8E A;  2N17 A;  1TBR R;  1TBN A;  1Y1C A;  2ARP F;  1MJ9 A;  2CJS C;  2NU3 I;  2OVO A;  1UVF A;  2X3T A;  3CXL A;  4AML A;  2ORW A;  3OXL A;  1P9G A;  1LR9 A;  2YUU A;  5HI7 A;  2A20 A;  1PCE A;  1NUB A;  7WGA A;  1YU6 C;  1HDL A;  3B4V C;  5EX0 A;  1SGN I;  1VDD A;  2ENZ A;  1K7T A;  2V1C C;  2LUY A;  2VRW B;  1Z2I A;  3E59 A;  5CCL A;  1SGE I;  1H0Z A;  1KMA A;  2OD1 A;  3SGQ I;  1ULM A;  2ENN A;  2NU0 I;  2P6A C;  2PQ8 A;  2N71 A;  2E5R A;  5FUW A;  1V1H A;  1XA6 A;  2WVJ A;  2J87 A;  3VDU A;  1FAR A;  2KMO A;  4HGU A;  1Z7K B;  1UHA A;  3TO9 A;  4UXJ A;  3UEJ A;  2NU2 I;  2N52 A;  2QQE A;  5E3Q A;  3R5C A;  1LR8 A;  3R5D A;  3E2I A;  1W4R A;  1MJB A;  2KCX A;  2QQC A;  1CT0 I;  1TIH A;  3R5B A;  4L9M A;  4GI3 C;  2OU2 A;  2SGF I;  2W0T A;  5JHW C;  2N1A B;  3VDP A;  1U5K A;  3OXG A;  1CHO I;  3TOA A;  4OVO A;  1PTQ A;  3FSY A;  1XX6 A;  2J9R A;  1KBE A;  2JXD A;  2K9H A;  1SGD I;  1HEV A;  3GOX A;  1Q9B A;  2B8T A;  3RU0 A;  4E1P A;  1S20 A;  2QQ0 A;  2E73 A;  2JW6 A;  1R0R I;  5FUX A;  2BUS A;  1TUR A;  2GIV A;  1TBO A;  1TGS I;  1TUS A;  2V53 A;  3FC3 A;  1LR7 A;  2GKR I;  2LB7 A;  2LEO A;  3R5A A;  3QTL D;  4UXH A;  2SGP I;  3UOE A;  2DB6 A;  1DS3 I;  1CGJ I;  2Y0M A;  1PTR A;  2UVO A;  2V1C A;  9WGA A;  1RFH A;  1PJU A;  3TJQ A;  1M8C A;  2GKV A;  1SGP I;  5CCM A;  1NXU A;  3QWP A;  5J8F A;  5FUV A;  1HPT A;  4FKD A;  1XBT A;  1UUC A;  2M5X A;  1TBQ R;  3OXF A;  1AN1 I;  3TO6 A;  1TOT A;  1IW4 A;  1IY6 A;  2UZ3 A;  2ROW A;  5DAE A;  1CE3 A;  3FSX A;  1WKX A;  3D00 A;  4A24 A;  4UXI A;  1HJA I;  2GVI A;  1FAQ A;  1YTP A;  2OZU A;  1P9Z A;  1UVG A;  1Y8F A;  5EX3 A;  3SGB I;  3UGL A;  2F3C I;  2QPO A;  2FNF X;  1WGT A;  2JYY A;  3SEK C;  3UGI A;  1IY5 A;  2B0U C;  2WCY A;  3PDN A;  2KMQ A;  1CSO I;  4MPI A;  1W3S A;  2NU1 I;  2KMP A;  2CWG A;  1WTJ A;  1ULN A;  1BUS A;  1SGQ I;  4B6D A;  1BMO A;  3BJI A;  1X4S A;  1K7V A;  2NU4 I;  2QQD A;  2ERW A;  5FUY A;  1K7U A;  2ORV A; 
#chains in the Genus database with same CATH homology
 2GKT I;  1SGR I;  1MT1 A;  1OMT A;  1OVO A;  1X74 A;  3KY9 A;  3UFF A;  3HH2 C;  2SGD I;  1Y1B A;  2JZM A;  4JCV E;  1PPF I;  2XRC A;  3UEY A;  3MEK A;  4A24 A;  4SGB I;  2DIP A;  1SGY I;  1CGI I;  2SGQ I;  3UGD A;  2ELI A;  2KMR A;  2ODD A;  1FYB A;  1CT4 I;  4E1R A;  2SGE I;  1OMU A;  1OYV I;  1DS2 I;  2YQP A;  2JA1 A;  3VE5 A;  3OL0 A;  1KBF A;  1CT2 I;  5HQ8 A;  3OVO A;  1V1I A;  1N13 A;  1M8B A;  1R79 A;  2L8E A;  2N17 A;  3TJQ A;  1TBR R;  1TBN A;  1Y1C A;  2ARP F;  2NU3 I;  2CJS C;  3CXL A;  2OVO A;  1UVF A;  2ORW A;  3OXL A;  5HI7 A;  1LR9 A;  2YUU A;  2A20 A;  1PCE A;  1NUB A;  1YU6 C;  1HDL A;  3B4V C;  5EX0 A;  1SGN I;  1VDD A;  2ENZ A;  2V1C C;  2LUY A;  2VRW B;  3E59 A;  5CCL A;  1SGE I;  1H0Z A;  1KMA A;  2OD1 A;  3SGQ I;  2ENN A;  2NU0 I;  2P6A C;  2N71 A;  2E5R A;  5FUW A;  1V1H A;  1XA6 A;  2WVJ A;  2J87 A;  3VDU A;  1FAR A;  2KMO A;  4HGU A;  1Z7K B;  4UXJ A;  3UEJ A;  2NU2 I;  2N52 A;  2QQE A;  1LR8 A;  3E2I A;  1W4R A;  2KCX A;  2QQC A;  1CT0 I;  1TIH A;  4L9M A;  4GI3 C;  2SGF I;  2W0T A;  5JHW C;  2N1A B;  3VDP A;  1U5K A;  3OXG A;  1CHO I;  4OVO A;  1PTQ A;  1XX6 A;  2J9R A;  1KBE A;  2JXD A;  2K9H A;  1SGD I;  3GOX A;  2B8T A;  3RU0 A;  4E1P A;  2QQ0 A;  2E73 A;  2JW6 A;  1R0R I;  5FUX A;  2BUS A;  1TUR A;  1TBO A;  1TGS I;  1TUS A;  2V53 A;  3FC3 A;  1LR7 A;  2GKR I;  2LEO A;  4UXH A;  3QTL D;  2SGP I;  2DB6 A;  1DS3 I;  1CGJ I;  1PTR A;  2V1C A;  1RFH A;  1PJU A;  1M8C A;  2GKV A;  1SGP I;  5CCM A;  3QWP A;  5FUV A;  1HPT A;  4FKD A;  1XBT A;  1UUC A;  2M5X A;  1TBQ R;  3OXF A;  1AN1 I;  1TOT A;  1IW4 A;  1IY6 A;  2UZ3 A;  2ROW A;  5DAE A;  1CE3 A;  3D00 A;  4UXI A;  1HJA I;  2GVI A;  1FAQ A;  1YTP A;  1UVG A;  1Y8F A;  5EX3 A;  3SGB I;  3UGL A;  2F3C I;  2QPO A;  2FNF X;  2JYY A;  3SEK C;  3UGI A;  1IY5 A;  2B0U C;  2WCY A;  3PDN A;  2KMQ A;  1CSO I;  1W3S A;  2NU1 I;  2KMP A;  1BUS A;  1SGQ I;  4B6D A;  1BMO A;  3BJI A;  1X4S A;  2QQD A;  2NU4 I;  2ERW A;  5FUY A;  2L7X A;  2ORV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...