2SGQI

Gln 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 6.5
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTQEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Streptogrisin B
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pH's
rcsb
source organism Meleagris gallopavo
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2sgqI00
1FYBA 1TBQR 1OMTA 2LEOA 1TGSI 2WCYA 2XRCA 2M5XA 1PPFI 2JYYA 2SGDI 2JZMA 3SEKC 1KMAA 1LR8A 4SGBI 1LR9A 1OVOA 1IY6A 2KMPA 5DAEA 2JXDA 2SGEI 3OVOA 1IY5A 1Y1BA 2NU2I 2NU4I 2KMOA 1NUBA 1HJAI 5JHWC 1MT1A 1CGII 1CHOI 4OVOA 3TJQA 1CT4I 1SGYI 2NU3I 2SGPI 1M8BA 1UUCA 1M8CA 1CT0I 1CT2I 1SGEI 1PJUA 1SGRI 2N71A 3B4VC 2QQCA 3SGBI 1DS2I 2KCXA 1R0RI 2KMQA 4GI3C 1CE3A 2N52A 1AN1I 1DS3I 2QQDA 1OMUA 1CGJI 2V53A 1PCEA 1TIHA 1YTPA 2B0UC 1IW4A 1OYVI 2ERWA 1SGPI 1SGNI 1YU6C 1HDLA 4HGUA 1UVGA 1SGDI 2KMRA 2NU1I 2BUSA 2F3CI 2GKRI 1TUSA 2NU0I 2GKTI 1HPTA 1UVFA 1CSOI 1TBRR 3SGQI 1N13A 1BMOA 2P6AC 2ARPF 1LR7A 1H0ZA 1Z7KB 1SGQI 2GKVA 2SGQI 3HH2C 2OVOA 3QTLD 1BUSA 2N17A 2SGFI 1TURA 1Y1CA
chains in the Genus database with same CATH superfamily
2ENNA 3TO6A 1FYBA 1TBQR 1OMTA 2LEOA 1TGSI 2WCYA 2XRCA 5CCMA 1K7UA 2M5XA 1PPFI 2ELIA 2JYYA 5FUVA 2SGDI 2JZMA 2L8EA 2UVOA 5HI7A 2FNFX 1W4RA 1LR8A 3SEKC 1KMAA 4SGBI 1LR9A 1OVOA 1IY6A 2KMPA 2QPOA 2JXDA 2WVJA 2SGEI 3QWPA 1XBTA 5DAEA 1PTQA 2CWGA 2QQEA 3OVOA 4WP4A 4AMLA 7WGAA 1IY5A 1Y1BA 2LUYA 2NU2I 1U5KA 2NU4I 1K7TA 1S20A 1VDDA 2CWFA 3PDNA 3UOEA 2V1CA 3UGLA 2KMOA 1NUBA 1HJAI 2YUUA 2ODDA 2ENZA 4UXHA 3UGDA 5JHWC 2J87A 2A20A 1RFHA 2RC4A 1MT1A 3UGIA 3GOXA 2W0TA 4B6DA 1CGII 1CHOI 4OVOA 3TJQA 1CT4I 1SGYI 2NU3I 3OXGA 1PTRA 2SGPI 3KY9A 1M8BA 1MJAA 1UUCA 2X52A 4L9MA 1M8CA 1CT0I 5E3PA 1Q9BA 1HEVA 2E73A 1CT2I 1MJBA 2DIPA 5FUWA 1SGEI 1PJUA 1SGRI 3OXLA 2N71A 3UEYA 2ROWA 1X74A 2X3TA 3B4VC 2QQCA 4JCVE 3SGBI 1DS2I 1ULMA 2KCXA 2RIJA 4UXJA 1R0RI 2KMQA 4A24A 2V1CC 1MJ9A 3FC3A 1WGTA 1NXUA 2J9RA 3MEKA 4GI3C 1CE3A 2N52A 3VDPA 1P9GA 1AN1I 5FUXA 4FKDA 1W3SA 1DS3I 1UHAA 2QQDA 3FSYA 2OZUA 3R5AA 3UFFA 1OMUA 5CCLA 2Y0MA 1CGJI 3R5DA 1FARA 2V53A 1PCEA 1ULKA 4DNCA 2PQ8A 1TIHA 1YTPA 5J8CA 1KBFA 2B0UC 3TOBA 1R79A 5EX3A 1BUSA 5E3RA 5J8FA 2CJSC 1IW4A 1OYVI 2ERWA 1XA6A 1SGPI 1SGNI 1YU6C 1Y8FA 2YQPA 4UXIA 2WGCA 1ULNA 1HDLA 2N1AB 1V1HA 9WGAA 1Z2IA 4HGUA 1UVGA 2CWHA 1FAQA 1TOTA 1P9ZA 2B8TA 3R5CA 2ORVA 3E2IA 1SGDI 2KMRA 2L7XA 5EX0A 5HQ8A 2JA1A 2NU1I 2BUSA 2GVIA 3FSXA 2LB7A 2OD1A 3TOAA 2ORWA 2F3CI 3BJIA 1WGCA 2GKRI 1TUSA 2NU0I 2GKTI 1HPTA 1WKXA 3RU0A 2VRWB 1UVFA 2DB6A 1CSOI 1TBRR 3QAHA 3SGQI 3VE5A 1N13A 1BMOA 2P6AC 3UEJA 1WTJA 2ARPF 1KBEA 1XX6A 2OU2A 1LR7A 1TBOA 1H0ZA 3R5BA 3VDUA 3D00A 3E59A 2UZ3A 1Z7KB 3OXFA 1SGQI 1K7VA 5E3QA 4E1PA 2DKVA 3TO7A 1TBNA 2E5RA 2GKVA 2SGQI 3HH2C 4MPIA 5FUYA 2OVOA 3QTLD 3TO9A 2QQ0A 3CXLA 2K9HA 2GIVA 1X4SA 2N17A 2SGFI 3OL0A 1FY7A 4E1RA 1TURA 1Y1CA 1V1IA 2JW6A
chains in the Genus database with same CATH topology
2ENNA 1FYBA 1TBQR 1OMTA 2LEOA 1TGSI 2WCYA 2XRCA 5CCMA 2M5XA 1PPFI 2ELIA 2JYYA 5FUVA 2SGDI 2JZMA 2L8EA 5HI7A 2FNFX 1W4RA 1LR8A 3SEKC 1KMAA 4SGBI 1LR9A 1OVOA 1IY6A 2KMPA 2QPOA 2JXDA 2WVJA 2SGEI 3QWPA 1XBTA 5DAEA 1PTQA 3OVOA 2QQEA 1IY5A 1Y1BA 2LUYA 2NU2I 1U5KA 2NU4I 1VDDA 3PDNA 2V1CA 3UGLA 2KMOA 1NUBA 1HJAI 2YUUA 2ODDA 2ENZA 4UXHA 3UGDA 5JHWC 2J87A 2A20A 1RFHA 1MT1A 3UGIA 3GOXA 2W0TA 4B6DA 1CGII 1CHOI 4OVOA 3TJQA 1CT4I 1SGYI 2NU3I 3OXGA 1PTRA 2SGPI 3KY9A 1M8BA 1UUCA 4L9MA 1M8CA 1CT0I 2E73A 1CT2I 2DIPA 5FUWA 1SGEI 1PJUA 1SGRI 3OXLA 2N71A 3UEYA 2ROWA 1X74A 4JCVE 3B4VC 2QQCA 3SGBI 1DS2I 2KCXA 4UXJA 1R0RI 2KMQA 4A24A 2V1CC 3FC3A 4GI3C 2J9RA 3MEKA 1CE3A 2N52A 3VDPA 1AN1I 5FUXA 4FKDA 1W3SA 1DS3I 2QQDA 3UFFA 1OMUA 5CCLA 1CGJI 1FARA 2V53A 1PCEA 1TIHA 1YTPA 1KBFA 2B0UC 1R79A 5EX3A 2CJSC 1IW4A 1OYVI 2ERWA 1XA6A 1SGPI 1SGNI 1YU6C 1Y8FA 2YQPA 4UXIA 1HDLA 2N1AB 1V1HA 4HGUA 1UVGA 1FAQA 1TOTA 2B8TA 2ORVA 3E2IA 1SGDI 2KMRA 2L7XA 5EX0A 5HQ8A 2JA1A 2NU1I 2BUSA 2GVIA 2OD1A 2ORWA 2F3CI 3BJIA 2GKRI 1TUSA 2NU0I 2GKTI 1HPTA 3RU0A 2VRWB 1UVFA 2DB6A 1CSOI 1TBRR 3SGQI 3VE5A 1N13A 1BMOA 2P6AC 3UEJA 2ARPF 1KBEA 1XX6A 1LR7A 1TBOA 1H0ZA 3VDUA 3D00A 3E59A 2UZ3A 1Z7KB 3OXFA 1SGQI 4E1PA 1TBNA 2E5RA 2GKVA 2SGQI 3HH2C 5FUYA 2OVOA 3QTLD 1BUSA 2QQ0A 3CXLA 2K9HA 2N17A 1X4SA 2SGFI 3OL0A 4E1RA 1TURA 1Y1CA 1V1IA 2JW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FYB A;  1TBQ R;  1OMT A;  2LEO A;  1TGS I;  2WCY A;  2XRC A;  2M5X A;  1PPF I;  2JYY A;  2SGD I;  2JZM A;  3SEK C;  1KMA A;  1LR8 A;  4SGB I;  1LR9 A;  1OVO A;  1IY6 A;  2KMP A;  5DAE A;  2JXD A;  2SGE I;  3OVO A;  1IY5 A;  1Y1B A;  2NU2 I;  2NU4 I;  2KMO A;  1NUB A;  1HJA I;  5JHW C;  1MT1 A;  1CGI I;  1CHO I;  4OVO A;  3TJQ A;  1CT4 I;  1SGY I;  2NU3 I;  2SGP I;  1M8B A;  1UUC A;  1M8C A;  1CT0 I;  1CT2 I;  1SGE I;  1PJU A;  1SGR I;  2N71 A;  3B4V C;  2QQC A;  3SGB I;  1DS2 I;  2KCX A;  1R0R I;  2KMQ A;  4GI3 C;  1CE3 A;  2N52 A;  1AN1 I;  1DS3 I;  2QQD A;  1OMU A;  1CGJ I;  2V53 A;  1PCE A;  1TIH A;  1YTP A;  2B0U C;  1IW4 A;  1OYV I;  2ERW A;  1SGP I;  1SGN I;  1YU6 C;  1HDL A;  4HGU A;  1UVG A;  1SGD I;  2KMR A;  2NU1 I;  2BUS A;  2F3C I;  2GKR I;  1TUS A;  2NU0 I;  2GKT I;  1HPT A;  1UVF A;  1CSO I;  1TBR R;  3SGQ I;  1N13 A;  1BMO A;  2P6A C;  2ARP F;  1LR7 A;  1H0Z A;  1Z7K B;  1SGQ I;  2GKV A;  2SGQ I;  3HH2 C;  2OVO A;  3QTL D;  1BUS A;  2N17 A;  2SGF I;  1TUR A;  1Y1C A; 
#chains in the Genus database with same CATH topology
 2ENN A;  3TO6 A;  1FYB A;  1TBQ R;  1OMT A;  2LEO A;  1TGS I;  2WCY A;  2XRC A;  5CCM A;  1K7U A;  2M5X A;  1PPF I;  2ELI A;  2JYY A;  5FUV A;  2SGD I;  2JZM A;  2L8E A;  2UVO A;  5HI7 A;  2FNF X;  1W4R A;  1LR8 A;  3SEK C;  1KMA A;  4SGB I;  1LR9 A;  1OVO A;  1IY6 A;  2KMP A;  2QPO A;  2JXD A;  2WVJ A;  2SGE I;  3QWP A;  1XBT A;  5DAE A;  1PTQ A;  2CWG A;  2QQE A;  3OVO A;  4WP4 A;  4AML A;  7WGA A;  1IY5 A;  1Y1B A;  2LUY A;  2NU2 I;  1U5K A;  2NU4 I;  1K7T A;  1S20 A;  1VDD A;  2CWF A;  3PDN A;  3UOE A;  2V1C A;  3UGL A;  2KMO A;  1NUB A;  1HJA I;  2YUU A;  2ODD A;  2ENZ A;  4UXH A;  3UGD A;  5JHW C;  2J87 A;  2A20 A;  1RFH A;  2RC4 A;  1MT1 A;  3UGI A;  3GOX A;  2W0T A;  4B6D A;  1CGI I;  1CHO I;  4OVO A;  3TJQ A;  1CT4 I;  1SGY I;  2NU3 I;  3OXG A;  1PTR A;  2SGP I;  3KY9 A;  1M8B A;  1MJA A;  1UUC A;  2X52 A;  4L9M A;  1M8C A;  1CT0 I;  5E3P A;  1Q9B A;  1HEV A;  2E73 A;  1CT2 I;  1MJB A;  2DIP A;  5FUW A;  1SGE I;  1PJU A;  1SGR I;  3OXL A;  2N71 A;  3UEY A;  2ROW A;  1X74 A;  2X3T A;  3B4V C;  2QQC A;  4JCV E;  3SGB I;  1DS2 I;  1ULM A;  2KCX A;  2RIJ A;  4UXJ A;  1R0R I;  2KMQ A;  4A24 A;  2V1C C;  1MJ9 A;  3FC3 A;  1WGT A;  1NXU A;  2J9R A;  3MEK A;  4GI3 C;  1CE3 A;  2N52 A;  3VDP A;  1P9G A;  1AN1 I;  5FUX A;  4FKD A;  1W3S A;  1DS3 I;  1UHA A;  2QQD A;  3FSY A;  2OZU A;  3R5A A;  3UFF A;  1OMU A;  5CCL A;  2Y0M A;  1CGJ I;  3R5D A;  1FAR A;  2V53 A;  1PCE A;  1ULK A;  4DNC A;  2PQ8 A;  1TIH A;  1YTP A;  5J8C A;  1KBF A;  2B0U C;  3TOB A;  1R79 A;  5EX3 A;  1BUS A;  5E3R A;  5J8F A;  2CJS C;  1IW4 A;  1OYV I;  2ERW A;  1XA6 A;  1SGP I;  1SGN I;  1YU6 C;  1Y8F A;  2YQP A;  4UXI A;  2WGC A;  1ULN A;  1HDL A;  2N1A B;  1V1H A;  9WGA A;  1Z2I A;  4HGU A;  1UVG A;  2CWH A;  1FAQ A;  1TOT A;  1P9Z A;  2B8T A;  3R5C A;  2ORV A;  3E2I A;  1SGD I;  2KMR A;  2L7X A;  5EX0 A;  5HQ8 A;  2JA1 A;  2NU1 I;  2BUS A;  2GVI A;  3FSX A;  2LB7 A;  2OD1 A;  3TOA A;  2ORW A;  2F3C I;  3BJI A;  1WGC A;  2GKR I;  1TUS A;  2NU0 I;  2GKT I;  1HPT A;  1WKX A;  3RU0 A;  2VRW B;  1UVF A;  2DB6 A;  1CSO I;  1TBR R;  3QAH A;  3SGQ I;  3VE5 A;  1N13 A;  1BMO A;  2P6A C;  3UEJ A;  1WTJ A;  2ARP F;  1KBE A;  1XX6 A;  2OU2 A;  1LR7 A;  1TBO A;  1H0Z A;  3R5B A;  3VDU A;  3D00 A;  3E59 A;  2UZ3 A;  1Z7K B;  3OXF A;  1SGQ I;  1K7V A;  5E3Q A;  4E1P A;  2DKV A;  3TO7 A;  1TBN A;  2E5R A;  2GKV A;  2SGQ I;  3HH2 C;  4MPI A;  5FUY A;  2OVO A;  3QTL D;  3TO9 A;  2QQ0 A;  3CXL A;  2K9H A;  2GIV A;  1X4S A;  2N17 A;  2SGF I;  3OL0 A;  1FY7 A;  4E1R A;  1TUR A;  1Y1C A;  1V1I A;  2JW6 A; 
#chains in the Genus database with same CATH homology
 2ENN A;  1FYB A;  1TBQ R;  1OMT A;  2LEO A;  1TGS I;  2WCY A;  2XRC A;  5CCM A;  2M5X A;  1PPF I;  2ELI A;  2JYY A;  5FUV A;  2SGD I;  2JZM A;  2L8E A;  5HI7 A;  2FNF X;  1W4R A;  1LR8 A;  3SEK C;  1KMA A;  4SGB I;  1LR9 A;  1OVO A;  1IY6 A;  2KMP A;  2QPO A;  2JXD A;  2WVJ A;  2SGE I;  3QWP A;  1XBT A;  5DAE A;  1PTQ A;  3OVO A;  2QQE A;  1IY5 A;  1Y1B A;  2LUY A;  2NU2 I;  1U5K A;  2NU4 I;  1VDD A;  3PDN A;  2V1C A;  3UGL A;  2KMO A;  1NUB A;  1HJA I;  2YUU A;  2ODD A;  2ENZ A;  4UXH A;  3UGD A;  5JHW C;  2J87 A;  2A20 A;  1RFH A;  1MT1 A;  3UGI A;  3GOX A;  2W0T A;  4B6D A;  1CGI I;  1CHO I;  4OVO A;  3TJQ A;  1CT4 I;  1SGY I;  2NU3 I;  3OXG A;  1PTR A;  2SGP I;  3KY9 A;  1M8B A;  1UUC A;  4L9M A;  1M8C A;  1CT0 I;  2E73 A;  1CT2 I;  2DIP A;  5FUW A;  1SGE I;  1PJU A;  1SGR I;  3OXL A;  2N71 A;  3UEY A;  2ROW A;  1X74 A;  4JCV E;  3B4V C;  2QQC A;  3SGB I;  1DS2 I;  2KCX A;  4UXJ A;  1R0R I;  2KMQ A;  4A24 A;  2V1C C;  3FC3 A;  4GI3 C;  2J9R A;  3MEK A;  1CE3 A;  2N52 A;  3VDP A;  1AN1 I;  5FUX A;  4FKD A;  1W3S A;  1DS3 I;  2QQD A;  3UFF A;  1OMU A;  5CCL A;  1CGJ I;  1FAR A;  2V53 A;  1PCE A;  1TIH A;  1YTP A;  1KBF A;  2B0U C;  1R79 A;  5EX3 A;  2CJS C;  1IW4 A;  1OYV I;  2ERW A;  1XA6 A;  1SGP I;  1SGN I;  1YU6 C;  1Y8F A;  2YQP A;  4UXI A;  1HDL A;  2N1A B;  1V1H A;  4HGU A;  1UVG A;  1FAQ A;  1TOT A;  2B8T A;  2ORV A;  3E2I A;  1SGD I;  2KMR A;  2L7X A;  5EX0 A;  5HQ8 A;  2JA1 A;  2NU1 I;  2BUS A;  2GVI A;  2OD1 A;  2ORW A;  2F3C I;  3BJI A;  2GKR I;  1TUS A;  2NU0 I;  2GKT I;  1HPT A;  3RU0 A;  2VRW B;  1UVF A;  2DB6 A;  1CSO I;  1TBR R;  3SGQ I;  3VE5 A;  1N13 A;  1BMO A;  2P6A C;  3UEJ A;  2ARP F;  1KBE A;  1XX6 A;  1LR7 A;  1TBO A;  1H0Z A;  3VDU A;  3D00 A;  3E59 A;  2UZ3 A;  1Z7K B;  3OXF A;  1SGQ I;  4E1P A;  1TBN A;  2E5R A;  2GKV A;  2SGQ I;  3HH2 C;  5FUY A;  2OVO A;  3QTL D;  1BUS A;  2QQ0 A;  3CXL A;  2K9H A;  2N17 A;  1X4S A;  2SGF I;  3OL0 A;  4E1R A;  1TUR A;  1Y1C A;  1V1I A;  2JW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...