2CJSC

Structural basis for a munc13-1 homodimer - munc13-1 - rim heterodimer switch: c2-domains as versatile protein-protein interaction modules
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
54
structure length
54
Chain Sequence
APTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLRSNKVMWVCNLCRKQQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UNC-13 HOMOLOG A
publication title Structural Basis for a Munc13-1 Homodimer to Munc13-1/Rim Heterodimer Switch.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Exocytosis
total genus 9
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2006-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.120 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2cjsC01
2A20A 2CJSC
chains in the Genus database with same CATH superfamily
4JCVE 3FSXA 3GOXA 1TBQR 2GKTI 2WCYA 1PCEA 2CWGA 5E3QA 1TOTA 7WGAA 1KMAA 2SGPI 2FNFX 3TOBA 2GVIA 3UFFA 5HQ8A 2SGDI 2B8TA 4L9MA 2YUUA 3MEKA 3BJIA 1HJAI 1SGDI 1TGSI 2N71A 2OD1A 1SGPI 3OXGA 3UGLA 1ULNA 1OMUA 2V1CC 3KY9A 3UEYA 1BUSA 1CE3A 1SGNI 2J87A 3E59A 4FKDA 1MJ9A 5CCLA 2DB6A 1PPFI 1LR7A 1OYVI 1WGCA 1Q9BA 1H0ZA 2K9HA 2ROWA 5HI7A 4WP4A 1FAQA 2A20A 5FUVA 3TO6A 4UXIA 3UEJA 2B0UC 2RC4A 1R79A 1P9GA 4HGUA 1UVFA 2JXDA 1UHAA 3SGQI 2ORVA 1XBTA 5FUXA 4A24A 2KMRA 2QQCA 3TO9A 2QQDA 1KBFA 3OXFA 1MJAA 2KMOA 1TBOA 5EX3A 3VE5A 2XRCA 2SGFI 2QQ0A 1YU6C 2GKRI 2CWFA 1CT4I 5J8FA 5FUYA 2PQ8A 2BUSA 3UOEA 2N52A 1IW4A 1TURA 1MJBA 2ENNA 3UGDA 2OU2A 2V1CA 1K7TA 5E3PA 5EX0A 5FUWA 2YQPA 2UVOA 1K7UA 4UXJA 1S20A 1OMTA 1VDDA 4MPIA 1W4RA 1DS2I 1LR8A 1X74A 2N1AB 1CSOI 2L7XA 1KBEA 3CXLA 1HPTA 1UUCA 3TO7A 1V1IA 2WVJA 2ODDA 2NU0I 3TOAA 4AMLA 1PTRA 2VRWB 1AN1I 1W3SA 5CCMA 1BMOA 1CHOI 1N13A 2DIPA 2JZMA 3R5DA 2KCXA 1PTQA 2ELIA 1NUBA 2RIJA 3VDPA 2ENZA 2ERWA 2JA1A 2Y0MA 1Y1BA 3OL0A 4E1PA 2X52A 9WGAA 3B4VC 5E3RA 1XX6A 1SGQI 1YTPA 2KMPA 2LB7A 1X4SA 4E1RA 1Z2IA 2W0TA 1DS3I 4B6DA 1CT0I 2X3TA 2QQEA 1ULKA 3R5BA 1IY5A 1RFHA 1HDLA 3QAHA 1PJUA 3SGBI 2SGQI 3QTLD 1TBRR 2F3CI 5DAEA 1NXUA 2J9RA 1CGII 2JYYA 3QWPA 3VDUA 2N17A 2DKVA 1WTJA 2P6AC 2NU4I 2WGCA 3FSYA 1UVGA 2NU1I 1ULMA 1IY6A 2E73A 2CWHA 1R0RI 1WGTA 2V53A 1OVOA 5J8CA 3TJQA 2JW6A 1TIHA 1SGEI 1TBNA 2ORWA 1MT1A 2OZUA 3D00A 4DNCA 1HEVA 2L8EA 2CJSC 2ARPF 2E5RA 1SGYI 1P9ZA 2GIVA 1FYBA 4OVOA 3SEKC 3HH2C 2QPOA 1Y8FA 3RU0A 1FY7A 1WKXA 2LUYA 1CGJI 1XA6A 2UZ3A 3PDNA 5JHWC 3UGIA 1Z7KB 3R5CA 1V1HA 1TUSA 4UXHA 1FARA 4SGBI 1SGRI 1M8CA 1U5KA 1Y1CA 2SGEI 3OXLA 1LR9A 2M5XA 1CT2I 2GKVA 1M8BA 2KMQA 2LEOA 3OVOA 3R5AA 4GI3C 2NU2I 2OVOA 3E2IA 1K7VA 2NU3I 3FC3A
chains in the Genus database with same CATH topology
4JCVE 3GOXA 1TBQR 2GKTI 2WCYA 1PCEA 1KMAA 1TOTA 2SGPI 2FNFX 2GVIA 3UFFA 5HQ8A 2SGDI 2B8TA 4L9MA 2YUUA 3MEKA 3BJIA 1HJAI 1SGDI 1TGSI 2N71A 2OD1A 1SGPI 3OXGA 3UGLA 1OMUA 2V1CC 3KY9A 3UEYA 1BUSA 1SGNI 2J87A 3E59A 4FKDA 5CCLA 2DB6A 1PPFI 1LR7A 1OYVI 1H0ZA 2K9HA 2ROWA 5HI7A 1FAQA 2A20A 5FUVA 4UXIA 3UEJA 2B0UC 1R79A 4HGUA 1UVFA 2JXDA 3SGQI 2ORVA 1XBTA 5FUXA 4A24A 2KMRA 2QQCA 2QQDA 1KBFA 3OXFA 2KMOA 1TBOA 5EX3A 3VE5A 2XRCA 2SGFI 2QQ0A 1YU6C 2GKRI 1CT4I 5FUYA 2BUSA 2N52A 1IW4A 1TURA 2ENNA 3UGDA 2V1CA 5FUWA 5EX0A 2YQPA 4UXJA 1OMTA 1VDDA 1W4RA 1LR8A 1DS2I 1X74A 2N1AB 1CSOI 2L7XA 1KBEA 3CXLA 1HPTA 1UUCA 1V1IA 2WVJA 2ODDA 2NU0I 1PTRA 2VRWB 1AN1I 1W3SA 5CCMA 1BMOA 1CHOI 1N13A 2DIPA 2JZMA 3VDPA 2KCXA 1PTQA 2ELIA 1NUBA 4B6DA 1CE3A 2ENZA 2ERWA 2JA1A 3OL0A 1Y1BA 4E1PA 3B4VC 1XX6A 1SGQI 1YTPA 2KMPA 1X4SA 4E1RA 2W0TA 1DS3I 1CT0I 2QQEA 1IY5A 1HDLA 1RFHA 1PJUA 3SGBI 2SGQI 3QTLD 1TBRR 2F3CI 5DAEA 2J9RA 1CGII 2JYYA 3QWPA 3VDUA 2N17A 2P6AC 2NU4I 1UVGA 2NU1I 1IY6A 2E73A 1R0RI 2V53A 1OVOA 3TJQA 2JW6A 1TIHA 1SGEI 1TBNA 2ORWA 1MT1A 3D00A 2L8EA 2CJSC 2ARPF 2E5RA 1SGYI 1FYBA 4OVOA 3SEKC 3HH2C 2QPOA 1Y8FA 3RU0A 2LUYA 3PDNA 1CGJI 1XA6A 2UZ3A 5JHWC 3UGIA 1Z7KB 1V1HA 1TUSA 4UXHA 1FARA 4SGBI 1SGRI 1M8CA 1U5KA 1Y1CA 2SGEI 3OXLA 1LR9A 2M5XA 1CT2I 2GKVA 1M8BA 2KMQA 2LEOA 3OVOA 4GI3C 2NU2I 2OVOA 3E2IA 2NU3I 3FC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A20 A;  2CJS C; 
#chains in the Genus database with same CATH topology
 4JCV E;  3FSX A;  3GOX A;  1TBQ R;  2GKT I;  2WCY A;  1PCE A;  2CWG A;  5E3Q A;  1TOT A;  7WGA A;  1KMA A;  2SGP I;  2FNF X;  3TOB A;  2GVI A;  3UFF A;  5HQ8 A;  2SGD I;  2B8T A;  4L9M A;  2YUU A;  3MEK A;  3BJI A;  1HJA I;  1SGD I;  1TGS I;  2N71 A;  2OD1 A;  1SGP I;  3OXG A;  3UGL A;  1ULN A;  1OMU A;  2V1C C;  3KY9 A;  3UEY A;  1BUS A;  1CE3 A;  1SGN I;  2J87 A;  3E59 A;  4FKD A;  1MJ9 A;  5CCL A;  2DB6 A;  1PPF I;  1LR7 A;  1OYV I;  1WGC A;  1Q9B A;  1H0Z A;  2K9H A;  2ROW A;  5HI7 A;  4WP4 A;  1FAQ A;  2A20 A;  5FUV A;  3TO6 A;  4UXI A;  3UEJ A;  2B0U C;  2RC4 A;  1R79 A;  1P9G A;  4HGU A;  1UVF A;  2JXD A;  1UHA A;  3SGQ I;  2ORV A;  1XBT A;  5FUX A;  4A24 A;  2KMR A;  2QQC A;  3TO9 A;  2QQD A;  1KBF A;  3OXF A;  1MJA A;  2KMO A;  1TBO A;  5EX3 A;  3VE5 A;  2XRC A;  2SGF I;  2QQ0 A;  1YU6 C;  2GKR I;  2CWF A;  1CT4 I;  5J8F A;  5FUY A;  2PQ8 A;  2BUS A;  3UOE A;  2N52 A;  1IW4 A;  1TUR A;  1MJB A;  2ENN A;  3UGD A;  2OU2 A;  2V1C A;  1K7T A;  5E3P A;  5EX0 A;  5FUW A;  2YQP A;  2UVO A;  1K7U A;  4UXJ A;  1S20 A;  1OMT A;  1VDD A;  4MPI A;  1W4R A;  1DS2 I;  1LR8 A;  1X74 A;  2N1A B;  1CSO I;  2L7X A;  1KBE A;  3CXL A;  1HPT A;  1UUC A;  3TO7 A;  1V1I A;  2WVJ A;  2ODD A;  2NU0 I;  3TOA A;  4AML A;  1PTR A;  2VRW B;  1AN1 I;  1W3S A;  5CCM A;  1BMO A;  1CHO I;  1N13 A;  2DIP A;  2JZM A;  3R5D A;  2KCX A;  1PTQ A;  2ELI A;  1NUB A;  2RIJ A;  3VDP A;  2ENZ A;  2ERW A;  2JA1 A;  2Y0M A;  1Y1B A;  3OL0 A;  4E1P A;  2X52 A;  9WGA A;  3B4V C;  5E3R A;  1XX6 A;  1SGQ I;  1YTP A;  2KMP A;  2LB7 A;  1X4S A;  4E1R A;  1Z2I A;  2W0T A;  1DS3 I;  4B6D A;  1CT0 I;  2X3T A;  2QQE A;  1ULK A;  3R5B A;  1IY5 A;  1RFH A;  1HDL A;  3QAH A;  1PJU A;  3SGB I;  2SGQ I;  3QTL D;  1TBR R;  2F3C I;  5DAE A;  1NXU A;  2J9R A;  1CGI I;  2JYY A;  3QWP A;  3VDU A;  2N17 A;  2DKV A;  1WTJ A;  2P6A C;  2NU4 I;  2WGC A;  3FSY A;  1UVG A;  2NU1 I;  1ULM A;  1IY6 A;  2E73 A;  2CWH A;  1R0R I;  1WGT A;  2V53 A;  1OVO A;  5J8C A;  3TJQ A;  2JW6 A;  1TIH A;  1SGE I;  1TBN A;  2ORW A;  1MT1 A;  2OZU A;  3D00 A;  4DNC A;  1HEV A;  2L8E A;  2CJS C;  2ARP F;  2E5R A;  1SGY I;  1P9Z A;  2GIV A;  1FYB A;  4OVO A;  3SEK C;  3HH2 C;  2QPO A;  1Y8F A;  3RU0 A;  1FY7 A;  1WKX A;  2LUY A;  1CGJ I;  1XA6 A;  2UZ3 A;  3PDN A;  5JHW C;  3UGI A;  1Z7K B;  3R5C A;  1V1H A;  1TUS A;  4UXH A;  1FAR A;  4SGB I;  1SGR I;  1M8C A;  1U5K A;  1Y1C A;  2SGE I;  3OXL A;  1LR9 A;  2M5X A;  1CT2 I;  2GKV A;  1M8B A;  2KMQ A;  2LEO A;  3OVO A;  3R5A A;  4GI3 C;  2NU2 I;  2OVO A;  3E2I A;  1K7V A;  2NU3 I;  3FC3 A; 
#chains in the Genus database with same CATH homology
 4JCV E;  3GOX A;  1TBQ R;  2GKT I;  2WCY A;  1PCE A;  1KMA A;  1TOT A;  2SGP I;  2FNF X;  2GVI A;  3UFF A;  5HQ8 A;  2SGD I;  2B8T A;  4L9M A;  2YUU A;  3MEK A;  3BJI A;  1HJA I;  1SGD I;  1TGS I;  2N71 A;  2OD1 A;  1SGP I;  3OXG A;  3UGL A;  1OMU A;  2V1C C;  3KY9 A;  3UEY A;  1BUS A;  1SGN I;  2J87 A;  3E59 A;  4FKD A;  5CCL A;  2DB6 A;  1PPF I;  1LR7 A;  1OYV I;  1H0Z A;  2K9H A;  2ROW A;  5HI7 A;  1FAQ A;  2A20 A;  5FUV A;  4UXI A;  3UEJ A;  2B0U C;  1R79 A;  4HGU A;  1UVF A;  2JXD A;  3SGQ I;  2ORV A;  1XBT A;  5FUX A;  4A24 A;  2KMR A;  2QQC A;  2QQD A;  1KBF A;  3OXF A;  2KMO A;  1TBO A;  5EX3 A;  3VE5 A;  2XRC A;  2SGF I;  2QQ0 A;  1YU6 C;  2GKR I;  1CT4 I;  5FUY A;  2BUS A;  2N52 A;  1IW4 A;  1TUR A;  2ENN A;  3UGD A;  2V1C A;  5FUW A;  5EX0 A;  2YQP A;  4UXJ A;  1OMT A;  1VDD A;  1W4R A;  1LR8 A;  1DS2 I;  1X74 A;  2N1A B;  1CSO I;  2L7X A;  1KBE A;  3CXL A;  1HPT A;  1UUC A;  1V1I A;  2WVJ A;  2ODD A;  2NU0 I;  1PTR A;  2VRW B;  1AN1 I;  1W3S A;  5CCM A;  1BMO A;  1CHO I;  1N13 A;  2DIP A;  2JZM A;  3VDP A;  2KCX A;  1PTQ A;  2ELI A;  1NUB A;  4B6D A;  1CE3 A;  2ENZ A;  2ERW A;  2JA1 A;  3OL0 A;  1Y1B A;  4E1P A;  3B4V C;  1XX6 A;  1SGQ I;  1YTP A;  2KMP A;  1X4S A;  4E1R A;  2W0T A;  1DS3 I;  1CT0 I;  2QQE A;  1IY5 A;  1HDL A;  1RFH A;  1PJU A;  3SGB I;  2SGQ I;  3QTL D;  1TBR R;  2F3C I;  5DAE A;  2J9R A;  1CGI I;  2JYY A;  3QWP A;  3VDU A;  2N17 A;  2P6A C;  2NU4 I;  1UVG A;  2NU1 I;  1IY6 A;  2E73 A;  1R0R I;  2V53 A;  1OVO A;  3TJQ A;  2JW6 A;  1TIH A;  1SGE I;  1TBN A;  2ORW A;  1MT1 A;  3D00 A;  2L8E A;  2CJS C;  2ARP F;  2E5R A;  1SGY I;  1FYB A;  4OVO A;  3SEK C;  3HH2 C;  2QPO A;  1Y8F A;  3RU0 A;  2LUY A;  3PDN A;  1CGJ I;  1XA6 A;  2UZ3 A;  5JHW C;  3UGI A;  1Z7K B;  1V1H A;  1TUS A;  4UXH A;  1FAR A;  4SGB I;  1SGR I;  1M8C A;  1U5K A;  1Y1C A;  2SGE I;  3OXL A;  1LR9 A;  2M5X A;  1CT2 I;  2GKV A;  1M8B A;  2KMQ A;  2LEO A;  3OVO A;  4GI3 C;  2NU2 I;  2OVO A;  3E2I A;  2NU3 I;  3FC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...