2CJSC

Structural basis for a munc13-1 homodimer - munc13-1 - rim heterodimer switch: c2-domains as versatile protein-protein interaction modules
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
54
structure length
54
Chain Sequence
APTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLRSNKVMWVCNLCRKQQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Exocytosis
molecule keywords UNC-13 HOMOLOG A
publication title Structural Basis for a Munc13-1 Homodimer to Munc13-1/Rim Heterodimer Switch.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 9
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2006-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.120 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2cjsC01
2CJSC 2A20A
chains in the Genus database with same CATH superfamily
3R5DA 1OYVI 3R5CA 2QQCA 1HDLA 2SGPI 1P9ZA 1OMUA 2GKRI 2RC4A 1WKXA 2YUUA 2UVOA 1Y1CA 2CJSC 1NXUA 4OVOA 4UXIA 1R0RI 2UZ3A 3MEKA 4WP4A 2K9HA 2N71A 3QWPA 2WGCA 1XBTA 1V1HA 1X74A 3OXLA 4E1RA 2CWGA 2KMQA 3OVOA 1CT2I 3UGLA 2QQEA 2ROWA 1CT4I 1CT0I 1SGYI 2OZUA 3UGDA 2NU0I 2JW6A 2ENNA 1VDDA 2J87A 2OU2A 1FY7A 2VRWB 1FAQA 1Z7KB 2PQ8A 1P9GA 2LEOA 3E59A 1Y1BA 3HH2C 2W0TA 1SGRI 3R5BA 1RFHA 1CGII 2L8EA 2XRCA 2GKTI 2CWHA 3PDNA 1MJ9A 3TO7A 3TOBA 2B8TA 3KY9A 3E2IA 3QAHA 2X3TA 3D00A 1MJBA 1TIHA 2YQPA 2KMPA 2JYYA 1W4RA 2B0UC 2V1CC 1UHAA 1FARA 1PJUA 1SGPI 2E5RA 2GKVA 1AN1I 2J9RA 2WCYA 3OXFA 1K7VA 1TBQR 1TGSI 5E3QA 5DAEA 3UEYA 4A24A 9WGAA 1Y8FA 1HJAI 7WGAA 1PTRA 2SGEI 4FKDA 1UUCA 5CCMA 4SGBI 2GIVA 4GI3C 5FUYA 1NUBA 3TOAA 1M8BA 1YU6C 5JHWC 2ENZA 2SGFI 2QQDA 2N52A 1V1IA 3VE5A 1S20A 1ULMA 1SGNI 1K7TA 2M5XA 2F3CI 2NU3I 2OVOA 4MPIA 5FUVA 2N1AB 3SGBI 1UVGA 1OMTA 1CSOI 4UXHA 1Z2IA 2A20A 1XA6A 2LB7A 2ORWA 2DKVA 5EX3A 2QPOA 1XX6A 1W3SA 3RU0A 2ELIA 2NU4I 3VDPA 3B4VC 1LR9A 2ARPF 3CXLA 2DB6A 2BUSA 1IY5A 4HGUA 2DIPA 1N13A 1KMAA 1CGJI 3FSYA 4L9MA 3UFFA 2WVJA 2JXDA 1CHOI 5HQ8A 1WTJA 3VDUA 5J8CA 1SGEI 2P6AC 1ULKA 4JCVE 3TO6A 5E3RA 2OD1A 2SGQI 3R5AA 2NU2I 1TBNA 5FUXA 1U5KA 2X52A 3SEKC 1BUSA 1MJAA 1TUSA 1K7UA 2JZMA 1IW4A 1HEVA 1Q9BA 1SGDI 5CCLA 1PTQA 4UXJA 3UEJA 3UOEA 5J8FA 1DS2I 3SGQI 1PCEA 1TBRR 2LUYA 2NU1I 2SGDI 1WGCA 2JA1A 1CE3A 1KBEA 2V1CA 5FUWA 1WGTA 1HPTA 1TOTA 3OL0A 1R79A 1TURA 1BMOA 3TJQA 2E73A 1LR8A 3UGIA 5EX0A 1KBFA 2FNFX 1YTPA 3BJIA 1SGQI 2GVIA 1UVFA 1FYBA 4E1PA 1IY6A 1PPFI 5E3PA 5HI7A 4DNCA 3QTLD 2Y0MA 4B6DA 2CWFA 1ULNA 3OXGA 1MT1A 2RIJA 1DS3I 1H0ZA 2QQ0A 1M8CA 2ODDA 3TO9A 3FC3A 1LR7A 3FSXA 4AMLA 3GOXA 1X4SA 2ERWA 1OVOA 2V53A 2KCXA 2ORVA 2KMOA 2N17A 1TBOA 2L7XA 2KMRA
chains in the Genus database with same CATH topology
1OYVI 2QQCA 1HDLA 2SGPI 1OMUA 2GKRI 2YUUA 1Y1CA 2CJSC 4OVOA 4UXIA 1R0RI 2UZ3A 3MEKA 2K9HA 2N71A 3QWPA 1XBTA 1V1HA 1X74A 3OXLA 4E1RA 2KMQA 3OVOA 1CT2I 3UGLA 2QQEA 2ROWA 1CT4I 1CT0I 1SGYI 3UGDA 2NU0I 2JW6A 2ENNA 1VDDA 2J87A 2VRWB 1FAQA 1Z7KB 2LEOA 3E59A 1Y1BA 3HH2C 2W0TA 1SGRI 1RFHA 1CGII 2L8EA 2XRCA 2GKTI 3PDNA 2B8TA 3KY9A 3E2IA 3D00A 1TIHA 2YQPA 2KMPA 2JYYA 1W4RA 2B0UC 2V1CC 1FARA 1PJUA 1SGPI 2E5RA 2GKVA 1AN1I 2J9RA 2WCYA 3OXFA 1TBQR 3UEYA 1TGSI 5DAEA 1Y8FA 1HJAI 1PTRA 2SGEI 4FKDA 1UUCA 5CCMA 4SGBI 5FUYA 4GI3C 1NUBA 1M8BA 1YU6C 5JHWC 2ENZA 2SGFI 2QQDA 2N52A 1V1IA 1SGNI 2M5XA 2NU3I 2OVOA 2F3CI 5FUVA 3VE5A 4A24A 2N1AB 3SGBI 1UVGA 1OMTA 1CSOI 4UXHA 2A20A 1XA6A 2ORWA 5EX3A 2QPOA 1XX6A 1W3SA 3RU0A 2ELIA 2NU4I 3VDPA 3B4VC 1LR9A 2ARPF 3CXLA 2DB6A 2BUSA 1IY5A 4HGUA 2DIPA 1N13A 1KMAA 1CGJI 4L9MA 3UFFA 2WVJA 2JXDA 1CHOI 5HQ8A 3VDUA 1SGEI 2P6AC 4JCVE 2OD1A 2SGQI 2NU2I 1TBNA 5FUXA 1U5KA 3SEKC 1BUSA 1TUSA 2JZMA 1IW4A 1SGDI 5CCLA 1PTQA 4UXJA 3UEJA 1DS2I 3SGQI 1PCEA 1TBRR 2LUYA 2NU1I 2SGDI 2JA1A 1CE3A 1KBEA 2V1CA 5FUWA 1HPTA 1TOTA 3OL0A 1R79A 1TURA 1BMOA 3TJQA 2E73A 1LR8A 3UGIA 5EX0A 1KBFA 2FNFX 1YTPA 3BJIA 1SGQI 2GVIA 1UVFA 1FYBA 4E1PA 1IY6A 1PPFI 5HI7A 3QTLD 4B6DA 3OXGA 1MT1A 1DS3I 1H0ZA 2QQ0A 1M8CA 2ODDA 3FC3A 1LR7A 3GOXA 1X4SA 2ERWA 1OVOA 2V53A 2KCXA 2ORVA 2KMOA 2N17A 1TBOA 2L7XA 2KMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CJS C;  2A20 A; 
#chains in the Genus database with same CATH topology
 3R5D A;  1OYV I;  3R5C A;  2QQC A;  1HDL A;  2SGP I;  1P9Z A;  1OMU A;  2GKR I;  2RC4 A;  1WKX A;  2YUU A;  2UVO A;  1Y1C A;  2CJS C;  1NXU A;  4OVO A;  4UXI A;  1R0R I;  2UZ3 A;  3MEK A;  4WP4 A;  2K9H A;  2N71 A;  3QWP A;  2WGC A;  1XBT A;  1V1H A;  1X74 A;  3OXL A;  4E1R A;  2CWG A;  2KMQ A;  3OVO A;  1CT2 I;  3UGL A;  2QQE A;  2ROW A;  1CT4 I;  1CT0 I;  1SGY I;  2OZU A;  3UGD A;  2NU0 I;  2JW6 A;  2ENN A;  1VDD A;  2J87 A;  2OU2 A;  1FY7 A;  2VRW B;  1FAQ A;  1Z7K B;  2PQ8 A;  1P9G A;  2LEO A;  3E59 A;  1Y1B A;  3HH2 C;  2W0T A;  1SGR I;  3R5B A;  1RFH A;  1CGI I;  2L8E A;  2XRC A;  2GKT I;  2CWH A;  3PDN A;  1MJ9 A;  3TO7 A;  3TOB A;  2B8T A;  3KY9 A;  3E2I A;  3QAH A;  2X3T A;  3D00 A;  1MJB A;  1TIH A;  2YQP A;  2KMP A;  2JYY A;  1W4R A;  2B0U C;  2V1C C;  1UHA A;  1FAR A;  1PJU A;  1SGP I;  2E5R A;  2GKV A;  1AN1 I;  2J9R A;  2WCY A;  3OXF A;  1K7V A;  1TBQ R;  1TGS I;  5E3Q A;  5DAE A;  3UEY A;  4A24 A;  9WGA A;  1Y8F A;  1HJA I;  7WGA A;  1PTR A;  2SGE I;  4FKD A;  1UUC A;  5CCM A;  4SGB I;  2GIV A;  4GI3 C;  5FUY A;  1NUB A;  3TOA A;  1M8B A;  1YU6 C;  5JHW C;  2ENZ A;  2SGF I;  2QQD A;  2N52 A;  1V1I A;  3VE5 A;  1S20 A;  1ULM A;  1SGN I;  1K7T A;  2M5X A;  2F3C I;  2NU3 I;  2OVO A;  4MPI A;  5FUV A;  2N1A B;  3SGB I;  1UVG A;  1OMT A;  1CSO I;  4UXH A;  1Z2I A;  2A20 A;  1XA6 A;  2LB7 A;  2ORW A;  2DKV A;  5EX3 A;  2QPO A;  1XX6 A;  1W3S A;  3RU0 A;  2ELI A;  2NU4 I;  3VDP A;  3B4V C;  1LR9 A;  2ARP F;  3CXL A;  2DB6 A;  2BUS A;  1IY5 A;  4HGU A;  2DIP A;  1N13 A;  1KMA A;  1CGJ I;  3FSY A;  4L9M A;  3UFF A;  2WVJ A;  2JXD A;  1CHO I;  5HQ8 A;  1WTJ A;  3VDU A;  5J8C A;  1SGE I;  2P6A C;  1ULK A;  4JCV E;  3TO6 A;  5E3R A;  2OD1 A;  2SGQ I;  3R5A A;  2NU2 I;  1TBN A;  5FUX A;  1U5K A;  2X52 A;  3SEK C;  1BUS A;  1MJA A;  1TUS A;  1K7U A;  2JZM A;  1IW4 A;  1HEV A;  1Q9B A;  1SGD I;  5CCL A;  1PTQ A;  4UXJ A;  3UEJ A;  3UOE A;  5J8F A;  1DS2 I;  3SGQ I;  1PCE A;  1TBR R;  2LUY A;  2NU1 I;  2SGD I;  1WGC A;  2JA1 A;  1CE3 A;  1KBE A;  2V1C A;  5FUW A;  1WGT A;  1HPT A;  1TOT A;  3OL0 A;  1R79 A;  1TUR A;  1BMO A;  3TJQ A;  2E73 A;  1LR8 A;  3UGI A;  5EX0 A;  1KBF A;  2FNF X;  1YTP A;  3BJI A;  1SGQ I;  2GVI A;  1UVF A;  1FYB A;  4E1P A;  1IY6 A;  1PPF I;  5E3P A;  5HI7 A;  4DNC A;  3QTL D;  2Y0M A;  4B6D A;  2CWF A;  1ULN A;  3OXG A;  1MT1 A;  2RIJ A;  1DS3 I;  1H0Z A;  2QQ0 A;  1M8C A;  2ODD A;  3TO9 A;  3FC3 A;  1LR7 A;  3FSX A;  4AML A;  3GOX A;  1X4S A;  2ERW A;  1OVO A;  2V53 A;  2KCX A;  2ORV A;  2KMO A;  2N17 A;  1TBO A;  2L7X A;  2KMR A; 
#chains in the Genus database with same CATH homology
 1OYV I;  2QQC A;  1HDL A;  2SGP I;  1OMU A;  2GKR I;  2YUU A;  1Y1C A;  2CJS C;  4OVO A;  4UXI A;  1R0R I;  2UZ3 A;  3MEK A;  2K9H A;  2N71 A;  3QWP A;  1XBT A;  1V1H A;  1X74 A;  3OXL A;  4E1R A;  2KMQ A;  3OVO A;  1CT2 I;  3UGL A;  2QQE A;  2ROW A;  1CT4 I;  1CT0 I;  1SGY I;  3UGD A;  2NU0 I;  2JW6 A;  2ENN A;  1VDD A;  2J87 A;  2VRW B;  1FAQ A;  1Z7K B;  2LEO A;  3E59 A;  1Y1B A;  3HH2 C;  2W0T A;  1SGR I;  1RFH A;  1CGI I;  2L8E A;  2XRC A;  2GKT I;  3PDN A;  2B8T A;  3KY9 A;  3E2I A;  3D00 A;  1TIH A;  2YQP A;  2KMP A;  2JYY A;  1W4R A;  2B0U C;  2V1C C;  1FAR A;  1PJU A;  1SGP I;  2E5R A;  2GKV A;  1AN1 I;  2J9R A;  2WCY A;  3OXF A;  1TBQ R;  3UEY A;  1TGS I;  5DAE A;  1Y8F A;  1HJA I;  1PTR A;  2SGE I;  4FKD A;  1UUC A;  5CCM A;  4SGB I;  5FUY A;  4GI3 C;  1NUB A;  1M8B A;  1YU6 C;  5JHW C;  2ENZ A;  2SGF I;  2QQD A;  2N52 A;  1V1I A;  1SGN I;  2M5X A;  2NU3 I;  2OVO A;  2F3C I;  5FUV A;  3VE5 A;  4A24 A;  2N1A B;  3SGB I;  1UVG A;  1OMT A;  1CSO I;  4UXH A;  2A20 A;  1XA6 A;  2ORW A;  5EX3 A;  2QPO A;  1XX6 A;  1W3S A;  3RU0 A;  2ELI A;  2NU4 I;  3VDP A;  3B4V C;  1LR9 A;  2ARP F;  3CXL A;  2DB6 A;  2BUS A;  1IY5 A;  4HGU A;  2DIP A;  1N13 A;  1KMA A;  1CGJ I;  4L9M A;  3UFF A;  2WVJ A;  2JXD A;  1CHO I;  5HQ8 A;  3VDU A;  1SGE I;  2P6A C;  4JCV E;  2OD1 A;  2SGQ I;  2NU2 I;  1TBN A;  5FUX A;  1U5K A;  3SEK C;  1BUS A;  1TUS A;  2JZM A;  1IW4 A;  1SGD I;  5CCL A;  1PTQ A;  4UXJ A;  3UEJ A;  1DS2 I;  3SGQ I;  1PCE A;  1TBR R;  2LUY A;  2NU1 I;  2SGD I;  2JA1 A;  1CE3 A;  1KBE A;  2V1C A;  5FUW A;  1HPT A;  1TOT A;  3OL0 A;  1R79 A;  1TUR A;  1BMO A;  3TJQ A;  2E73 A;  1LR8 A;  3UGI A;  5EX0 A;  1KBF A;  2FNF X;  1YTP A;  3BJI A;  1SGQ I;  2GVI A;  1UVF A;  1FYB A;  4E1P A;  1IY6 A;  1PPF I;  5HI7 A;  3QTL D;  4B6D A;  3OXG A;  1MT1 A;  1DS3 I;  1H0Z A;  2QQ0 A;  1M8C A;  2ODD A;  3FC3 A;  1LR7 A;  3GOX A;  1X4S A;  2ERW A;  1OVO A;  2V53 A;  2KCX A;  2ORV A;  2KMO A;  2N17 A;  1TBO A;  2L7X A;  2KMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...