2CJSC

Structural basis for a munc13-1 homodimer - munc13-1 - rim heterodimer switch: c2-domains as versatile protein-protein interaction modules
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
54
structure length
54
Chain Sequence
APTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLRSNKVMWVCNLCRKQQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UNC-13 HOMOLOG A
publication title Structural Basis for a Munc13-1 Homodimer to Munc13-1/Rim Heterodimer Switch.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Exocytosis
total genus 9
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2006-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.120 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2cjsC01
2CJSC 2A20A
chains in the Genus database with same CATH superfamily
1R0RI 1U5KA 1NUBA 1SGQI 1N13A 1CGII 1TBNA 5J8CA 1M8CA 1P9ZA 1HPTA 1W4RA 3TJQA 2B8TA 1TIHA 2CWHA 1PPFI 2OZUA 4UXJA 5FUYA 1CSOI 1PTQA 1R79A 2Y0MA 2KMPA 4AMLA 2KMOA 1FAQA 2N1AB 1KBEA 1IY6A 1MJ9A 1PTRA 2SGDI 1Y8FA 2KMQA 2NU3I 2SGPI 3OXLA 1PCEA 2NU0I 1CE3A 2V1CA 2JYYA 2M5XA 2OU2A 5DAEA 1TURA 1MJBA 5HI7A 3VDPA 4UXIA 3E2IA 1UUCA 1K7UA 1VDDA 1SGEI 2NU4I 2QPOA 2QQEA 1OVOA 3FSYA 3OVOA 2W0TA 2GKRI 1UHAA 1ULNA 3FSXA 3HH2C 1H0ZA 1XX6A 2GKVA 1TBQR 1UVFA 2ODDA 1KBFA 2LUYA 2N52A 3OL0A 1HJAI 1BUSA 2P6AC 1OMTA 1TBRR 2K9HA 1SGRI 4DNCA 5CCMA 1LR7A 2ORWA 3UEYA 4FKDA 1X74A 2ROWA 2WGCA 1FYBA 1P9GA 1ULMA 4OVOA 3SEKC 2YQPA 1WKXA 2KCXA 5E3RA 1OYVI 1CT2I 1NXUA 1Y1CA 2A20A 1PJUA 2LEOA 2UVOA 2J87A 1SGYI 3E59A 3B4VC 4B6DA 1TUSA 1OMUA 2ENNA 1CGJI 1SGPI 4JCVE 3UFFA 4A24A 7WGAA 4E1RA 5JHWC 1HEVA 1K7TA 1WTJA 1XBTA 5EX0A 1TOTA 2X3TA 3R5CA 2VRWB 2RIJA 1BMOA 2L8EA 1MJAA 1SGNI 4GI3C 3TO6A 2GKTI 1UVGA 2UZ3A 1MT1A 3SGQI 2SGFI 2OVOA 5HQ8A 2B0UC 1LR8A 2N17A 2SGQI 3PDNA 2CWFA 1W3SA 1Q9BA 2DB6A 5EX3A 2CJSC 3UEJA 2JA1A 1TGSI 3OXGA 1WGCA 1XA6A 2X52A 3QTLD 4UXHA 3FC3A 2ORVA 1RFHA 4E1PA 1Y1BA 2FNFX 2RC4A 3VDUA 5CCLA 1SGDI 2LB7A 2QQDA 4HGUA 5FUVA 3R5AA 2SGEI 3QWPA 2V53A 1CT4I 1TBOA 2OD1A 2F3CI 2PQ8A 3VE5A 3D00A 5E3PA 2WCYA 3MEKA 1ULKA 9WGAA 1WGTA 1S20A 5FUXA 2WVJA 3TOAA 2DIPA 3SGBI 1KMAA 2E5RA 5J8FA 2ERWA 2GIVA 1X4SA 2ARPF 1CHOI 1YU6C 4WP4A 2J9RA 2V1CC 5E3QA 2L7XA 3UGDA 1LR9A 4SGBI 3RU0A 1Z7KB 3QAHA 2E73A 3TO9A 3UGLA 2YUUA 1Z2IA 2CWGA 2NU2I 1K7VA 3R5DA 2NU1I 1V1IA 2DKVA 5FUWA 2ENZA 3UGIA 4MPIA 2GVIA 3CXLA 2JW6A 2JXDA 2ELIA 3TO7A 2KMRA 1FY7A 4L9MA 3UOEA 2BUSA 2QQCA 3KY9A 1DS3I 1FARA 2QQ0A 2N71A 3TOBA 1CT0I 1IY5A 1YTPA 3OXFA 1HDLA 1IW4A 3BJIA 2XRCA 1AN1I 3R5BA 1DS2I 1M8BA 2JZMA 3GOXA 1V1HA
chains in the Genus database with same CATH topology
1R0RI 1U5KA 1NUBA 1SGQI 1N13A 1CGII 1TBNA 1M8CA 1HPTA 1W4RA 3TJQA 2B8TA 1TIHA 1PPFI 4UXJA 5FUYA 1CSOI 1PTQA 1R79A 2KMPA 2KMOA 1FAQA 2N1AB 1KBEA 1IY6A 1PTRA 2SGDI 1Y8FA 2KMQA 2NU3I 2SGPI 3OXLA 1PCEA 2NU0I 1CE3A 2V1CA 2JYYA 2M5XA 5DAEA 1TURA 5HI7A 3VDPA 4UXIA 3E2IA 1UUCA 2NU4I 1VDDA 1SGEI 2QPOA 2QQEA 1OVOA 3OVOA 2W0TA 2GKRI 3HH2C 1H0ZA 1XX6A 2GKVA 1TBQR 1UVFA 2ODDA 1KBFA 2LUYA 2N52A 3OL0A 1HJAI 1BUSA 2P6AC 1OMTA 1TBRR 2K9HA 1SGRI 5CCMA 1LR7A 2ORWA 3UEYA 4FKDA 1X74A 2ROWA 1FYBA 4OVOA 3SEKC 2YQPA 2KCXA 1OYVI 1CT2I 1Y1CA 2A20A 1PJUA 2LEOA 2J87A 1SGYI 3E59A 3B4VC 4B6DA 1TUSA 1OMUA 2ENNA 1CGJI 1SGPI 4JCVE 3UFFA 4A24A 4E1RA 5JHWC 1XBTA 5EX0A 1TOTA 2VRWB 1BMOA 2L8EA 1SGNI 4GI3C 2GKTI 1UVGA 2UZ3A 1MT1A 3SGQI 2SGFI 2OVOA 5HQ8A 2B0UC 1LR8A 2N17A 2SGQI 3PDNA 1W3SA 2DB6A 5EX3A 2CJSC 3UEJA 2JA1A 1TGSI 3OXGA 1XA6A 3QTLD 4UXHA 3FC3A 2ORVA 1RFHA 4E1PA 1Y1BA 2FNFX 3VDUA 5CCLA 1SGDI 2QQDA 4HGUA 5FUVA 2SGEI 3QWPA 2V53A 1CT4I 1TBOA 2OD1A 2F3CI 3VE5A 3D00A 2WCYA 3MEKA 5FUXA 2WVJA 2DIPA 3SGBI 1KMAA 2E5RA 2ERWA 1X4SA 2ARPF 1CHOI 1YU6C 2J9RA 2V1CC 2L7XA 3UGDA 1LR9A 4SGBI 3RU0A 1Z7KB 2E73A 3UGLA 2YUUA 2NU2I 2NU1I 1V1IA 5FUWA 2ENZA 3UGIA 2GVIA 3CXLA 2JW6A 2JXDA 2ELIA 2KMRA 4L9MA 2BUSA 2QQCA 3KY9A 1DS3I 1FARA 2QQ0A 2N71A 1CT0I 1IY5A 1YTPA 3OXFA 1HDLA 1IW4A 3BJIA 2XRCA 1AN1I 1DS2I 1M8BA 2JZMA 3GOXA 1V1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CJS C;  2A20 A; 
#chains in the Genus database with same CATH topology
 1R0R I;  1U5K A;  1NUB A;  1SGQ I;  1N13 A;  1CGI I;  1TBN A;  5J8C A;  1M8C A;  1P9Z A;  1HPT A;  1W4R A;  3TJQ A;  2B8T A;  1TIH A;  2CWH A;  1PPF I;  2OZU A;  4UXJ A;  5FUY A;  1CSO I;  1PTQ A;  1R79 A;  2Y0M A;  2KMP A;  4AML A;  2KMO A;  1FAQ A;  2N1A B;  1KBE A;  1IY6 A;  1MJ9 A;  1PTR A;  2SGD I;  1Y8F A;  2KMQ A;  2NU3 I;  2SGP I;  3OXL A;  1PCE A;  2NU0 I;  1CE3 A;  2V1C A;  2JYY A;  2M5X A;  2OU2 A;  5DAE A;  1TUR A;  1MJB A;  5HI7 A;  3VDP A;  4UXI A;  3E2I A;  1UUC A;  1K7U A;  1VDD A;  1SGE I;  2NU4 I;  2QPO A;  2QQE A;  1OVO A;  3FSY A;  3OVO A;  2W0T A;  2GKR I;  1UHA A;  1ULN A;  3FSX A;  3HH2 C;  1H0Z A;  1XX6 A;  2GKV A;  1TBQ R;  1UVF A;  2ODD A;  1KBF A;  2LUY A;  2N52 A;  3OL0 A;  1HJA I;  1BUS A;  2P6A C;  1OMT A;  1TBR R;  2K9H A;  1SGR I;  4DNC A;  5CCM A;  1LR7 A;  2ORW A;  3UEY A;  4FKD A;  1X74 A;  2ROW A;  2WGC A;  1FYB A;  1P9G A;  1ULM A;  4OVO A;  3SEK C;  2YQP A;  1WKX A;  2KCX A;  5E3R A;  1OYV I;  1CT2 I;  1NXU A;  1Y1C A;  2A20 A;  1PJU A;  2LEO A;  2UVO A;  2J87 A;  1SGY I;  3E59 A;  3B4V C;  4B6D A;  1TUS A;  1OMU A;  2ENN A;  1CGJ I;  1SGP I;  4JCV E;  3UFF A;  4A24 A;  7WGA A;  4E1R A;  5JHW C;  1HEV A;  1K7T A;  1WTJ A;  1XBT A;  5EX0 A;  1TOT A;  2X3T A;  3R5C A;  2VRW B;  2RIJ A;  1BMO A;  2L8E A;  1MJA A;  1SGN I;  4GI3 C;  3TO6 A;  2GKT I;  1UVG A;  2UZ3 A;  1MT1 A;  3SGQ I;  2SGF I;  2OVO A;  5HQ8 A;  2B0U C;  1LR8 A;  2N17 A;  2SGQ I;  3PDN A;  2CWF A;  1W3S A;  1Q9B A;  2DB6 A;  5EX3 A;  2CJS C;  3UEJ A;  2JA1 A;  1TGS I;  3OXG A;  1WGC A;  1XA6 A;  2X52 A;  3QTL D;  4UXH A;  3FC3 A;  2ORV A;  1RFH A;  4E1P A;  1Y1B A;  2FNF X;  2RC4 A;  3VDU A;  5CCL A;  1SGD I;  2LB7 A;  2QQD A;  4HGU A;  5FUV A;  3R5A A;  2SGE I;  3QWP A;  2V53 A;  1CT4 I;  1TBO A;  2OD1 A;  2F3C I;  2PQ8 A;  3VE5 A;  3D00 A;  5E3P A;  2WCY A;  3MEK A;  1ULK A;  9WGA A;  1WGT A;  1S20 A;  5FUX A;  2WVJ A;  3TOA A;  2DIP A;  3SGB I;  1KMA A;  2E5R A;  5J8F A;  2ERW A;  2GIV A;  1X4S A;  2ARP F;  1CHO I;  1YU6 C;  4WP4 A;  2J9R A;  2V1C C;  5E3Q A;  2L7X A;  3UGD A;  1LR9 A;  4SGB I;  3RU0 A;  1Z7K B;  3QAH A;  2E73 A;  3TO9 A;  3UGL A;  2YUU A;  1Z2I A;  2CWG A;  2NU2 I;  1K7V A;  3R5D A;  2NU1 I;  1V1I A;  2DKV A;  5FUW A;  2ENZ A;  3UGI A;  4MPI A;  2GVI A;  3CXL A;  2JW6 A;  2JXD A;  2ELI A;  3TO7 A;  2KMR A;  1FY7 A;  4L9M A;  3UOE A;  2BUS A;  2QQC A;  3KY9 A;  1DS3 I;  1FAR A;  2QQ0 A;  2N71 A;  3TOB A;  1CT0 I;  1IY5 A;  1YTP A;  3OXF A;  1HDL A;  1IW4 A;  3BJI A;  2XRC A;  1AN1 I;  3R5B A;  1DS2 I;  1M8B A;  2JZM A;  3GOX A;  1V1H A; 
#chains in the Genus database with same CATH homology
 1R0R I;  1U5K A;  1NUB A;  1SGQ I;  1N13 A;  1CGI I;  1TBN A;  1M8C A;  1HPT A;  1W4R A;  3TJQ A;  2B8T A;  1TIH A;  1PPF I;  4UXJ A;  5FUY A;  1CSO I;  1PTQ A;  1R79 A;  2KMP A;  2KMO A;  1FAQ A;  2N1A B;  1KBE A;  1IY6 A;  1PTR A;  2SGD I;  1Y8F A;  2KMQ A;  2NU3 I;  2SGP I;  3OXL A;  1PCE A;  2NU0 I;  1CE3 A;  2V1C A;  2JYY A;  2M5X A;  5DAE A;  1TUR A;  5HI7 A;  3VDP A;  4UXI A;  3E2I A;  1UUC A;  2NU4 I;  1VDD A;  1SGE I;  2QPO A;  2QQE A;  1OVO A;  3OVO A;  2W0T A;  2GKR I;  3HH2 C;  1H0Z A;  1XX6 A;  2GKV A;  1TBQ R;  1UVF A;  2ODD A;  1KBF A;  2LUY A;  2N52 A;  3OL0 A;  1HJA I;  1BUS A;  2P6A C;  1OMT A;  1TBR R;  2K9H A;  1SGR I;  5CCM A;  1LR7 A;  2ORW A;  3UEY A;  4FKD A;  1X74 A;  2ROW A;  1FYB A;  4OVO A;  3SEK C;  2YQP A;  2KCX A;  1OYV I;  1CT2 I;  1Y1C A;  2A20 A;  1PJU A;  2LEO A;  2J87 A;  1SGY I;  3E59 A;  3B4V C;  4B6D A;  1TUS A;  1OMU A;  2ENN A;  1CGJ I;  1SGP I;  4JCV E;  3UFF A;  4A24 A;  4E1R A;  5JHW C;  1XBT A;  5EX0 A;  1TOT A;  2VRW B;  1BMO A;  2L8E A;  1SGN I;  4GI3 C;  2GKT I;  1UVG A;  2UZ3 A;  1MT1 A;  3SGQ I;  2SGF I;  2OVO A;  5HQ8 A;  2B0U C;  1LR8 A;  2N17 A;  2SGQ I;  3PDN A;  1W3S A;  2DB6 A;  5EX3 A;  2CJS C;  3UEJ A;  2JA1 A;  1TGS I;  3OXG A;  1XA6 A;  3QTL D;  4UXH A;  3FC3 A;  2ORV A;  1RFH A;  4E1P A;  1Y1B A;  2FNF X;  3VDU A;  5CCL A;  1SGD I;  2QQD A;  4HGU A;  5FUV A;  2SGE I;  3QWP A;  2V53 A;  1CT4 I;  1TBO A;  2OD1 A;  2F3C I;  3VE5 A;  3D00 A;  2WCY A;  3MEK A;  5FUX A;  2WVJ A;  2DIP A;  3SGB I;  1KMA A;  2E5R A;  2ERW A;  1X4S A;  2ARP F;  1CHO I;  1YU6 C;  2J9R A;  2V1C C;  2L7X A;  3UGD A;  1LR9 A;  4SGB I;  3RU0 A;  1Z7K B;  2E73 A;  3UGL A;  2YUU A;  2NU2 I;  2NU1 I;  1V1I A;  5FUW A;  2ENZ A;  3UGI A;  2GVI A;  3CXL A;  2JW6 A;  2JXD A;  2ELI A;  2KMR A;  4L9M A;  2BUS A;  2QQC A;  3KY9 A;  1DS3 I;  1FAR A;  2QQ0 A;  2N71 A;  1CT0 I;  1IY5 A;  1YTP A;  3OXF A;  1HDL A;  1IW4 A;  3BJI A;  2XRC A;  1AN1 I;  1DS2 I;  1M8B A;  2JZM A;  3GOX A;  1V1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...