1CE3A

Putative ancestral protein encoded by a single sequence repeat of the multidomain proteinase inhibitor from nicotiana alata
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
54
structure length
54
Chain Sequence
MKACTLNCDPRIAYGVCPRSEEKKNDRICTNCCAGTKGCKYFSDDGTFVCEGES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protease inhibitor
molecule keywords PROTEIN (API)
publication title Structure of a putative ancestral protein encoded by a single sequence repeat from a multidomain proteinase inhibitor gene from Nicotiana alata.
pubmed doi rcsb
source organism Nicotiana alata
total genus 6
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1999-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02428 Prot_inhib_II Potato type II proteinase inhibitor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1ce3A00
1CSOI 1OMUA 2JZMA 2SGEI 2NU3I 1MT1A 1FYBA 2NU1I 1PPFI 1IW4A 1BUSA 1OYVI 1SGRI 2N17A 1TIHA 1TURA 1Y1BA 3HH2C 3TJQA 2QQDA 2N52A 2WCYA 1CT0I 1SGEI 2KCXA 2NU4I 2OVOA 2KMOA 1LR8A 1CGJI 1HPTA 3B4VC 1KMAA 1DS3I 1SGPI 2LEOA 1R0RI 1Z7KB 2KMPA 1LR9A 1N13A 1TBQR 2ERWA 2V53A 2GKVA 1SGNI 2N71A 3QTLD 2NU0I 2XRCA 1AN1I 1M8BA 4GI3C 2KMRA 2GKRI 2KMQA 1H0ZA 4OVOA 1IY5A 1TGSI 2JXDA 1SGQI 2SGQI 2BUSA 2JYYA 1SGYI 1PCEA 1CGII 1IY6A 1HJAI 1TBRR 1TUSA 1Y1CA 2GKTI 2SGPI 1BMOA 3SGQI 1OMTA 2F3CI 1M8CA 2ARPF 1HDLA 1UUCA 2NU2I 1PJUA 1DS2I 1UVFA 3OVOA 1YU6C 2QQCA 3SGBI 1UVGA 1NUBA 2B0UC 5DAEA 1LR7A 3SEKC 5JHWC 4SGBI 1YTPA 1CT2I 1OVOA 1SGDI 2SGDI 2SGFI 2P6AC 1CT4I 1CHOI 1CE3A 4HGUA 2M5XA
chains in the Genus database with same CATH superfamily
3OXGA 1CSOI 1FARA 1OMUA 1Z2IA 2JZMA 3CXLA 4DNCA 1UHAA 1MJBA 1K7UA 2PQ8A 2NU3I 2OZUA 1MT1A 2CJSC 2SGEI 2Y0MA 5CCMA 2ORWA 1FYBA 2NU1I 1PPFI 3VE5A 7WGAA 1OYVI 1SGRI 2N17A 1TIHA 2YQPA 5HI7A 1TBNA 1BUSA 1K7VA 1TURA 1Y1BA 3R5AA 3HH2C 3TJQA 2ROWA 2QQDA 2N52A 3UOEA 2V1CA 1IW4A 1XBTA 1CT0I 1SGEI 2WCYA 1H0ZA 2KCXA 1R79A 2NU4I 1V1HA 2QQEA 2ELIA 1FAQA 1P9ZA 2OVOA 2E73A 4UXHA 2KMOA 3UFFA 2B8TA 1LR8A 1CGJI 3BJIA 1XX6A 3OL0A 2YUUA 1HPTA 3MEKA 3B4VC 3TO6A 1KMAA 1X4SA 2L7XA 1DS3I 1WGCA 1RFHA 1SGPI 5E3RA 4MPIA 3FC3A 3TOAA 1S20A 2LEOA 2OU2A 1R0RI 1ULKA 3QAHA 1Z7KB 2KMPA 5EX3A 2J87A 3UGDA 1ULMA 2L8EA 1LR9A 3RU0A 1N13A 2CWGA 1TBQR 2DB6A 3GOXA 2WVJA 2ENZA 2ERWA 2V53A 1TOTA 2GKVA 2VRWB 4WP4A 1MJ9A 2GVIA 2DKVA 1SGNI 1PTQA 2ODDA 2QPOA 3TOBA 2CWHA 2N71A 5CCLA 3E2IA 5FUVA 1W3SA 3QTLD 2NU0I 1NXUA 2ORVA 2XRCA 4B6DA 2J9RA 1PTRA 3E59A 3FSXA 1AN1I 1Q9BA 3R5CA 2LB7A 1M8BA 4GI3C 2JW6A 2GKRI 2KMRA 1K7TA 1WKXA 1P9GA 2KMQA 4OVOA 1IY5A 5J8FA 3D00A 1TGSI 2FNFX 2JXDA 1SGQI 2SGQI 3FSYA 2LUYA 1XA6A 3VDUA 2BUSA 2X3TA 2JYYA 3UGLA 2RIJA 3R5DA 1SGYI 1PCEA 2W0TA 3KY9A 1CGII 5E3PA 2X52A 1IY6A 1HJAI 1W4RA 1TBRR 1TUSA 1Y1CA 2GKTI 2UVOA 9WGAA 5FUYA 2RC4A 2SGPI 1BMOA 2JA1A 3SGQI 4UXIA 1OMTA 2QQ0A 2F3CI 5E3QA 1M8CA 3UGIA 2ARPF 1HDLA 5J8CA 1TBOA 1HEVA 1U5KA 4AMLA 1WGTA 2N1AB 1UUCA 2A20A 2K9HA 1VDDA 2NU2I 3VDPA 5EX0A 4A24A 3UEYA 2V1CC 1PJUA 3OXFA 1DS2I 4JCVE 1UVFA 2CWFA 1ULNA 2OD1A 3OVOA 3TO9A 4E1PA 3R5BA 1YU6C 1X74A 3QWPA 2QQCA 3SGBI 3PDNA 3OXLA 1UVGA 1NUBA 2B0UC 2DIPA 1LR7A 2UZ3A 5DAEA 3SEKC 4E1RA 5FUXA 3TO7A 1WTJA 4FKDA 1Y8FA 1V1IA 1FY7A 5JHWC 4SGBI 1MJAA 1YTPA 1CT2I 1OVOA 1SGDI 2SGDI 1KBFA 4UXJA 5HQ8A 2SGFI 2P6AC 2E5RA 1CT4I 4L9MA 5FUWA 1CHOI 2GIVA 1CE3A 3UEJA 1KBEA 4HGUA 2WGCA 2M5XA 2ENNA
chains in the Genus database with same CATH topology
3OXGA 1CSOI 1FARA 1OMUA 2JZMA 3CXLA 2SGEI 5CCMA 2NU3I 1MT1A 2CJSC 1FYBA 2ORWA 2NU1I 1PPFI 3VE5A 1BUSA 1OYVI 1SGRI 2N17A 1TIHA 2YQPA 5HI7A 1TBNA 1IW4A 1TURA 1Y1BA 3HH2C 3TJQA 2ROWA 2QQDA 2N52A 2V1CA 1XBTA 1CT0I 1SGEI 2WCYA 2KCXA 1R79A 2NU4I 1V1HA 2QQEA 2ELIA 1FAQA 2OVOA 2E73A 4UXHA 2KMOA 3UFFA 2B8TA 1LR8A 1CGJI 3BJIA 1XX6A 3OL0A 2YUUA 1HPTA 3MEKA 3B4VC 1KMAA 1X4SA 2L7XA 1DS3I 1RFHA 1SGPI 3FC3A 2LEOA 1R0RI 1Z7KB 2KMPA 5EX3A 2J87A 3UGDA 2L8EA 1LR9A 3RU0A 1N13A 2DB6A 1TBQR 3GOXA 2WVJA 2ENZA 2ERWA 2V53A 1TOTA 2GKVA 2VRWB 2GVIA 1SGNI 1PTQA 2ODDA 2QPOA 2N71A 5CCLA 3E2IA 5FUVA 1W3SA 3QTLD 2NU0I 2ORVA 2XRCA 4B6DA 2J9RA 1PTRA 3E59A 1AN1I 1M8BA 4GI3C 2JW6A 2GKRI 2KMRA 2KMQA 1H0ZA 4OVOA 1IY5A 3D00A 1TGSI 2FNFX 2JXDA 1SGQI 2SGQI 2LUYA 1XA6A 3VDUA 2BUSA 2JYYA 3UGLA 1SGYI 1PCEA 2W0TA 3KY9A 1CGII 1IY6A 1HJAI 1W4RA 1TBRR 1TUSA 1Y1CA 2GKTI 5FUYA 2SGPI 1BMOA 2JA1A 3SGQI 4UXIA 1OMTA 2QQ0A 2F3CI 3UGIA 1M8CA 2ARPF 1HDLA 1TBOA 1U5KA 2N1AB 1UUCA 2A20A 2K9HA 1VDDA 2NU2I 3VDPA 5EX0A 4A24A 3UEYA 2V1CC 1PJUA 3OXFA 1DS2I 4JCVE 1UVFA 2OD1A 3OVOA 4E1PA 1YU6C 1X74A 3QWPA 2QQCA 3SGBI 3PDNA 3OXLA 1UVGA 1NUBA 2B0UC 2DIPA 1LR7A 2UZ3A 5DAEA 3SEKC 4E1RA 5FUXA 4FKDA 1Y8FA 1V1IA 5JHWC 4SGBI 1YTPA 1CT2I 1OVOA 1SGDI 2SGDI 1KBFA 4UXJA 5HQ8A 2SGFI 2P6AC 2E5RA 1CT4I 4L9MA 5FUWA 1CHOI 1CE3A 3UEJA 1KBEA 4HGUA 2M5XA 2ENNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CSO I;  1OMU A;  2JZM A;  2SGE I;  2NU3 I;  1MT1 A;  1FYB A;  2NU1 I;  1PPF I;  1IW4 A;  1BUS A;  1OYV I;  1SGR I;  2N17 A;  1TIH A;  1TUR A;  1Y1B A;  3HH2 C;  3TJQ A;  2QQD A;  2N52 A;  2WCY A;  1CT0 I;  1SGE I;  2KCX A;  2NU4 I;  2OVO A;  2KMO A;  1LR8 A;  1CGJ I;  1HPT A;  3B4V C;  1KMA A;  1DS3 I;  1SGP I;  2LEO A;  1R0R I;  1Z7K B;  2KMP A;  1LR9 A;  1N13 A;  1TBQ R;  2ERW A;  2V53 A;  2GKV A;  1SGN I;  2N71 A;  3QTL D;  2NU0 I;  2XRC A;  1AN1 I;  1M8B A;  4GI3 C;  2KMR A;  2GKR I;  2KMQ A;  1H0Z A;  4OVO A;  1IY5 A;  1TGS I;  2JXD A;  1SGQ I;  2SGQ I;  2BUS A;  2JYY A;  1SGY I;  1PCE A;  1CGI I;  1IY6 A;  1HJA I;  1TBR R;  1TUS A;  1Y1C A;  2GKT I;  2SGP I;  1BMO A;  3SGQ I;  1OMT A;  2F3C I;  1M8C A;  2ARP F;  1HDL A;  1UUC A;  2NU2 I;  1PJU A;  1DS2 I;  1UVF A;  3OVO A;  1YU6 C;  2QQC A;  3SGB I;  1UVG A;  1NUB A;  2B0U C;  5DAE A;  1LR7 A;  3SEK C;  5JHW C;  4SGB I;  1YTP A;  1CT2 I;  1OVO A;  1SGD I;  2SGD I;  2SGF I;  2P6A C;  1CT4 I;  1CHO I;  1CE3 A;  4HGU A;  2M5X A; 
#chains in the Genus database with same CATH topology
 3OXG A;  1CSO I;  1FAR A;  1OMU A;  1Z2I A;  2JZM A;  3CXL A;  4DNC A;  1UHA A;  1MJB A;  1K7U A;  2PQ8 A;  2NU3 I;  2OZU A;  1MT1 A;  2CJS C;  2SGE I;  2Y0M A;  5CCM A;  2ORW A;  1FYB A;  2NU1 I;  1PPF I;  3VE5 A;  7WGA A;  1OYV I;  1SGR I;  2N17 A;  1TIH A;  2YQP A;  5HI7 A;  1TBN A;  1BUS A;  1K7V A;  1TUR A;  1Y1B A;  3R5A A;  3HH2 C;  3TJQ A;  2ROW A;  2QQD A;  2N52 A;  3UOE A;  2V1C A;  1IW4 A;  1XBT A;  1CT0 I;  1SGE I;  2WCY A;  1H0Z A;  2KCX A;  1R79 A;  2NU4 I;  1V1H A;  2QQE A;  2ELI A;  1FAQ A;  1P9Z A;  2OVO A;  2E73 A;  4UXH A;  2KMO A;  3UFF A;  2B8T A;  1LR8 A;  1CGJ I;  3BJI A;  1XX6 A;  3OL0 A;  2YUU A;  1HPT A;  3MEK A;  3B4V C;  3TO6 A;  1KMA A;  1X4S A;  2L7X A;  1DS3 I;  1WGC A;  1RFH A;  1SGP I;  5E3R A;  4MPI A;  3FC3 A;  3TOA A;  1S20 A;  2LEO A;  2OU2 A;  1R0R I;  1ULK A;  3QAH A;  1Z7K B;  2KMP A;  5EX3 A;  2J87 A;  3UGD A;  1ULM A;  2L8E A;  1LR9 A;  3RU0 A;  1N13 A;  2CWG A;  1TBQ R;  2DB6 A;  3GOX A;  2WVJ A;  2ENZ A;  2ERW A;  2V53 A;  1TOT A;  2GKV A;  2VRW B;  4WP4 A;  1MJ9 A;  2GVI A;  2DKV A;  1SGN I;  1PTQ A;  2ODD A;  2QPO A;  3TOB A;  2CWH A;  2N71 A;  5CCL A;  3E2I A;  5FUV A;  1W3S A;  3QTL D;  2NU0 I;  1NXU A;  2ORV A;  2XRC A;  4B6D A;  2J9R A;  1PTR A;  3E59 A;  3FSX A;  1AN1 I;  1Q9B A;  3R5C A;  2LB7 A;  1M8B A;  4GI3 C;  2JW6 A;  2GKR I;  2KMR A;  1K7T A;  1WKX A;  1P9G A;  2KMQ A;  4OVO A;  1IY5 A;  5J8F A;  3D00 A;  1TGS I;  2FNF X;  2JXD A;  1SGQ I;  2SGQ I;  3FSY A;  2LUY A;  1XA6 A;  3VDU A;  2BUS A;  2X3T A;  2JYY A;  3UGL A;  2RIJ A;  3R5D A;  1SGY I;  1PCE A;  2W0T A;  3KY9 A;  1CGI I;  5E3P A;  2X52 A;  1IY6 A;  1HJA I;  1W4R A;  1TBR R;  1TUS A;  1Y1C A;  2GKT I;  2UVO A;  9WGA A;  5FUY A;  2RC4 A;  2SGP I;  1BMO A;  2JA1 A;  3SGQ I;  4UXI A;  1OMT A;  2QQ0 A;  2F3C I;  5E3Q A;  1M8C A;  3UGI A;  2ARP F;  1HDL A;  5J8C A;  1TBO A;  1HEV A;  1U5K A;  4AML A;  1WGT A;  2N1A B;  1UUC A;  2A20 A;  2K9H A;  1VDD A;  2NU2 I;  3VDP A;  5EX0 A;  4A24 A;  3UEY A;  2V1C C;  1PJU A;  3OXF A;  1DS2 I;  4JCV E;  1UVF A;  2CWF A;  1ULN A;  2OD1 A;  3OVO A;  3TO9 A;  4E1P A;  3R5B A;  1YU6 C;  1X74 A;  3QWP A;  2QQC A;  3SGB I;  3PDN A;  3OXL A;  1UVG A;  1NUB A;  2B0U C;  2DIP A;  1LR7 A;  2UZ3 A;  5DAE A;  3SEK C;  4E1R A;  5FUX A;  3TO7 A;  1WTJ A;  4FKD A;  1Y8F A;  1V1I A;  1FY7 A;  5JHW C;  4SGB I;  1MJA A;  1YTP A;  1CT2 I;  1OVO A;  1SGD I;  2SGD I;  1KBF A;  4UXJ A;  5HQ8 A;  2SGF I;  2P6A C;  2E5R A;  1CT4 I;  4L9M A;  5FUW A;  1CHO I;  2GIV A;  1CE3 A;  3UEJ A;  1KBE A;  4HGU A;  2WGC A;  2M5X A;  2ENN A; 
#chains in the Genus database with same CATH homology
 3OXG A;  1CSO I;  1FAR A;  1OMU A;  2JZM A;  3CXL A;  2SGE I;  5CCM A;  2NU3 I;  1MT1 A;  2CJS C;  1FYB A;  2ORW A;  2NU1 I;  1PPF I;  3VE5 A;  1BUS A;  1OYV I;  1SGR I;  2N17 A;  1TIH A;  2YQP A;  5HI7 A;  1TBN A;  1IW4 A;  1TUR A;  1Y1B A;  3HH2 C;  3TJQ A;  2ROW A;  2QQD A;  2N52 A;  2V1C A;  1XBT A;  1CT0 I;  1SGE I;  2WCY A;  2KCX A;  1R79 A;  2NU4 I;  1V1H A;  2QQE A;  2ELI A;  1FAQ A;  2OVO A;  2E73 A;  4UXH A;  2KMO A;  3UFF A;  2B8T A;  1LR8 A;  1CGJ I;  3BJI A;  1XX6 A;  3OL0 A;  2YUU A;  1HPT A;  3MEK A;  3B4V C;  1KMA A;  1X4S A;  2L7X A;  1DS3 I;  1RFH A;  1SGP I;  3FC3 A;  2LEO A;  1R0R I;  1Z7K B;  2KMP A;  5EX3 A;  2J87 A;  3UGD A;  2L8E A;  1LR9 A;  3RU0 A;  1N13 A;  2DB6 A;  1TBQ R;  3GOX A;  2WVJ A;  2ENZ A;  2ERW A;  2V53 A;  1TOT A;  2GKV A;  2VRW B;  2GVI A;  1SGN I;  1PTQ A;  2ODD A;  2QPO A;  2N71 A;  5CCL A;  3E2I A;  5FUV A;  1W3S A;  3QTL D;  2NU0 I;  2ORV A;  2XRC A;  4B6D A;  2J9R A;  1PTR A;  3E59 A;  1AN1 I;  1M8B A;  4GI3 C;  2JW6 A;  2GKR I;  2KMR A;  2KMQ A;  1H0Z A;  4OVO A;  1IY5 A;  3D00 A;  1TGS I;  2FNF X;  2JXD A;  1SGQ I;  2SGQ I;  2LUY A;  1XA6 A;  3VDU A;  2BUS A;  2JYY A;  3UGL A;  1SGY I;  1PCE A;  2W0T A;  3KY9 A;  1CGI I;  1IY6 A;  1HJA I;  1W4R A;  1TBR R;  1TUS A;  1Y1C A;  2GKT I;  5FUY A;  2SGP I;  1BMO A;  2JA1 A;  3SGQ I;  4UXI A;  1OMT A;  2QQ0 A;  2F3C I;  3UGI A;  1M8C A;  2ARP F;  1HDL A;  1TBO A;  1U5K A;  2N1A B;  1UUC A;  2A20 A;  2K9H A;  1VDD A;  2NU2 I;  3VDP A;  5EX0 A;  4A24 A;  3UEY A;  2V1C C;  1PJU A;  3OXF A;  1DS2 I;  4JCV E;  1UVF A;  2OD1 A;  3OVO A;  4E1P A;  1YU6 C;  1X74 A;  3QWP A;  2QQC A;  3SGB I;  3PDN A;  3OXL A;  1UVG A;  1NUB A;  2B0U C;  2DIP A;  1LR7 A;  2UZ3 A;  5DAE A;  3SEK C;  4E1R A;  5FUX A;  4FKD A;  1Y8F A;  1V1I A;  5JHW C;  4SGB I;  1YTP A;  1CT2 I;  1OVO A;  1SGD I;  2SGD I;  1KBF A;  4UXJ A;  5HQ8 A;  2SGF I;  2P6A C;  2E5R A;  1CT4 I;  4L9M A;  5FUW A;  1CHO I;  1CE3 A;  3UEJ A;  1KBE A;  4HGU A;  2M5X A;  2ENN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...