1CE3A

Putative ancestral protein encoded by a single sequence repeat of the multidomain proteinase inhibitor from nicotiana alata
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
54
structure length
54
Chain Sequence
MKACTLNCDPRIAYGVCPRSEEKKNDRICTNCCAGTKGCKYFSDDGTFVCEGES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (API)
publication title Structure of a putative ancestral protein encoded by a single sequence repeat from a multidomain proteinase inhibitor gene from Nicotiana alata.
pubmed doi rcsb
source organism Nicotiana alata
molecule tags Protease inhibitor
total genus 6
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1999-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02428 Prot_inhib_II Potato type II proteinase inhibitor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1ce3A00
1H0ZA 5DAEA 1SGPI 2NU2I 1M8BA 2SGFI 1BUSA 2N52A 2JXDA 1N13A 2XRCA 3QTLD 1UVGA 3SGQI 1AN1I 2SGEI 1OVOA 2SGPI 2NU0I 2V53A 2WCYA 1R0RI 2KMRA 1TURA 1DS2I 2GKVA 1TGSI 2F3CI 2SGDI 2NU1I 2NU3I 2QQCA 1LR9A 2KMQA 1CGJI 2JYYA 1Y1BA 2OVOA 1IY5A 1IY6A 1TIHA 1CT4I 1SGQI 1OYVI 1TBQR 4GI3C 2ERWA 3TJQA 1NUBA 2JZMA 1BMOA 1LR8A 1CT2I 2N71A 2B0UC 4HGUA 1IW4A 1HDLA 1PJUA 3SGBI 1SGEI 1TBRR 2LEOA 1DS3I 2KMOA 5JHWC 1CT0I 1SGYI 1CHOI 2KCXA 2N17A 2SGQI 3HH2C 2GKRI 2GKTI 1YU6C 4SGBI 1M8CA 2BUSA 1LR7A 2QQDA 1MT1A 2KMPA 1PPFI 1SGNI 2P6AC 1KMAA 2ARPF 1CE3A 1OMTA 3SEKC 1HJAI 1SGDI 4OVOA 3B4VC 1OMUA 1UUCA 1YTPA 1CGII 1CSOI 2M5XA 1TUSA 1Z7KB 1HPTA 1PCEA 3OVOA 1Y1CA 1SGRI 2NU4I 1UVFA 1FYBA
chains in the Genus database with same CATH superfamily
2LUYA 2DKVA 1H0ZA 3VDUA 2QQ0A 1WKXA 5DAEA 1SGPI 2LB7A 1Z2IA 2NU2I 3UGLA 3TO9A 2ODDA 1M8BA 2SGFI 2ORWA 1BUSA 3BJIA 3UGDA 1MJ9A 2N52A 2JXDA 1N13A 2OU2A 2XRCA 3QTLD 1UVGA 1FARA 3FSXA 2DB6A 2ORVA 4WP4A 1KBFA 3SGQI 1AN1I 3R5CA 2SGEI 4E1RA 1OVOA 2SGPI 2GVIA 2NU0I 2V53A 1W3SA 3MEKA 2WCYA 2ROWA 1R0RI 2WGCA 1TOTA 2KMRA 1TURA 3R5AA 1Q9BA 1WGTA 2CJSC 2K9HA 1DS2I 2GKVA 3UOEA 2ENNA 3TO7A 4JCVE 1TGSI 2F3CI 2SGDI 2X3TA 2NU1I 2NU3I 3PDNA 3UGIA 5FUYA 3RU0A 2QQCA 5EX0A 1XBTA 1LR9A 2KMQA 1CGJI 1NXUA 1WTJA 4DNCA 1PTRA 2JYYA 1Y1BA 2OVOA 2L8EA 1IY5A 1TIHA 1W4RA 2JA1A 1IY6A 1CT4I 1SGQI 2GIVA 1OYVI 1TBQR 4GI3C 2ERWA 4A24A 1XA6A 2CWHA 2X52A 1NUBA 3TJQA 2JZMA 4E1PA 5HQ8A 1TBNA 1FAQA 1HEVA 9WGAA 3FC3A 1BMOA 5J8FA 1LR8A 1MJBA 1CT2I 2N71A 2YUUA 2L7XA 1U5KA 1TBOA 2B0UC 1S20A 1K7UA 4HGUA 1IW4A 4B6DA 3UFFA 5FUXA 2UZ3A 1HDLA 3E2IA 1PJUA 3D00A 3R5BA 2N1AB 1XX6A 3SGBI 5EX3A 4L9MA 1SGEI 1KBEA 1TBRR 2LEOA 1DS3I 4FKDA 2UVOA 2A20A 2VRWB 1X4SA 1MJAA 2KMOA 4UXIA 7WGAA 5JHWC 1CT0I 1P9ZA 5E3RA 1SGYI 1WGCA 2FNFX 1CHOI 3OXGA 2KCXA 2OZUA 3QWPA 2J87A 2E5RA 2E73A 1K7TA 2N17A 4MPIA 2SGQI 2J9RA 3HH2C 1PTQA 2GKRI 2ELIA 3OXLA 3UEYA 2ENZA 2GKTI 1V1HA 1YU6C 3OXFA 4SGBI 1M8CA 5FUVA 2BUSA 1LR7A 2QQDA 3GOXA 3QAHA 1MT1A 5J8CA 2KMPA 1PPFI 1SGNI 2P6AC 1K7VA 3FSYA 2ARPF 1ULKA 1KMAA 1CE3A 2V1CA 1Y8FA 3CXLA 3R5DA 1ULNA 2V1CC 2B8TA 4UXJA 1X74A 3E59A 3TOAA 1OMTA 2DIPA 5FUWA 1HJAI 3SEKC 5E3QA 1ULMA 2JW6A 1SGDI 3TOBA 2WVJA 2Y0MA 2RC4A 1UHAA 3UEJA 5E3PA 5CCMA 1R79A 3VE5A 1P9GA 4AMLA 4OVOA 3B4VC 1OMUA 1UUCA 3KY9A 1YTPA 5HI7A 2QPOA 2W0TA 1CGII 1CSOI 2M5XA 1TUSA 1V1IA 1Z7KB 3VDPA 1HPTA 2PQ8A 1PCEA 3OVOA 1Y1CA 1SGRI 2QQEA 2NU4I 2OD1A 3OL0A 1UVFA 4UXHA 1FY7A 2CWFA 2RIJA 1FYBA 2CWGA 1RFHA 2YQPA 3TO6A 5CCLA 1VDDA
chains in the Genus database with same CATH topology
2LUYA 1H0ZA 3VDUA 2QQ0A 5DAEA 1SGPI 3UGLA 2NU2I 2ODDA 1M8BA 2SGFI 2ORWA 1BUSA 3BJIA 3UGDA 2N52A 2JXDA 1N13A 2XRCA 3QTLD 1UVGA 1FARA 2DB6A 2ORVA 1KBFA 3SGQI 1AN1I 2SGEI 4E1RA 1OVOA 2SGPI 2GVIA 2NU0I 2V53A 1W3SA 3MEKA 2WCYA 2ROWA 1R0RI 1TOTA 2KMRA 1TURA 2CJSC 2K9HA 1DS2I 2GKVA 2ENNA 4JCVE 1TGSI 2F3CI 2SGDI 2NU1I 2NU3I 3PDNA 3UGIA 5FUYA 3RU0A 2QQCA 5EX0A 1XBTA 1LR9A 2KMQA 1CGJI 1PTRA 2JYYA 1Y1BA 2OVOA 2L8EA 1IY5A 1TIHA 1W4RA 2JA1A 1IY6A 1CT4I 1SGQI 1OYVI 1TBQR 4GI3C 2ERWA 4A24A 1XA6A 3TJQA 1NUBA 4E1PA 2JZMA 5HQ8A 1TBNA 1FAQA 3FC3A 1BMOA 1LR8A 1CT2I 2N71A 2YUUA 2L7XA 1U5KA 1TBOA 2B0UC 4HGUA 1IW4A 4B6DA 3UFFA 5FUXA 2UZ3A 1HDLA 3E2IA 1PJUA 3D00A 2N1AB 1XX6A 3SGBI 5EX3A 4L9MA 1SGEI 1KBEA 1TBRR 2LEOA 1DS3I 4FKDA 2A20A 2VRWB 1X4SA 2KMOA 4UXIA 5JHWC 1CT0I 1SGYI 2FNFX 1CHOI 3OXGA 2KCXA 3QWPA 2J87A 2E5RA 2E73A 2N17A 2SGQI 2J9RA 3HH2C 1PTQA 2GKRI 2ELIA 3OXLA 3UEYA 2ENZA 2GKTI 1V1HA 1YU6C 3OXFA 4SGBI 1M8CA 5FUVA 2BUSA 1LR7A 2QQDA 3GOXA 1MT1A 2KMPA 1PPFI 1SGNI 2P6AC 1KMAA 2ARPF 1CE3A 2V1CA 1Y8FA 3CXLA 2V1CC 2B8TA 4UXJA 1X74A 3E59A 1OMTA 2DIPA 5FUWA 1HJAI 3SEKC 2JW6A 1SGDI 2WVJA 3UEJA 5CCMA 1R79A 3VE5A 4OVOA 3B4VC 1OMUA 1UUCA 3KY9A 1YTPA 5HI7A 2QPOA 2W0TA 1CGII 1CSOI 2M5XA 1TUSA 1V1IA 1Z7KB 3VDPA 1HPTA 1PCEA 3OVOA 1Y1CA 1SGRI 2QQEA 2NU4I 2OD1A 3OL0A 1UVFA 4UXHA 1FYBA 1RFHA 2YQPA 5CCLA 1VDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H0Z A;  5DAE A;  1SGP I;  2NU2 I;  1M8B A;  2SGF I;  1BUS A;  2N52 A;  2JXD A;  1N13 A;  2XRC A;  3QTL D;  1UVG A;  3SGQ I;  1AN1 I;  2SGE I;  1OVO A;  2SGP I;  2NU0 I;  2V53 A;  2WCY A;  1R0R I;  2KMR A;  1TUR A;  1DS2 I;  2GKV A;  1TGS I;  2F3C I;  2SGD I;  2NU1 I;  2NU3 I;  2QQC A;  1LR9 A;  2KMQ A;  1CGJ I;  2JYY A;  1Y1B A;  2OVO A;  1IY5 A;  1IY6 A;  1TIH A;  1CT4 I;  1SGQ I;  1OYV I;  1TBQ R;  4GI3 C;  2ERW A;  3TJQ A;  1NUB A;  2JZM A;  1BMO A;  1LR8 A;  1CT2 I;  2N71 A;  2B0U C;  4HGU A;  1IW4 A;  1HDL A;  1PJU A;  3SGB I;  1SGE I;  1TBR R;  2LEO A;  1DS3 I;  2KMO A;  5JHW C;  1CT0 I;  1SGY I;  1CHO I;  2KCX A;  2N17 A;  2SGQ I;  3HH2 C;  2GKR I;  2GKT I;  1YU6 C;  4SGB I;  1M8C A;  2BUS A;  1LR7 A;  2QQD A;  1MT1 A;  2KMP A;  1PPF I;  1SGN I;  2P6A C;  1KMA A;  2ARP F;  1CE3 A;  1OMT A;  3SEK C;  1HJA I;  1SGD I;  4OVO A;  3B4V C;  1OMU A;  1UUC A;  1YTP A;  1CGI I;  1CSO I;  2M5X A;  1TUS A;  1Z7K B;  1HPT A;  1PCE A;  3OVO A;  1Y1C A;  1SGR I;  2NU4 I;  1UVF A;  1FYB A; 
#chains in the Genus database with same CATH topology
 2LUY A;  2DKV A;  1H0Z A;  3VDU A;  2QQ0 A;  1WKX A;  5DAE A;  1SGP I;  2LB7 A;  1Z2I A;  2NU2 I;  3UGL A;  3TO9 A;  2ODD A;  1M8B A;  2SGF I;  2ORW A;  1BUS A;  3BJI A;  3UGD A;  1MJ9 A;  2N52 A;  2JXD A;  1N13 A;  2OU2 A;  2XRC A;  3QTL D;  1UVG A;  1FAR A;  3FSX A;  2DB6 A;  2ORV A;  4WP4 A;  1KBF A;  3SGQ I;  1AN1 I;  3R5C A;  2SGE I;  4E1R A;  1OVO A;  2SGP I;  2GVI A;  2NU0 I;  2V53 A;  1W3S A;  3MEK A;  2WCY A;  2ROW A;  1R0R I;  2WGC A;  1TOT A;  2KMR A;  1TUR A;  3R5A A;  1Q9B A;  1WGT A;  2CJS C;  2K9H A;  1DS2 I;  2GKV A;  3UOE A;  2ENN A;  3TO7 A;  4JCV E;  1TGS I;  2F3C I;  2SGD I;  2X3T A;  2NU1 I;  2NU3 I;  3PDN A;  3UGI A;  5FUY A;  3RU0 A;  2QQC A;  5EX0 A;  1XBT A;  1LR9 A;  2KMQ A;  1CGJ I;  1NXU A;  1WTJ A;  4DNC A;  1PTR A;  2JYY A;  1Y1B A;  2OVO A;  2L8E A;  1IY5 A;  1TIH A;  1W4R A;  2JA1 A;  1IY6 A;  1CT4 I;  1SGQ I;  2GIV A;  1OYV I;  1TBQ R;  4GI3 C;  2ERW A;  4A24 A;  1XA6 A;  2CWH A;  2X52 A;  1NUB A;  3TJQ A;  2JZM A;  4E1P A;  5HQ8 A;  1TBN A;  1FAQ A;  1HEV A;  9WGA A;  3FC3 A;  1BMO A;  5J8F A;  1LR8 A;  1MJB A;  1CT2 I;  2N71 A;  2YUU A;  2L7X A;  1U5K A;  1TBO A;  2B0U C;  1S20 A;  1K7U A;  4HGU A;  1IW4 A;  4B6D A;  3UFF A;  5FUX A;  2UZ3 A;  1HDL A;  3E2I A;  1PJU A;  3D00 A;  3R5B A;  2N1A B;  1XX6 A;  3SGB I;  5EX3 A;  4L9M A;  1SGE I;  1KBE A;  1TBR R;  2LEO A;  1DS3 I;  4FKD A;  2UVO A;  2A20 A;  2VRW B;  1X4S A;  1MJA A;  2KMO A;  4UXI A;  7WGA A;  5JHW C;  1CT0 I;  1P9Z A;  5E3R A;  1SGY I;  1WGC A;  2FNF X;  1CHO I;  3OXG A;  2KCX A;  2OZU A;  3QWP A;  2J87 A;  2E5R A;  2E73 A;  1K7T A;  2N17 A;  4MPI A;  2SGQ I;  2J9R A;  3HH2 C;  1PTQ A;  2GKR I;  2ELI A;  3OXL A;  3UEY A;  2ENZ A;  2GKT I;  1V1H A;  1YU6 C;  3OXF A;  4SGB I;  1M8C A;  5FUV A;  2BUS A;  1LR7 A;  2QQD A;  3GOX A;  3QAH A;  1MT1 A;  5J8C A;  2KMP A;  1PPF I;  1SGN I;  2P6A C;  1K7V A;  3FSY A;  2ARP F;  1ULK A;  1KMA A;  1CE3 A;  2V1C A;  1Y8F A;  3CXL A;  3R5D A;  1ULN A;  2V1C C;  2B8T A;  4UXJ A;  1X74 A;  3E59 A;  3TOA A;  1OMT A;  2DIP A;  5FUW A;  1HJA I;  3SEK C;  5E3Q A;  1ULM A;  2JW6 A;  1SGD I;  3TOB A;  2WVJ A;  2Y0M A;  2RC4 A;  1UHA A;  3UEJ A;  5E3P A;  5CCM A;  1R79 A;  3VE5 A;  1P9G A;  4AML A;  4OVO A;  3B4V C;  1OMU A;  1UUC A;  3KY9 A;  1YTP A;  5HI7 A;  2QPO A;  2W0T A;  1CGI I;  1CSO I;  2M5X A;  1TUS A;  1V1I A;  1Z7K B;  3VDP A;  1HPT A;  2PQ8 A;  1PCE A;  3OVO A;  1Y1C A;  1SGR I;  2QQE A;  2NU4 I;  2OD1 A;  3OL0 A;  1UVF A;  4UXH A;  1FY7 A;  2CWF A;  2RIJ A;  1FYB A;  2CWG A;  1RFH A;  2YQP A;  3TO6 A;  5CCL A;  1VDD A; 
#chains in the Genus database with same CATH homology
 2LUY A;  1H0Z A;  3VDU A;  2QQ0 A;  5DAE A;  1SGP I;  3UGL A;  2NU2 I;  2ODD A;  1M8B A;  2SGF I;  2ORW A;  1BUS A;  3BJI A;  3UGD A;  2N52 A;  2JXD A;  1N13 A;  2XRC A;  3QTL D;  1UVG A;  1FAR A;  2DB6 A;  2ORV A;  1KBF A;  3SGQ I;  1AN1 I;  2SGE I;  4E1R A;  1OVO A;  2SGP I;  2GVI A;  2NU0 I;  2V53 A;  1W3S A;  3MEK A;  2WCY A;  2ROW A;  1R0R I;  1TOT A;  2KMR A;  1TUR A;  2CJS C;  2K9H A;  1DS2 I;  2GKV A;  2ENN A;  4JCV E;  1TGS I;  2F3C I;  2SGD I;  2NU1 I;  2NU3 I;  3PDN A;  3UGI A;  5FUY A;  3RU0 A;  2QQC A;  5EX0 A;  1XBT A;  1LR9 A;  2KMQ A;  1CGJ I;  1PTR A;  2JYY A;  1Y1B A;  2OVO A;  2L8E A;  1IY5 A;  1TIH A;  1W4R A;  2JA1 A;  1IY6 A;  1CT4 I;  1SGQ I;  1OYV I;  1TBQ R;  4GI3 C;  2ERW A;  4A24 A;  1XA6 A;  3TJQ A;  1NUB A;  4E1P A;  2JZM A;  5HQ8 A;  1TBN A;  1FAQ A;  3FC3 A;  1BMO A;  1LR8 A;  1CT2 I;  2N71 A;  2YUU A;  2L7X A;  1U5K A;  1TBO A;  2B0U C;  4HGU A;  1IW4 A;  4B6D A;  3UFF A;  5FUX A;  2UZ3 A;  1HDL A;  3E2I A;  1PJU A;  3D00 A;  2N1A B;  1XX6 A;  3SGB I;  5EX3 A;  4L9M A;  1SGE I;  1KBE A;  1TBR R;  2LEO A;  1DS3 I;  4FKD A;  2A20 A;  2VRW B;  1X4S A;  2KMO A;  4UXI A;  5JHW C;  1CT0 I;  1SGY I;  2FNF X;  1CHO I;  3OXG A;  2KCX A;  3QWP A;  2J87 A;  2E5R A;  2E73 A;  2N17 A;  2SGQ I;  2J9R A;  3HH2 C;  1PTQ A;  2GKR I;  2ELI A;  3OXL A;  3UEY A;  2ENZ A;  2GKT I;  1V1H A;  1YU6 C;  3OXF A;  4SGB I;  1M8C A;  5FUV A;  2BUS A;  1LR7 A;  2QQD A;  3GOX A;  1MT1 A;  2KMP A;  1PPF I;  1SGN I;  2P6A C;  1KMA A;  2ARP F;  1CE3 A;  2V1C A;  1Y8F A;  3CXL A;  2V1C C;  2B8T A;  4UXJ A;  1X74 A;  3E59 A;  1OMT A;  2DIP A;  5FUW A;  1HJA I;  3SEK C;  2JW6 A;  1SGD I;  2WVJ A;  3UEJ A;  5CCM A;  1R79 A;  3VE5 A;  4OVO A;  3B4V C;  1OMU A;  1UUC A;  3KY9 A;  1YTP A;  5HI7 A;  2QPO A;  2W0T A;  1CGI I;  1CSO I;  2M5X A;  1TUS A;  1V1I A;  1Z7K B;  3VDP A;  1HPT A;  1PCE A;  3OVO A;  1Y1C A;  1SGR I;  2QQE A;  2NU4 I;  2OD1 A;  3OL0 A;  1UVF A;  4UXH A;  1FYB A;  1RFH A;  2YQP A;  5CCL A;  1VDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...