1CE3A

Putative ancestral protein encoded by a single sequence repeat of the multidomain proteinase inhibitor from nicotiana alata
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
54
structure length
54
Chain Sequence
MKACTLNCDPRIAYGVCPRSEEKKNDRICTNCCAGTKGCKYFSDDGTFVCEGES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (API)
publication title Structure of a putative ancestral protein encoded by a single sequence repeat from a multidomain proteinase inhibitor gene from Nicotiana alata.
pubmed doi rcsb
source organism Nicotiana alata
molecule tags Protease inhibitor
total genus 6
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1999-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02428 Prot_inhib_II Potato type II proteinase inhibitor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1ce3A00
2JZMA 1CE3A 1TIHA 1PCEA 2GKRI 1CGII 3QTLD 1Y1CA 1TBQR 1AN1I 3SGQI 1HJAI 4SGBI 1HDLA 1HPTA 2XRCA 1PPFI 1TBRR 1DS2I 2GKTI 2KCXA 2KMPA 2SGEI 3HH2C 1CHOI 3B4VC 1SGNI 1CT4I 3SGBI 1M8BA 2KMQA 1YU6C 1SGRI 2P6AC 1TGSI 1PJUA 1UUCA 2V53A 2SGFI 1IY6A 2LEOA 2ARPF 1CT2I 2JYYA 2SGDI 5JHWC 3SEKC 2KMRA 1LR7A 2NU0I 2SGPI 1M8CA 2BUSA 2N52A 1UVGA 1BMOA 1UVFA 5DAEA 1KMAA 1FYBA 1R0RI 1TURA 1Y1BA 3OVOA 1CT0I 1SGPI 1Z7KB 2ERWA 2B0UC 1OVOA 1OMUA 1H0ZA 1SGDI 1LR8A 4OVOA 1LR9A 1SGQI 1TUSA 1IY5A 1CSOI 1SGYI 2N17A 1OYVI 1DS3I 4HGUA 2N71A 1N13A 1YTPA 2F3CI 2QQCA 2NU1I 2SGQI 2NU4I 2M5XA 2OVOA 4GI3C 1NUBA 2NU2I 1MT1A 2KMOA 2GKVA 2JXDA 2QQDA 1BUSA 1CGJI 1IW4A 2NU3I 1OMTA 2WCYA 3TJQA 1SGEI
chains in the Genus database with same CATH superfamily
3VDPA 2JZMA 5E3RA 3VE5A 1TIHA 1CE3A 1PCEA 1XBTA 2VRWB 5HQ8A 2GKRI 1CGII 1K7UA 1XX6A 2V1CC 3QTLD 2QQ0A 1Y1CA 4UXIA 2WGCA 1TBQR 1K7TA 3TO6A 3OXLA 3QWPA 1AN1I 2PQ8A 3TO9A 2QPOA 2OU2A 1FARA 3R5DA 3SGQI 2B8TA 2DKVA 1HJAI 4E1RA 2V1CA 4SGBI 1HDLA 2ORWA 1HPTA 2XRCA 4UXJA 3VDUA 1PPFI 5E3PA 1TBRR 1DS2I 2GKTI 2KCXA 4B6DA 2KMPA 2SGEI 3HH2C 1CHOI 2L7XA 4L9MA 4E1PA 3B4VC 2WVJA 1SGNI 1TOTA 3FSYA 5HI7A 1CT4I 3UEYA 3SGBI 1M8BA 2DB6A 2CWFA 1P9GA 2KMQA 3RU0A 1MJ9A 1YU6C 1SGRI 1RFHA 2P6AC 1TGSI 1PJUA 2ENZA 1ULNA 1UUCA 2ELIA 2V53A 2SGFI 4A24A 1IY6A 2LEOA 1Q9BA 2GVIA 1X74A 2J9RA 3TO7A 7WGAA 2ARPF 1CT2I 2CWGA 2JYYA 2SGDI 4UXHA 1R79A 5FUYA 1K7VA 5JHWC 1TBNA 3SEKC 3OXFA 5J8CA 2KMRA 1Z2IA 3KY9A 3FSXA 3QAHA 2UZ3A 1TBOA 3E2IA 1LR7A 2NU0I 3OL0A 2JA1A 2SGPI 1M8CA 1MJAA 4JCVE 2BUSA 3UGIA 3D00A 2N52A 1ULMA 1FY7A 1BMOA 1UVGA 4MPIA 1UVFA 2X3TA 5DAEA 1Y8FA 3R5AA 3UOEA 4DNCA 2FNFX 1W4RA 1V1HA 2OZUA 1KMAA 2QQEA 2UVOA 3TOAA 5FUVA 1FYBA 1HEVA 1R0RI 2N1AB 5J8FA 1TURA 1Y1BA 3OVOA 1CT0I 3UEJA 5CCMA 3BJIA 1SGPI 2CWHA 2DIPA 1Z7KB 2ERWA 1KBEA 2RC4A 2B0UC 2L8EA 1OVOA 1VDDA 9WGAA 1OMUA 2YUUA 1H0ZA 2LUYA 1MJBA 1SGDI 1LR8A 4OVOA 2A20A 2Y0MA 1FAQA 1LR9A 1X4SA 2CJSC 1SGQI 1TUSA 2ORVA 1S20A 1WTJA 2LB7A 5EX3A 5FUWA 1IY5A 1P9ZA 1CSOI 2RIJA 1PTRA 3E59A 3UFFA 1SGYI 1UHAA 2N17A 2ROWA 3PDNA 1OYVI 3UGLA 1DS3I 1WKXA 4HGUA 2OD1A 2N71A 1N13A 1V1IA 1YTPA 2E5RA 2F3CI 2QQCA 4AMLA 2W0TA 3R5CA 2K9HA 2NU1I 1ULKA 1WGTA 3R5BA 1KBFA 2SGQI 3FC3A 2NU4I 2E73A 2X52A 3CXLA 2M5XA 2OVOA 4GI3C 1NUBA 5EX0A 1NXUA 1U5KA 2NU2I 1MT1A 2YQPA 5FUXA 3TOBA 5CCLA 3OXGA 1WGCA 2ODDA 3GOXA 1W3SA 2GKVA 2KMOA 2ENNA 2JXDA 2QQDA 4WP4A 1BUSA 1CGJI 2JW6A 1IW4A 2NU3I 2J87A 3MEKA 1OMTA 4FKDA 1XA6A 2WCYA 3UGDA 5E3QA 2GIVA 3TJQA 1SGEI 1PTQA
chains in the Genus database with same CATH topology
3VDPA 2JZMA 3VE5A 1CE3A 1TIHA 1PCEA 1XBTA 2VRWB 5HQ8A 2GKRI 1CGII 1XX6A 3QTLD 2V1CC 4UXIA 2QQ0A 1Y1CA 1TBQR 3OXLA 3QWPA 1AN1I 2QPOA 1FARA 3SGQI 2B8TA 1HJAI 4E1RA 2V1CA 4SGBI 1HDLA 2ORWA 1HPTA 2XRCA 4UXJA 3VDUA 1PPFI 4B6DA 1TBRR 1DS2I 2GKTI 2KCXA 4E1PA 2KMPA 2SGEI 3HH2C 1CHOI 2L7XA 4L9MA 3B4VC 2WVJA 1SGNI 1TOTA 5HI7A 1CT4I 3UEYA 3SGBI 1M8BA 2DB6A 3RU0A 2KMQA 1YU6C 1SGRI 1RFHA 2P6AC 1TGSI 1PJUA 2ENZA 1UUCA 2ELIA 2V53A 2SGFI 4A24A 1IY6A 2LEOA 2GVIA 2J9RA 1X74A 2ARPF 1CT2I 2JYYA 2SGDI 4UXHA 1R79A 5FUYA 5JHWC 1TBNA 3SEKC 3OXFA 2KMRA 3KY9A 2UZ3A 1TBOA 3E2IA 1LR7A 2NU0I 3OL0A 2JA1A 2SGPI 1M8CA 4JCVE 2BUSA 3UGIA 3D00A 2N52A 1UVGA 1BMOA 1UVFA 5DAEA 1Y8FA 2FNFX 1W4RA 1V1HA 1KMAA 2QQEA 5FUVA 1FYBA 1R0RI 2N1AB 1TURA 1Y1BA 3OVOA 1CT0I 3UEJA 5CCMA 3BJIA 1SGPI 2DIPA 1Z7KB 2ERWA 1KBEA 2B0UC 2L8EA 1OVOA 1VDDA 1OMUA 2YUUA 1H0ZA 2LUYA 1SGDI 1FAQA 1LR8A 4OVOA 2A20A 1LR9A 1X4SA 2CJSC 1SGQI 1TUSA 2ORVA 5EX3A 5FUWA 1IY5A 1CSOI 3E59A 1PTRA 3UFFA 1SGYI 2N17A 2ROWA 3PDNA 1OYVI 3UGLA 1DS3I 4HGUA 2OD1A 2N71A 1N13A 1V1IA 1YTPA 2E5RA 2F3CI 2QQCA 2W0TA 2K9HA 2NU1I 1KBFA 2SGQI 3FC3A 2NU4I 2E73A 3CXLA 2M5XA 2OVOA 4GI3C 1NUBA 5EX0A 1U5KA 2NU2I 2YQPA 1MT1A 5FUXA 5CCLA 3OXGA 2ODDA 3GOXA 1W3SA 2GKVA 2KMOA 2ENNA 2JXDA 2QQDA 1BUSA 1CGJI 2JW6A 1IW4A 2NU3I 2J87A 3MEKA 1OMTA 4FKDA 1XA6A 2WCYA 3UGDA 3TJQA 1SGEI 1PTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JZM A;  1CE3 A;  1TIH A;  1PCE A;  2GKR I;  1CGI I;  3QTL D;  1Y1C A;  1TBQ R;  1AN1 I;  3SGQ I;  1HJA I;  4SGB I;  1HDL A;  1HPT A;  2XRC A;  1PPF I;  1TBR R;  1DS2 I;  2GKT I;  2KCX A;  2KMP A;  2SGE I;  3HH2 C;  1CHO I;  3B4V C;  1SGN I;  1CT4 I;  3SGB I;  1M8B A;  2KMQ A;  1YU6 C;  1SGR I;  2P6A C;  1TGS I;  1PJU A;  1UUC A;  2V53 A;  2SGF I;  1IY6 A;  2LEO A;  2ARP F;  1CT2 I;  2JYY A;  2SGD I;  5JHW C;  3SEK C;  2KMR A;  1LR7 A;  2NU0 I;  2SGP I;  1M8C A;  2BUS A;  2N52 A;  1UVG A;  1BMO A;  1UVF A;  5DAE A;  1KMA A;  1FYB A;  1R0R I;  1TUR A;  1Y1B A;  3OVO A;  1CT0 I;  1SGP I;  1Z7K B;  2ERW A;  2B0U C;  1OVO A;  1OMU A;  1H0Z A;  1SGD I;  1LR8 A;  4OVO A;  1LR9 A;  1SGQ I;  1TUS A;  1IY5 A;  1CSO I;  1SGY I;  2N17 A;  1OYV I;  1DS3 I;  4HGU A;  2N71 A;  1N13 A;  1YTP A;  2F3C I;  2QQC A;  2NU1 I;  2SGQ I;  2NU4 I;  2M5X A;  2OVO A;  4GI3 C;  1NUB A;  2NU2 I;  1MT1 A;  2KMO A;  2GKV A;  2JXD A;  2QQD A;  1BUS A;  1CGJ I;  1IW4 A;  2NU3 I;  1OMT A;  2WCY A;  3TJQ A;  1SGE I; 
#chains in the Genus database with same CATH topology
 3VDP A;  2JZM A;  5E3R A;  3VE5 A;  1TIH A;  1CE3 A;  1PCE A;  1XBT A;  2VRW B;  5HQ8 A;  2GKR I;  1CGI I;  1K7U A;  1XX6 A;  2V1C C;  3QTL D;  2QQ0 A;  1Y1C A;  4UXI A;  2WGC A;  1TBQ R;  1K7T A;  3TO6 A;  3OXL A;  3QWP A;  1AN1 I;  2PQ8 A;  3TO9 A;  2QPO A;  2OU2 A;  1FAR A;  3R5D A;  3SGQ I;  2B8T A;  2DKV A;  1HJA I;  4E1R A;  2V1C A;  4SGB I;  1HDL A;  2ORW A;  1HPT A;  2XRC A;  4UXJ A;  3VDU A;  1PPF I;  5E3P A;  1TBR R;  1DS2 I;  2GKT I;  2KCX A;  4B6D A;  2KMP A;  2SGE I;  3HH2 C;  1CHO I;  2L7X A;  4L9M A;  4E1P A;  3B4V C;  2WVJ A;  1SGN I;  1TOT A;  3FSY A;  5HI7 A;  1CT4 I;  3UEY A;  3SGB I;  1M8B A;  2DB6 A;  2CWF A;  1P9G A;  2KMQ A;  3RU0 A;  1MJ9 A;  1YU6 C;  1SGR I;  1RFH A;  2P6A C;  1TGS I;  1PJU A;  2ENZ A;  1ULN A;  1UUC A;  2ELI A;  2V53 A;  2SGF I;  4A24 A;  1IY6 A;  2LEO A;  1Q9B A;  2GVI A;  1X74 A;  2J9R A;  3TO7 A;  7WGA A;  2ARP F;  1CT2 I;  2CWG A;  2JYY A;  2SGD I;  4UXH A;  1R79 A;  5FUY A;  1K7V A;  5JHW C;  1TBN A;  3SEK C;  3OXF A;  5J8C A;  2KMR A;  1Z2I A;  3KY9 A;  3FSX A;  3QAH A;  2UZ3 A;  1TBO A;  3E2I A;  1LR7 A;  2NU0 I;  3OL0 A;  2JA1 A;  2SGP I;  1M8C A;  1MJA A;  4JCV E;  2BUS A;  3UGI A;  3D00 A;  2N52 A;  1ULM A;  1FY7 A;  1BMO A;  1UVG A;  4MPI A;  1UVF A;  2X3T A;  5DAE A;  1Y8F A;  3R5A A;  3UOE A;  4DNC A;  2FNF X;  1W4R A;  1V1H A;  2OZU A;  1KMA A;  2QQE A;  2UVO A;  3TOA A;  5FUV A;  1FYB A;  1HEV A;  1R0R I;  2N1A B;  5J8F A;  1TUR A;  1Y1B A;  3OVO A;  1CT0 I;  3UEJ A;  5CCM A;  3BJI A;  1SGP I;  2CWH A;  2DIP A;  1Z7K B;  2ERW A;  1KBE A;  2RC4 A;  2B0U C;  2L8E A;  1OVO A;  1VDD A;  9WGA A;  1OMU A;  2YUU A;  1H0Z A;  2LUY A;  1MJB A;  1SGD I;  1LR8 A;  4OVO A;  2A20 A;  2Y0M A;  1FAQ A;  1LR9 A;  1X4S A;  2CJS C;  1SGQ I;  1TUS A;  2ORV A;  1S20 A;  1WTJ A;  2LB7 A;  5EX3 A;  5FUW A;  1IY5 A;  1P9Z A;  1CSO I;  2RIJ A;  1PTR A;  3E59 A;  3UFF A;  1SGY I;  1UHA A;  2N17 A;  2ROW A;  3PDN A;  1OYV I;  3UGL A;  1DS3 I;  1WKX A;  4HGU A;  2OD1 A;  2N71 A;  1N13 A;  1V1I A;  1YTP A;  2E5R A;  2F3C I;  2QQC A;  4AML A;  2W0T A;  3R5C A;  2K9H A;  2NU1 I;  1ULK A;  1WGT A;  3R5B A;  1KBF A;  2SGQ I;  3FC3 A;  2NU4 I;  2E73 A;  2X52 A;  3CXL A;  2M5X A;  2OVO A;  4GI3 C;  1NUB A;  5EX0 A;  1NXU A;  1U5K A;  2NU2 I;  1MT1 A;  2YQP A;  5FUX A;  3TOB A;  5CCL A;  3OXG A;  1WGC A;  2ODD A;  3GOX A;  1W3S A;  2GKV A;  2KMO A;  2ENN A;  2JXD A;  2QQD A;  4WP4 A;  1BUS A;  1CGJ I;  2JW6 A;  1IW4 A;  2NU3 I;  2J87 A;  3MEK A;  1OMT A;  4FKD A;  1XA6 A;  2WCY A;  3UGD A;  5E3Q A;  2GIV A;  3TJQ A;  1SGE I;  1PTQ A; 
#chains in the Genus database with same CATH homology
 3VDP A;  2JZM A;  3VE5 A;  1CE3 A;  1TIH A;  1PCE A;  1XBT A;  2VRW B;  5HQ8 A;  2GKR I;  1CGI I;  1XX6 A;  3QTL D;  2V1C C;  4UXI A;  2QQ0 A;  1Y1C A;  1TBQ R;  3OXL A;  3QWP A;  1AN1 I;  2QPO A;  1FAR A;  3SGQ I;  2B8T A;  1HJA I;  4E1R A;  2V1C A;  4SGB I;  1HDL A;  2ORW A;  1HPT A;  2XRC A;  4UXJ A;  3VDU A;  1PPF I;  4B6D A;  1TBR R;  1DS2 I;  2GKT I;  2KCX A;  4E1P A;  2KMP A;  2SGE I;  3HH2 C;  1CHO I;  2L7X A;  4L9M A;  3B4V C;  2WVJ A;  1SGN I;  1TOT A;  5HI7 A;  1CT4 I;  3UEY A;  3SGB I;  1M8B A;  2DB6 A;  3RU0 A;  2KMQ A;  1YU6 C;  1SGR I;  1RFH A;  2P6A C;  1TGS I;  1PJU A;  2ENZ A;  1UUC A;  2ELI A;  2V53 A;  2SGF I;  4A24 A;  1IY6 A;  2LEO A;  2GVI A;  2J9R A;  1X74 A;  2ARP F;  1CT2 I;  2JYY A;  2SGD I;  4UXH A;  1R79 A;  5FUY A;  5JHW C;  1TBN A;  3SEK C;  3OXF A;  2KMR A;  3KY9 A;  2UZ3 A;  1TBO A;  3E2I A;  1LR7 A;  2NU0 I;  3OL0 A;  2JA1 A;  2SGP I;  1M8C A;  4JCV E;  2BUS A;  3UGI A;  3D00 A;  2N52 A;  1UVG A;  1BMO A;  1UVF A;  5DAE A;  1Y8F A;  2FNF X;  1W4R A;  1V1H A;  1KMA A;  2QQE A;  5FUV A;  1FYB A;  1R0R I;  2N1A B;  1TUR A;  1Y1B A;  3OVO A;  1CT0 I;  3UEJ A;  5CCM A;  3BJI A;  1SGP I;  2DIP A;  1Z7K B;  2ERW A;  1KBE A;  2B0U C;  2L8E A;  1OVO A;  1VDD A;  1OMU A;  2YUU A;  1H0Z A;  2LUY A;  1SGD I;  1FAQ A;  1LR8 A;  4OVO A;  2A20 A;  1LR9 A;  1X4S A;  2CJS C;  1SGQ I;  1TUS A;  2ORV A;  5EX3 A;  5FUW A;  1IY5 A;  1CSO I;  3E59 A;  1PTR A;  3UFF A;  1SGY I;  2N17 A;  2ROW A;  3PDN A;  1OYV I;  3UGL A;  1DS3 I;  4HGU A;  2OD1 A;  2N71 A;  1N13 A;  1V1I A;  1YTP A;  2E5R A;  2F3C I;  2QQC A;  2W0T A;  2K9H A;  2NU1 I;  1KBF A;  2SGQ I;  3FC3 A;  2NU4 I;  2E73 A;  3CXL A;  2M5X A;  2OVO A;  4GI3 C;  1NUB A;  5EX0 A;  1U5K A;  2NU2 I;  2YQP A;  1MT1 A;  5FUX A;  5CCL A;  3OXG A;  2ODD A;  3GOX A;  1W3S A;  2GKV A;  2KMO A;  2ENN A;  2JXD A;  2QQD A;  1BUS A;  1CGJ I;  2JW6 A;  1IW4 A;  2NU3 I;  2J87 A;  3MEK A;  1OMT A;  4FKD A;  1XA6 A;  2WCY A;  3UGD A;  3TJQ A;  1SGE I;  1PTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...