2GKTI

Crystal structure of the p14'-ala32 variant of the n-terminally truncated omtky3-del(1-5)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTLEYRPLCGSDNKTYANKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Ovomucoid
publication title Structural Insights into the Non-additivity Effects in the Sequence-to-Reactivity Algorithm for Serine Peptidases and their Inhibitors.
pubmed doi rcsb
source organism Meleagris gallopavo
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2006-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2gktI00
2KMRA 1N13A 1CGII 1OMTA 1UUCA 2ARPF 2SGEI 1TIHA 1Y1BA 1PCEA 2JYYA 1SGQI 1BUSA 2P6AC 2B0UC 2JXDA 1OYVI 1PPFI 2KMOA 1CSOI 2SGQI 1HDLA 1FYBA 1LR9A 1CT0I 1DS2I 1SGDI 2KCXA 2N52A 1SGEI 2XRCA 2BUSA 1M8BA 1PJUA 1SGRI 2LEOA 1CGJI 1CT4I 3SEKC 1TGSI 2N71A 2M5XA 2F3CI 2JZMA 1SGNI 2V53A 1MT1A 3QTLD 2GKTI 5DAEA 4GI3C 3SGQI 3TJQA 1R0RI 2KMQA 1TBRR 1TBQR 2WCYA 1Y1CA 2QQCA 2NU4I 2NU2I 1IY6A 1LR7A 1CT2I 5JHWC 1UVFA 2GKVA 1CHOI 1LR8A 2NU1I 1SGPI 1NUBA 2QQDA 1Z7KB 1TUSA 3SGBI 1OMUA 4OVOA 1CE3A 3HH2C 1OVOA 2SGFI 1YTPA 4HGUA 1H0ZA 1IW4A 2N17A 1BMOA 1HPTA 2ERWA 2OVOA 2NU3I 2NU0I 2KMPA 1AN1I 1UVGA 2GKRI 4SGBI 1M8CA 3OVOA 3B4VC 1YU6C 2SGPI 1HJAI 1IY5A 1DS3I 1KMAA 1SGYI 2SGDI 1TURA
chains in the Genus database with same CATH superfamily
3BJIA 2KMRA 3OL0A 1N13A 2GVIA 1VDDA 1CGII 1OMTA 3D00A 1UUCA 2ARPF 3UOEA 3GOXA 2SGEI 1K7TA 2FNFX 1UHAA 3FC3A 1MJBA 1TIHA 1Y1BA 2JA1A 2ORWA 5E3QA 3UEYA 2ENZA 3R5CA 2ELIA 1PCEA 2JYYA 3OXLA 2J87A 2RIJA 1SGQI 3OXFA 2P6AC 5FUYA 2B0UC 4A24A 1BUSA 2V1CC 1U5KA 2JXDA 1OYVI 5EX0A 1XBTA 2DB6A 2OZUA 3FSXA 2LUYA 1PPFI 2N1AB 1PTRA 2KMOA 3TOBA 1ULKA 3OXGA 1CSOI 2SGQI 2J9RA 2YUUA 1HDLA 1X74A 1FYBA 2LB7A 2W0TA 1LR9A 1CT0I 1DS2I 3UGIA 1SGDI 1TBNA 3E59A 2L8EA 1TBOA 2OD1A 1XA6A 2KCXA 2N52A 1ULMA 1SGEI 2UVOA 2BUSA 1M8BA 2XRCA 1PJUA 1FY7A 1SGRI 1K7UA 2LEOA 3PDNA 4MPIA 5E3PA 3R5AA 1CGJI 1CT4I 1WGTA 2GIVA 2CWHA 3SEKC 3TO9A 1Z2IA 4UXJA 1TGSI 2N71A 2M5XA 2F3CI 3CXLA 2JZMA 1SGNI 3UGLA 2QQEA 1PTQA 2V53A 2YQPA 1MT1A 3QTLD 2GKTI 5DAEA 4GI3C 5EX3A 3SGQI 4B6DA 2A20A 3E2IA 3TJQA 3VE5A 1R0RI 1Y8FA 3KY9A 5CCMA 4FKDA 2KMQA 2E5RA 9WGAA 1TBRR 1P9ZA 1WTJA 1TBQR 2WCYA 5CCLA 1Y1CA 5E3RA 2ENNA 1Q9BA 2VRWB 2QQCA 3R5DA 1RFHA 2ROWA 1TOTA 2DKVA 2NU4I 2V1CA 5HI7A 4E1PA 1HEVA 5HQ8A 2NU2I 4AMLA 3TO6A 1IY6A 2WGCA 1LR7A 1CT2I 2UZ3A 1S20A 2QQ0A 5JHWC 1UVFA 1R79A 2OU2A 2GKVA 5FUXA 1W3SA 1CHOI 3R5BA 1LR8A 1W4RA 3QWPA 2NU1I 1SGPI 2JW6A 3TOAA 1NUBA 2QQDA 1NXUA 2RC4A 1Z7KB 2CWFA 1K7VA 4UXIA 3UFFA 1TUSA 5FUWA 1WKXA 1XX6A 1FAQA 3SGBI 1OMUA 4E1RA 2CWGA 4OVOA 3UGDA 3VDUA 1CE3A 3HH2C 2E73A 3FSYA 2PQ8A 1OVOA 1V1IA 2SGFI 4JCVE 1P9GA 1KBEA 1KBFA 1FARA 5J8CA 4L9MA 5J8FA 1YTPA 4HGUA 3RU0A 1H0ZA 1IW4A 2ODDA 2N17A 2QPOA 2B8TA 1BMOA 1HPTA 1MJ9A 2ERWA 2K9HA 5FUVA 2WVJA 2OVOA 2NU3I 2X52A 4WP4A 2NU0I 2ORVA 2KMPA 3UEJA 1AN1I 2CJSC 1UVGA 2GKRI 2X3TA 4SGBI 2L7XA 1ULNA 1M8CA 3TO7A 3OVOA 1WGCA 2DIPA 3QAHA 1X4SA 1YU6C 3B4VC 3MEKA 2SGPI 2Y0MA 7WGAA 1HJAI 4UXHA 4DNCA 1MJAA 1IY5A 1DS3I 1KMAA 1SGYI 1V1HA 3VDPA 2SGDI 1TURA
chains in the Genus database with same CATH topology
3BJIA 2KMRA 3OL0A 1N13A 2GVIA 1VDDA 1CGII 1OMTA 3D00A 1UUCA 2ARPF 3GOXA 2SGEI 2FNFX 3FC3A 2JA1A 1TIHA 1Y1BA 2ORWA 3UEYA 2ENZA 2ELIA 1PCEA 2JYYA 3OXLA 2J87A 3OXFA 1SGQI 4A24A 2P6AC 5FUYA 2B0UC 1BUSA 2V1CC 1U5KA 2JXDA 1OYVI 5EX0A 1XBTA 2DB6A 2LUYA 1PPFI 2N1AB 1PTRA 2KMOA 3OXGA 1CSOI 2SGQI 2J9RA 2YUUA 1HDLA 1X74A 1FYBA 2W0TA 1LR9A 1CT0I 1DS2I 3UGIA 1SGDI 1TBNA 3E59A 2L8EA 1TBOA 2OD1A 1XA6A 2KCXA 2N52A 1SGEI 2XRCA 2BUSA 1M8BA 1PJUA 1SGRI 2LEOA 3PDNA 1CGJI 1CT4I 3SEKC 4UXJA 1TGSI 2N71A 2M5XA 2F3CI 3CXLA 2JZMA 1SGNI 3UGLA 2QQEA 1PTQA 2V53A 2YQPA 1MT1A 3QTLD 2GKTI 5DAEA 4GI3C 5EX3A 3SGQI 4B6DA 2A20A 3E2IA 3TJQA 3VE5A 1R0RI 1Y8FA 3KY9A 5CCMA 4FKDA 2KMQA 2E5RA 1TBRR 1TBQR 2WCYA 5CCLA 1Y1CA 2ENNA 2VRWB 2QQCA 1RFHA 2ROWA 1TOTA 2NU4I 2V1CA 4E1PA 5HI7A 5HQ8A 2NU2I 1IY6A 1LR7A 1CT2I 2UZ3A 2QQ0A 5JHWC 1UVFA 1R79A 2GKVA 5FUXA 1W3SA 1CHOI 1LR8A 1W4RA 3QWPA 2NU1I 1SGPI 2JW6A 1NUBA 2QQDA 1Z7KB 4UXIA 3UFFA 1TUSA 5FUWA 1XX6A 1FAQA 3SGBI 1OMUA 4E1RA 4OVOA 3UGDA 3VDUA 1CE3A 3HH2C 2E73A 1OVOA 1V1IA 2SGFI 4JCVE 1KBFA 1KBEA 1FARA 4L9MA 1YTPA 4HGUA 3RU0A 1H0ZA 1IW4A 2ODDA 2N17A 2QPOA 2B8TA 1BMOA 1HPTA 2ERWA 2K9HA 5FUVA 2WVJA 2OVOA 2NU3I 2NU0I 2ORVA 2KMPA 3UEJA 1AN1I 2CJSC 1UVGA 2GKRI 4SGBI 2L7XA 1M8CA 3OVOA 2DIPA 1X4SA 1YU6C 3B4VC 3MEKA 2SGPI 1HJAI 4UXHA 1IY5A 1DS3I 1KMAA 1SGYI 1V1HA 3VDPA 2SGDI 1TURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KMR A;  1N13 A;  1CGI I;  1OMT A;  1UUC A;  2ARP F;  2SGE I;  1TIH A;  1Y1B A;  1PCE A;  2JYY A;  1SGQ I;  1BUS A;  2P6A C;  2B0U C;  2JXD A;  1OYV I;  1PPF I;  2KMO A;  1CSO I;  2SGQ I;  1HDL A;  1FYB A;  1LR9 A;  1CT0 I;  1DS2 I;  1SGD I;  2KCX A;  2N52 A;  1SGE I;  2XRC A;  2BUS A;  1M8B A;  1PJU A;  1SGR I;  2LEO A;  1CGJ I;  1CT4 I;  3SEK C;  1TGS I;  2N71 A;  2M5X A;  2F3C I;  2JZM A;  1SGN I;  2V53 A;  1MT1 A;  3QTL D;  2GKT I;  5DAE A;  4GI3 C;  3SGQ I;  3TJQ A;  1R0R I;  2KMQ A;  1TBR R;  1TBQ R;  2WCY A;  1Y1C A;  2QQC A;  2NU4 I;  2NU2 I;  1IY6 A;  1LR7 A;  1CT2 I;  5JHW C;  1UVF A;  2GKV A;  1CHO I;  1LR8 A;  2NU1 I;  1SGP I;  1NUB A;  2QQD A;  1Z7K B;  1TUS A;  3SGB I;  1OMU A;  4OVO A;  1CE3 A;  3HH2 C;  1OVO A;  2SGF I;  1YTP A;  4HGU A;  1H0Z A;  1IW4 A;  2N17 A;  1BMO A;  1HPT A;  2ERW A;  2OVO A;  2NU3 I;  2NU0 I;  2KMP A;  1AN1 I;  1UVG A;  2GKR I;  4SGB I;  1M8C A;  3OVO A;  3B4V C;  1YU6 C;  2SGP I;  1HJA I;  1IY5 A;  1DS3 I;  1KMA A;  1SGY I;  2SGD I;  1TUR A; 
#chains in the Genus database with same CATH topology
 3BJI A;  2KMR A;  3OL0 A;  1N13 A;  2GVI A;  1VDD A;  1CGI I;  1OMT A;  3D00 A;  1UUC A;  2ARP F;  3UOE A;  3GOX A;  2SGE I;  1K7T A;  2FNF X;  1UHA A;  3FC3 A;  1MJB A;  1TIH A;  1Y1B A;  2JA1 A;  2ORW A;  5E3Q A;  3UEY A;  2ENZ A;  3R5C A;  2ELI A;  1PCE A;  2JYY A;  3OXL A;  2J87 A;  2RIJ A;  1SGQ I;  3OXF A;  2P6A C;  5FUY A;  2B0U C;  4A24 A;  1BUS A;  2V1C C;  1U5K A;  2JXD A;  1OYV I;  5EX0 A;  1XBT A;  2DB6 A;  2OZU A;  3FSX A;  2LUY A;  1PPF I;  2N1A B;  1PTR A;  2KMO A;  3TOB A;  1ULK A;  3OXG A;  1CSO I;  2SGQ I;  2J9R A;  2YUU A;  1HDL A;  1X74 A;  1FYB A;  2LB7 A;  2W0T A;  1LR9 A;  1CT0 I;  1DS2 I;  3UGI A;  1SGD I;  1TBN A;  3E59 A;  2L8E A;  1TBO A;  2OD1 A;  1XA6 A;  2KCX A;  2N52 A;  1ULM A;  1SGE I;  2UVO A;  2BUS A;  1M8B A;  2XRC A;  1PJU A;  1FY7 A;  1SGR I;  1K7U A;  2LEO A;  3PDN A;  4MPI A;  5E3P A;  3R5A A;  1CGJ I;  1CT4 I;  1WGT A;  2GIV A;  2CWH A;  3SEK C;  3TO9 A;  1Z2I A;  4UXJ A;  1TGS I;  2N71 A;  2M5X A;  2F3C I;  3CXL A;  2JZM A;  1SGN I;  3UGL A;  2QQE A;  1PTQ A;  2V53 A;  2YQP A;  1MT1 A;  3QTL D;  2GKT I;  5DAE A;  4GI3 C;  5EX3 A;  3SGQ I;  4B6D A;  2A20 A;  3E2I A;  3TJQ A;  3VE5 A;  1R0R I;  1Y8F A;  3KY9 A;  5CCM A;  4FKD A;  2KMQ A;  2E5R A;  9WGA A;  1TBR R;  1P9Z A;  1WTJ A;  1TBQ R;  2WCY A;  5CCL A;  1Y1C A;  5E3R A;  2ENN A;  1Q9B A;  2VRW B;  2QQC A;  3R5D A;  1RFH A;  2ROW A;  1TOT A;  2DKV A;  2NU4 I;  2V1C A;  5HI7 A;  4E1P A;  1HEV A;  5HQ8 A;  2NU2 I;  4AML A;  3TO6 A;  1IY6 A;  2WGC A;  1LR7 A;  1CT2 I;  2UZ3 A;  1S20 A;  2QQ0 A;  5JHW C;  1UVF A;  1R79 A;  2OU2 A;  2GKV A;  5FUX A;  1W3S A;  1CHO I;  3R5B A;  1LR8 A;  1W4R A;  3QWP A;  2NU1 I;  1SGP I;  2JW6 A;  3TOA A;  1NUB A;  2QQD A;  1NXU A;  2RC4 A;  1Z7K B;  2CWF A;  1K7V A;  4UXI A;  3UFF A;  1TUS A;  5FUW A;  1WKX A;  1XX6 A;  1FAQ A;  3SGB I;  1OMU A;  4E1R A;  2CWG A;  4OVO A;  3UGD A;  3VDU A;  1CE3 A;  3HH2 C;  2E73 A;  3FSY A;  2PQ8 A;  1OVO A;  1V1I A;  2SGF I;  4JCV E;  1P9G A;  1KBE A;  1KBF A;  1FAR A;  5J8C A;  4L9M A;  5J8F A;  1YTP A;  4HGU A;  3RU0 A;  1H0Z A;  1IW4 A;  2ODD A;  2N17 A;  2QPO A;  2B8T A;  1BMO A;  1HPT A;  1MJ9 A;  2ERW A;  2K9H A;  5FUV A;  2WVJ A;  2OVO A;  2NU3 I;  2X52 A;  4WP4 A;  2NU0 I;  2ORV A;  2KMP A;  3UEJ A;  1AN1 I;  2CJS C;  1UVG A;  2GKR I;  2X3T A;  4SGB I;  2L7X A;  1ULN A;  1M8C A;  3TO7 A;  3OVO A;  1WGC A;  2DIP A;  3QAH A;  1X4S A;  1YU6 C;  3B4V C;  3MEK A;  2SGP I;  2Y0M A;  7WGA A;  1HJA I;  4UXH A;  4DNC A;  1MJA A;  1IY5 A;  1DS3 I;  1KMA A;  1SGY I;  1V1H A;  3VDP A;  2SGD I;  1TUR A; 
#chains in the Genus database with same CATH homology
 3BJI A;  2KMR A;  3OL0 A;  1N13 A;  2GVI A;  1VDD A;  1CGI I;  1OMT A;  3D00 A;  1UUC A;  2ARP F;  3GOX A;  2SGE I;  2FNF X;  3FC3 A;  2JA1 A;  1TIH A;  1Y1B A;  2ORW A;  3UEY A;  2ENZ A;  2ELI A;  1PCE A;  2JYY A;  3OXL A;  2J87 A;  3OXF A;  1SGQ I;  4A24 A;  2P6A C;  5FUY A;  2B0U C;  1BUS A;  2V1C C;  1U5K A;  2JXD A;  1OYV I;  5EX0 A;  1XBT A;  2DB6 A;  2LUY A;  1PPF I;  2N1A B;  1PTR A;  2KMO A;  3OXG A;  1CSO I;  2SGQ I;  2J9R A;  2YUU A;  1HDL A;  1X74 A;  1FYB A;  2W0T A;  1LR9 A;  1CT0 I;  1DS2 I;  3UGI A;  1SGD I;  1TBN A;  3E59 A;  2L8E A;  1TBO A;  2OD1 A;  1XA6 A;  2KCX A;  2N52 A;  1SGE I;  2XRC A;  2BUS A;  1M8B A;  1PJU A;  1SGR I;  2LEO A;  3PDN A;  1CGJ I;  1CT4 I;  3SEK C;  4UXJ A;  1TGS I;  2N71 A;  2M5X A;  2F3C I;  3CXL A;  2JZM A;  1SGN I;  3UGL A;  2QQE A;  1PTQ A;  2V53 A;  2YQP A;  1MT1 A;  3QTL D;  2GKT I;  5DAE A;  4GI3 C;  5EX3 A;  3SGQ I;  4B6D A;  2A20 A;  3E2I A;  3TJQ A;  3VE5 A;  1R0R I;  1Y8F A;  3KY9 A;  5CCM A;  4FKD A;  2KMQ A;  2E5R A;  1TBR R;  1TBQ R;  2WCY A;  5CCL A;  1Y1C A;  2ENN A;  2VRW B;  2QQC A;  1RFH A;  2ROW A;  1TOT A;  2NU4 I;  2V1C A;  4E1P A;  5HI7 A;  5HQ8 A;  2NU2 I;  1IY6 A;  1LR7 A;  1CT2 I;  2UZ3 A;  2QQ0 A;  5JHW C;  1UVF A;  1R79 A;  2GKV A;  5FUX A;  1W3S A;  1CHO I;  1LR8 A;  1W4R A;  3QWP A;  2NU1 I;  1SGP I;  2JW6 A;  1NUB A;  2QQD A;  1Z7K B;  4UXI A;  3UFF A;  1TUS A;  5FUW A;  1XX6 A;  1FAQ A;  3SGB I;  1OMU A;  4E1R A;  4OVO A;  3UGD A;  3VDU A;  1CE3 A;  3HH2 C;  2E73 A;  1OVO A;  1V1I A;  2SGF I;  4JCV E;  1KBF A;  1KBE A;  1FAR A;  4L9M A;  1YTP A;  4HGU A;  3RU0 A;  1H0Z A;  1IW4 A;  2ODD A;  2N17 A;  2QPO A;  2B8T A;  1BMO A;  1HPT A;  2ERW A;  2K9H A;  5FUV A;  2WVJ A;  2OVO A;  2NU3 I;  2NU0 I;  2ORV A;  2KMP A;  3UEJ A;  1AN1 I;  2CJS C;  1UVG A;  2GKR I;  4SGB I;  2L7X A;  1M8C A;  3OVO A;  2DIP A;  1X4S A;  1YU6 C;  3B4V C;  3MEK A;  2SGP I;  1HJA I;  4UXH A;  1IY5 A;  1DS3 I;  1KMA A;  1SGY I;  1V1H A;  3VDP A;  2SGD I;  1TUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...