2GKTI

Crystal structure of the p14'-ala32 variant of the n-terminally truncated omtky3-del(1-5)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
b'VDCSEYPKPACTLEYRPLCGSDNKTYANKCNFCNAVVESNGTLTLSHFGKC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ovomucoid
publication title Structural Insights into the Non-additivity Effects in the Sequence-to-Reactivity Algorithm for Serine Peptidases and their Inhibitors.
pubmed doi rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase inhibitor
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2006-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2gktI00
2LEOA 1HDLA 1KMAA 1DS3I 1DS2I 2JZMA 2NU3I 4OVOA 1TIHA 1M8BA 4HGUA 2M5XA 2SGDI 2F3CI 1SGNI 2ERWA 1FYBA 1Y1CA 2JXDA 2KCXA 1OMTA 1UVGA 1OVOA 1CT0I 3B4VC 1CSOI 2N17A 2KMOA 1R0RI 1IY6A 1SGDI 5DAEA 1UVFA 1CT2I 1TURA 1BMOA 2ARPF 2KMQA 2KMPA 1MT1A 2V53A 1HPTA 2GKRI 2NU2I 1SGPI 1BUSA 2QQDA 1CE3A 1H0ZA 1CHOI 2P6AC 2QQCA 5JHWC 3SGBI 3SEKC 4SGBI 2B0UC 2NU4I 1AN1I 2OVOA 1IW4A 2NU0I 1CT4I 1LR9A 1PPFI 1SGYI 1YTPA 2JYYA 1PJUA 1IY5A 2XRCA 1N13A 3SGQI 1NUBA 1M8CA 1SGRI 2KMRA 2GKTI 2N52A 1CGJI 1TBRR 2NU1I 1LR8A 1TUSA 1SGQI 1OMUA 1UUCA 1Z7KB 1CGII 3HH2C 3QTLD 2SGQI 3OVOA 1HJAI 1TBQR 2SGFI 2WCYA 2BUSA 1TGSI 1PCEA 1SGEI 2SGPI 1YU6C 1LR7A 1OYVI 2GKVA 2N71A 2SGEI 3TJQA 1Y1BA 4GI3C
chains in the Genus database with same CATH superfamily
3QWPA 2RC4A 3KY9A 1PTQA 1XBTA 2JW6A 2LEOA 2WGCA 3UGIA 4E1PA 3QAHA 2V1CC 2LB7A 1HDLA 1KMAA 1DS3I 1Y8FA 1DS2I 3TO7A 1FY7A 2JZMA 4FKDA 3OL0A 1K7VA 5HI7A 2NU3I 2GVIA 5HQ8A 2UVOA 1FARA 4OVOA 1NXUA 1TIHA 1M8BA 4HGUA 2M5XA 2SGDI 1MJAA 3CXLA 2F3CI 1SGNI 4JCVE 2ERWA 1FYBA 1Y1CA 5CCLA 3RU0A 2ELIA 2JXDA 3FSXA 2KCXA 2FNFX 2DIPA 1OMTA 1W3SA 7WGAA 1UVGA 1OVOA 1CT0I 4UXIA 3VDUA 1TBOA 2Y0MA 3VDPA 4A24A 1X4SA 3B4VC 1CSOI 3FSYA 3MEKA 1FAQA 1Z2IA 2N17A 2KMOA 1HEVA 2ORVA 1WTJA 1R0RI 4AMLA 5E3RA 3E59A 4L9MA 9WGAA 1IY6A 1PTRA 1SGDI 1ULKA 1MJ9A 1UVFA 5DAEA 1CT2I 1P9ZA 2ENNA 2ENZA 1WGTA 3UEJA 1K7TA 1BMOA 1TURA 2ARPF 2K9HA 2KMQA 2UZ3A 2VRWB 3TO6A 4WP4A 4B6DA 2KMPA 1MT1A 2V53A 1HPTA 2GKRI 2NU2I 3TOAA 1SGPI 3UFFA 5E3PA 1ULNA 1BUSA 1WGCA 2QQDA 2YQPA 1CE3A 1H0ZA 1CHOI 1V1HA 2P6AC 3OXLA 2QQCA 5JHWC 2L7XA 3SGBI 2QQ0A 3UEYA 3SEKC 2ROWA 2QPOA 4SGBI 2OD1A 2E5RA 2DB6A 2B0UC 2J87A 2NU4I 5EX0A 1AN1I 1VDDA 2OVOA 2PQ8A 1XX6A 1IW4A 1V1IA 2NU0I 3BJIA 1Q9BA 1CT4I 1LR9A 1PPFI 1XA6A 2DKVA 2GIVA 1SGYI 1U5KA 1YTPA 2CJSC 2JA1A 2JYYA 1PJUA 3UGLA 3VE5A 1IY5A 2XRCA 2RIJA 1N13A 1X74A 3SGQI 1NUBA 1M8CA 1SGRI 2KMRA 2GKTI 2L8EA 2N52A 2OZUA 1R79A 3GOXA 5J8CA 3R5DA 1ULMA 2J9RA 1CGJI 1TBRR 2NU1I 2ORWA 2QQEA 2X3TA 1P9GA 4UXHA 3TO9A 3FC3A 1LR8A 1TUSA 1SGQI 1OMUA 1UUCA 2N1AB 2OU2A 1MJBA 1Z7KB 1CGII 3HH2C 3QTLD 3E2IA 5FUWA 5J8FA 4DNCA 2SGQI 3OVOA 1HJAI 1TBQR 2SGFI 2W0TA 2YUUA 3OXFA 2WCYA 4E1RA 1UHAA 1TBNA 2BUSA 3UOEA 1TGSI 5EX3A 1PCEA 3R5CA 2A20A 3OXGA 1KBFA 1SGEI 1KBEA 2SGPI 1S20A 3R5BA 1YU6C 4UXJA 1LR7A 5FUVA 1OYVI 2CWFA 2LUYA 5FUYA 2GKVA 5E3QA 1K7UA 2N71A 3UGDA 4MPIA 2X52A 2SGEI 3TJQA 2E73A 3D00A 5CCMA 2WVJA 2ODDA 3TOBA 3R5AA 5FUXA 1RFHA 1WKXA 1Y1BA 2CWHA 1W4RA 2B8TA 3PDNA 2CWGA 4GI3C 1TOTA 2V1CA
chains in the Genus database with same CATH topology
3QWPA 3KY9A 1PTQA 1XBTA 2JW6A 2LEOA 4E1PA 3UGIA 2V1CC 1HDLA 1KMAA 1DS3I 1Y8FA 1DS2I 2JZMA 4FKDA 3OL0A 5HI7A 2NU3I 2GVIA 5HQ8A 1FARA 4OVOA 1TIHA 1M8BA 4HGUA 2M5XA 2SGDI 3CXLA 2F3CI 1SGNI 4JCVE 2ERWA 1FYBA 1Y1CA 5CCLA 3RU0A 2ELIA 2JXDA 2KCXA 2FNFX 2DIPA 1OMTA 1W3SA 1UVGA 1OVOA 1CT0I 4UXIA 3VDUA 1TBOA 3VDPA 4A24A 1X4SA 3B4VC 1CSOI 3MEKA 1FAQA 2N17A 2KMOA 2ORVA 1R0RI 3E59A 4L9MA 1IY6A 1PTRA 1SGDI 5DAEA 1UVFA 1CT2I 2ENNA 2ENZA 3UEJA 1TURA 1BMOA 2ARPF 2K9HA 2KMQA 2UZ3A 2VRWB 4B6DA 2KMPA 1MT1A 2V53A 1HPTA 2GKRI 2NU2I 3UFFA 1SGPI 1BUSA 2QQDA 2YQPA 1CE3A 1H0ZA 1CHOI 1V1HA 2P6AC 3OXLA 2QQCA 5JHWC 2L7XA 3SGBI 2QQ0A 3UEYA 3SEKC 2ROWA 2QPOA 4SGBI 2OD1A 2E5RA 2DB6A 2B0UC 2J87A 2NU4I 5EX0A 1AN1I 1VDDA 2OVOA 1XX6A 1IW4A 1V1IA 2NU0I 3BJIA 1CT4I 1LR9A 1PPFI 1XA6A 1SGYI 1U5KA 1YTPA 2CJSC 2JA1A 2JYYA 1PJUA 3UGLA 3VE5A 1IY5A 2XRCA 1N13A 1X74A 3SGQI 1NUBA 1M8CA 1SGRI 2KMRA 2GKTI 2L8EA 2N52A 1R79A 3GOXA 2J9RA 1CGJI 1TBRR 2NU1I 2ORWA 2QQEA 4UXHA 3FC3A 1LR8A 1TUSA 1SGQI 1OMUA 1UUCA 2N1AB 1Z7KB 1CGII 3HH2C 3QTLD 3E2IA 5FUWA 2SGQI 3OVOA 1HJAI 1TBQR 2SGFI 2W0TA 2YUUA 3OXFA 2WCYA 4E1RA 1TBNA 2BUSA 1TGSI 5EX3A 1PCEA 2A20A 3OXGA 1KBFA 1SGEI 1KBEA 2SGPI 1YU6C 4UXJA 1LR7A 5FUVA 1OYVI 2LUYA 5FUYA 2GKVA 2N71A 3UGDA 2SGEI 3TJQA 2E73A 3D00A 5CCMA 2WVJA 2ODDA 5FUXA 1RFHA 1Y1BA 3PDNA 1W4RA 2B8TA 4GI3C 1TOTA 2V1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LEO A;  1HDL A;  1KMA A;  1DS3 I;  1DS2 I;  2JZM A;  2NU3 I;  4OVO A;  1TIH A;  1M8B A;  4HGU A;  2M5X A;  2SGD I;  2F3C I;  1SGN I;  2ERW A;  1FYB A;  1Y1C A;  2JXD A;  2KCX A;  1OMT A;  1UVG A;  1OVO A;  1CT0 I;  3B4V C;  1CSO I;  2N17 A;  2KMO A;  1R0R I;  1IY6 A;  1SGD I;  5DAE A;  1UVF A;  1CT2 I;  1TUR A;  1BMO A;  2ARP F;  2KMQ A;  2KMP A;  1MT1 A;  2V53 A;  1HPT A;  2GKR I;  2NU2 I;  1SGP I;  1BUS A;  2QQD A;  1CE3 A;  1H0Z A;  1CHO I;  2P6A C;  2QQC A;  5JHW C;  3SGB I;  3SEK C;  4SGB I;  2B0U C;  2NU4 I;  1AN1 I;  2OVO A;  1IW4 A;  2NU0 I;  1CT4 I;  1LR9 A;  1PPF I;  1SGY I;  1YTP A;  2JYY A;  1PJU A;  1IY5 A;  2XRC A;  1N13 A;  3SGQ I;  1NUB A;  1M8C A;  1SGR I;  2KMR A;  2GKT I;  2N52 A;  1CGJ I;  1TBR R;  2NU1 I;  1LR8 A;  1TUS A;  1SGQ I;  1OMU A;  1UUC A;  1Z7K B;  1CGI I;  3HH2 C;  3QTL D;  2SGQ I;  3OVO A;  1HJA I;  1TBQ R;  2SGF I;  2WCY A;  2BUS A;  1TGS I;  1PCE A;  1SGE I;  2SGP I;  1YU6 C;  1LR7 A;  1OYV I;  2GKV A;  2N71 A;  2SGE I;  3TJQ A;  1Y1B A;  4GI3 C; 
#chains in the Genus database with same CATH topology
 3QWP A;  2RC4 A;  3KY9 A;  1PTQ A;  1XBT A;  2JW6 A;  2LEO A;  2WGC A;  3UGI A;  4E1P A;  3QAH A;  2V1C C;  2LB7 A;  1HDL A;  1KMA A;  1DS3 I;  1Y8F A;  1DS2 I;  3TO7 A;  1FY7 A;  2JZM A;  4FKD A;  3OL0 A;  1K7V A;  5HI7 A;  2NU3 I;  2GVI A;  5HQ8 A;  2UVO A;  1FAR A;  4OVO A;  1NXU A;  1TIH A;  1M8B A;  4HGU A;  2M5X A;  2SGD I;  1MJA A;  3CXL A;  2F3C I;  1SGN I;  4JCV E;  2ERW A;  1FYB A;  1Y1C A;  5CCL A;  3RU0 A;  2ELI A;  2JXD A;  3FSX A;  2KCX A;  2FNF X;  2DIP A;  1OMT A;  1W3S A;  7WGA A;  1UVG A;  1OVO A;  1CT0 I;  4UXI A;  3VDU A;  1TBO A;  2Y0M A;  3VDP A;  4A24 A;  1X4S A;  3B4V C;  1CSO I;  3FSY A;  3MEK A;  1FAQ A;  1Z2I A;  2N17 A;  2KMO A;  1HEV A;  2ORV A;  1WTJ A;  1R0R I;  4AML A;  5E3R A;  3E59 A;  4L9M A;  9WGA A;  1IY6 A;  1PTR A;  1SGD I;  1ULK A;  1MJ9 A;  1UVF A;  5DAE A;  1CT2 I;  1P9Z A;  2ENN A;  2ENZ A;  1WGT A;  3UEJ A;  1K7T A;  1BMO A;  1TUR A;  2ARP F;  2K9H A;  2KMQ A;  2UZ3 A;  2VRW B;  3TO6 A;  4WP4 A;  4B6D A;  2KMP A;  1MT1 A;  2V53 A;  1HPT A;  2GKR I;  2NU2 I;  3TOA A;  1SGP I;  3UFF A;  5E3P A;  1ULN A;  1BUS A;  1WGC A;  2QQD A;  2YQP A;  1CE3 A;  1H0Z A;  1CHO I;  1V1H A;  2P6A C;  3OXL A;  2QQC A;  5JHW C;  2L7X A;  3SGB I;  2QQ0 A;  3UEY A;  3SEK C;  2ROW A;  2QPO A;  4SGB I;  2OD1 A;  2E5R A;  2DB6 A;  2B0U C;  2J87 A;  2NU4 I;  5EX0 A;  1AN1 I;  1VDD A;  2OVO A;  2PQ8 A;  1XX6 A;  1IW4 A;  1V1I A;  2NU0 I;  3BJI A;  1Q9B A;  1CT4 I;  1LR9 A;  1PPF I;  1XA6 A;  2DKV A;  2GIV A;  1SGY I;  1U5K A;  1YTP A;  2CJS C;  2JA1 A;  2JYY A;  1PJU A;  3UGL A;  3VE5 A;  1IY5 A;  2XRC A;  2RIJ A;  1N13 A;  1X74 A;  3SGQ I;  1NUB A;  1M8C A;  1SGR I;  2KMR A;  2GKT I;  2L8E A;  2N52 A;  2OZU A;  1R79 A;  3GOX A;  5J8C A;  3R5D A;  1ULM A;  2J9R A;  1CGJ I;  1TBR R;  2NU1 I;  2ORW A;  2QQE A;  2X3T A;  1P9G A;  4UXH A;  3TO9 A;  3FC3 A;  1LR8 A;  1TUS A;  1SGQ I;  1OMU A;  1UUC A;  2N1A B;  2OU2 A;  1MJB A;  1Z7K B;  1CGI I;  3HH2 C;  3QTL D;  3E2I A;  5FUW A;  5J8F A;  4DNC A;  2SGQ I;  3OVO A;  1HJA I;  1TBQ R;  2SGF I;  2W0T A;  2YUU A;  3OXF A;  2WCY A;  4E1R A;  1UHA A;  1TBN A;  2BUS A;  3UOE A;  1TGS I;  5EX3 A;  1PCE A;  3R5C A;  2A20 A;  3OXG A;  1KBF A;  1SGE I;  1KBE A;  2SGP I;  1S20 A;  3R5B A;  1YU6 C;  4UXJ A;  1LR7 A;  5FUV A;  1OYV I;  2CWF A;  2LUY A;  5FUY A;  2GKV A;  5E3Q A;  1K7U A;  2N71 A;  3UGD A;  4MPI A;  2X52 A;  2SGE I;  3TJQ A;  2E73 A;  3D00 A;  5CCM A;  2WVJ A;  2ODD A;  3TOB A;  3R5A A;  5FUX A;  1RFH A;  1WKX A;  1Y1B A;  2CWH A;  1W4R A;  2B8T A;  3PDN A;  2CWG A;  4GI3 C;  1TOT A;  2V1C A; 
#chains in the Genus database with same CATH homology
 3QWP A;  3KY9 A;  1PTQ A;  1XBT A;  2JW6 A;  2LEO A;  4E1P A;  3UGI A;  2V1C C;  1HDL A;  1KMA A;  1DS3 I;  1Y8F A;  1DS2 I;  2JZM A;  4FKD A;  3OL0 A;  5HI7 A;  2NU3 I;  2GVI A;  5HQ8 A;  1FAR A;  4OVO A;  1TIH A;  1M8B A;  4HGU A;  2M5X A;  2SGD I;  3CXL A;  2F3C I;  1SGN I;  4JCV E;  2ERW A;  1FYB A;  1Y1C A;  5CCL A;  3RU0 A;  2ELI A;  2JXD A;  2KCX A;  2FNF X;  2DIP A;  1OMT A;  1W3S A;  1UVG A;  1OVO A;  1CT0 I;  4UXI A;  3VDU A;  1TBO A;  3VDP A;  4A24 A;  1X4S A;  3B4V C;  1CSO I;  3MEK A;  1FAQ A;  2N17 A;  2KMO A;  2ORV A;  1R0R I;  3E59 A;  4L9M A;  1IY6 A;  1PTR A;  1SGD I;  5DAE A;  1UVF A;  1CT2 I;  2ENN A;  2ENZ A;  3UEJ A;  1TUR A;  1BMO A;  2ARP F;  2K9H A;  2KMQ A;  2UZ3 A;  2VRW B;  4B6D A;  2KMP A;  1MT1 A;  2V53 A;  1HPT A;  2GKR I;  2NU2 I;  3UFF A;  1SGP I;  1BUS A;  2QQD A;  2YQP A;  1CE3 A;  1H0Z A;  1CHO I;  1V1H A;  2P6A C;  3OXL A;  2QQC A;  5JHW C;  2L7X A;  3SGB I;  2QQ0 A;  3UEY A;  3SEK C;  2ROW A;  2QPO A;  4SGB I;  2OD1 A;  2E5R A;  2DB6 A;  2B0U C;  2J87 A;  2NU4 I;  5EX0 A;  1AN1 I;  1VDD A;  2OVO A;  1XX6 A;  1IW4 A;  1V1I A;  2NU0 I;  3BJI A;  1CT4 I;  1LR9 A;  1PPF I;  1XA6 A;  1SGY I;  1U5K A;  1YTP A;  2CJS C;  2JA1 A;  2JYY A;  1PJU A;  3UGL A;  3VE5 A;  1IY5 A;  2XRC A;  1N13 A;  1X74 A;  3SGQ I;  1NUB A;  1M8C A;  1SGR I;  2KMR A;  2GKT I;  2L8E A;  2N52 A;  1R79 A;  3GOX A;  2J9R A;  1CGJ I;  1TBR R;  2NU1 I;  2ORW A;  2QQE A;  4UXH A;  3FC3 A;  1LR8 A;  1TUS A;  1SGQ I;  1OMU A;  1UUC A;  2N1A B;  1Z7K B;  1CGI I;  3HH2 C;  3QTL D;  3E2I A;  5FUW A;  2SGQ I;  3OVO A;  1HJA I;  1TBQ R;  2SGF I;  2W0T A;  2YUU A;  3OXF A;  2WCY A;  4E1R A;  1TBN A;  2BUS A;  1TGS I;  5EX3 A;  1PCE A;  2A20 A;  3OXG A;  1KBF A;  1SGE I;  1KBE A;  2SGP I;  1YU6 C;  4UXJ A;  1LR7 A;  5FUV A;  1OYV I;  2LUY A;  5FUY A;  2GKV A;  2N71 A;  3UGD A;  2SGE I;  3TJQ A;  2E73 A;  3D00 A;  5CCM A;  2WVJ A;  2ODD A;  5FUX A;  1RFH A;  1Y1B A;  3PDN A;  1W4R A;  2B8T A;  4GI3 C;  1TOT A;  2V1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...