2GKTI

Crystal structure of the p14'-ala32 variant of the n-terminally truncated omtky3-del(1-5)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTLEYRPLCGSDNKTYANKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ovomucoid
publication title Structural Insights into the Non-additivity Effects in the Sequence-to-Reactivity Algorithm for Serine Peptidases and their Inhibitors.
pubmed doi rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase inhibitor
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2006-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2gktI00
2P6AC 2SGFI 1R0RI 1CT4I 1Z7KB 1Y1BA 1MT1A 1IY5A 1CT2I 1YTPA 1FYBA 1IW4A 1DS2I 1LR8A 2NU3I 1BUSA 1M8BA 1TUSA 2V53A 1TGSI 1OMUA 2ARPF 1LR9A 2ERWA 4HGUA 1HJAI 1CT0I 1UVGA 2KMQA 1SGNI 3B4VC 2KMOA 2M5XA 1HPTA 1CSOI 1CGII 1PJUA 2XRCA 2GKRI 3SGQI 2N52A 2B0UC 1OVOA 1N13A 1AN1I 1TBRR 1YU6C 1KMAA 2JYYA 1NUBA 2F3CI 4OVOA 2LEOA 1TBQR 2KMRA 1SGEI 1HDLA 2JXDA 1UUCA 1SGYI 2KCXA 5DAEA 1SGRI 1OMTA 2SGEI 2JZMA 1BMOA 1TURA 2QQCA 2GKVA 1CE3A 2KMPA 1TIHA 2NU1I 4GI3C 3SEKC 2SGQI 1PPFI 1IY6A 1SGQI 3HH2C 2BUSA 2SGDI 1M8CA 1SGPI 2N71A 1Y1CA 1SGDI 1UVFA 3OVOA 1CGJI 2OVOA 1H0ZA 3SGBI 2NU4I 1PCEA 2NU2I 2WCYA 3TJQA 1LR7A 2NU0I 2QQDA 2SGPI 1DS3I 3QTLD 5JHWC 4SGBI 2GKTI 1OYVI 1CHOI 2N17A
chains in the Genus database with same CATH superfamily
1S20A 2P6AC 2SGFI 3E2IA 1R0RI 2ENZA 2A20A 1CT4I 3TO9A 1WTJA 9WGAA 4E1RA 1Z7KB 1WGCA 3OXFA 2K9HA 2ORVA 2W0TA 3OXGA 1MJAA 2UVOA 1Y1BA 3VDUA 1MT1A 2OU2A 1CT2I 1YTPA 5E3RA 3VE5A 5CCMA 1IW4A 3QWPA 1IY5A 1FYBA 1DS2I 5HQ8A 1LR8A 2NU3I 2DB6A 3GOXA 1ULMA 4MPIA 1BUSA 3TO6A 1W4RA 2WVJA 2QQEA 3FSXA 1ULKA 1TBNA 3R5AA 1M8BA 1NXUA 1TUSA 1XA6A 3E59A 2QQ0A 2V53A 2GVIA 2JW6A 1TGSI 3TOBA 1K7UA 1OMUA 2CWFA 2ARPF 1K7TA 1P9GA 2CWGA 2DIPA 3OL0A 1LR9A 2ERWA 2YQPA 4HGUA 5FUYA 3UFFA 1HJAI 3UGLA 2LB7A 1CT0I 1UVGA 1KBFA 2KMQA 1SGNI 2OZUA 3B4VC 2QPOA 2KMOA 2M5XA 1HPTA 1CSOI 3FC3A 5FUVA 1X74A 1CGII 2ORWA 4UXJA 5EX3A 1PJUA 1TBOA 2XRCA 2GKRI 3SGQI 2N52A 2B0UC 4UXIA 4DNCA 1OVOA 1N13A 4WP4A 1AN1I 1TBRR 3RU0A 1VDDA 1YU6C 4B6DA 1FY7A 1KMAA 2JYYA 1NUBA 2F3CI 4OVOA 2LEOA 3MEKA 1TBQR 2KMRA 2J9RA 3R5DA 4AMLA 1SGEI 3TO7A 1HDLA 7WGAA 2JXDA 1UUCA 1XBTA 2ELIA 2FNFX 4E1PA 1SGYI 3CXLA 2KCXA 3R5BA 2ROWA 5DAEA 1SGRI 2OD1A 4FKDA 1OMTA 2SGEI 2JZMA 1X4SA 1BMOA 1TURA 3QAHA 2QQCA 2GKVA 5EX0A 1CE3A 1V1IA 2L7XA 2KMPA 1TIHA 2NU1I 4GI3C 5FUXA 2X3TA 5HI7A 2N1AB 1P9ZA 3UEYA 1PTRA 2SGQI 3SEKC 2UZ3A 1PPFI 1ULNA 2B8TA 1IY6A 1SGQI 3HH2C 1PTQA 1WKXA 1U5KA 5FUWA 2BUSA 2DKVA 1XX6A 1M8CA 2SGDI 1SGPI 2N71A 1K7VA 1Y1CA 3UGDA 5CCLA 1RFHA 1SGDI 2WGCA 1UVFA 3OVOA 1CGJI 5J8FA 2ODDA 2YUUA 3OXLA 1MJBA 2JA1A 2L8EA 3FSYA 2OVOA 3KY9A 2LUYA 3R5CA 2CJSC 1H0ZA 2E73A 2E5RA 4L9MA 1UHAA 2J87A 1Y8FA 3SGBI 3VDPA 4A24A 2NU4I 2RC4A 3BJIA 1Q9BA 1MJ9A 1HEVA 2VRWB 1KBEA 1Z2IA 1TOTA 1PCEA 2NU2I 5E3PA 3UGIA 2WCYA 2X52A 1W3SA 3TJQA 3PDNA 1LR7A 2ENNA 4JCVE 2V1CC 1V1HA 2NU0I 1FARA 2RIJA 5J8CA 2QQDA 2SGPI 3D00A 1DS3I 5E3QA 3UOEA 2GIVA 3TOAA 2CWHA 1R79A 3QTLD 5JHWC 3UEJA 4UXHA 1FAQA 2Y0MA 4SGBI 2GKTI 2V1CA 2PQ8A 1OYVI 1CHOI 2N17A 1WGTA
chains in the Genus database with same CATH topology
2P6AC 2SGFI 3E2IA 1R0RI 2ENZA 2A20A 1CT4I 4E1RA 1Z7KB 3OXFA 2K9HA 2ORVA 2W0TA 3OXGA 1Y1BA 3VDUA 1MT1A 3VE5A 1CT2I 1YTPA 5CCMA 1IY5A 1FYBA 1IW4A 3QWPA 1DS2I 5HQ8A 1LR8A 2NU3I 2DB6A 3GOXA 1BUSA 1W4RA 2WVJA 2QQEA 1TBNA 1M8BA 1TUSA 1XA6A 3E59A 2QQ0A 2V53A 2GVIA 2JW6A 1TGSI 1OMUA 2ARPF 2DIPA 3OL0A 1LR9A 2ERWA 2YQPA 4HGUA 5FUYA 3UFFA 1HJAI 3UGLA 1CT0I 1UVGA 1KBFA 2KMQA 1SGNI 3B4VC 2QPOA 2KMOA 2M5XA 1HPTA 1CSOI 3FC3A 5FUVA 1X74A 1CGII 2ORWA 4UXJA 5EX3A 1PJUA 1TBOA 2XRCA 2GKRI 3SGQI 2N52A 2B0UC 4UXIA 1OVOA 1N13A 1AN1I 1TBRR 3RU0A 1VDDA 1YU6C 4B6DA 1KMAA 2JYYA 1NUBA 2F3CI 4OVOA 2LEOA 3MEKA 1TBQR 2KMRA 2J9RA 1SGEI 1HDLA 2JXDA 1UUCA 1XBTA 2ELIA 2FNFX 4E1PA 1SGYI 3CXLA 2KCXA 2ROWA 5DAEA 1SGRI 2OD1A 4FKDA 1OMTA 2SGEI 2JZMA 1X4SA 1BMOA 1TURA 2QQCA 2GKVA 5EX0A 1CE3A 1V1IA 2L7XA 2KMPA 1TIHA 2NU1I 4GI3C 5FUXA 5HI7A 2N1AB 3UEYA 1PTRA 2SGQI 3SEKC 2UZ3A 1PPFI 2B8TA 1IY6A 1SGQI 3HH2C 1PTQA 1U5KA 5FUWA 2BUSA 1XX6A 1M8CA 2SGDI 1SGPI 2N71A 1Y1CA 3UGDA 5CCLA 1RFHA 1SGDI 1UVFA 3OVOA 1CGJI 2ODDA 2YUUA 3OXLA 2JA1A 2L8EA 3KY9A 2OVOA 2LUYA 2CJSC 1H0ZA 2E73A 2E5RA 4L9MA 2J87A 1Y8FA 3SGBI 3VDPA 4A24A 2NU4I 3BJIA 2VRWB 1KBEA 1TOTA 1PCEA 2NU2I 3UGIA 2WCYA 1W3SA 3TJQA 3PDNA 1LR7A 2ENNA 4JCVE 2V1CC 1V1HA 2NU0I 1FARA 2QQDA 2SGPI 3D00A 1DS3I 1R79A 3QTLD 5JHWC 3UEJA 4UXHA 1FAQA 4SGBI 2GKTI 2V1CA 1OYVI 1CHOI 2N17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6A C;  2SGF I;  1R0R I;  1CT4 I;  1Z7K B;  1Y1B A;  1MT1 A;  1IY5 A;  1CT2 I;  1YTP A;  1FYB A;  1IW4 A;  1DS2 I;  1LR8 A;  2NU3 I;  1BUS A;  1M8B A;  1TUS A;  2V53 A;  1TGS I;  1OMU A;  2ARP F;  1LR9 A;  2ERW A;  4HGU A;  1HJA I;  1CT0 I;  1UVG A;  2KMQ A;  1SGN I;  3B4V C;  2KMO A;  2M5X A;  1HPT A;  1CSO I;  1CGI I;  1PJU A;  2XRC A;  2GKR I;  3SGQ I;  2N52 A;  2B0U C;  1OVO A;  1N13 A;  1AN1 I;  1TBR R;  1YU6 C;  1KMA A;  2JYY A;  1NUB A;  2F3C I;  4OVO A;  2LEO A;  1TBQ R;  2KMR A;  1SGE I;  1HDL A;  2JXD A;  1UUC A;  1SGY I;  2KCX A;  5DAE A;  1SGR I;  1OMT A;  2SGE I;  2JZM A;  1BMO A;  1TUR A;  2QQC A;  2GKV A;  1CE3 A;  2KMP A;  1TIH A;  2NU1 I;  4GI3 C;  3SEK C;  2SGQ I;  1PPF I;  1IY6 A;  1SGQ I;  3HH2 C;  2BUS A;  2SGD I;  1M8C A;  1SGP I;  2N71 A;  1Y1C A;  1SGD I;  1UVF A;  3OVO A;  1CGJ I;  2OVO A;  1H0Z A;  3SGB I;  2NU4 I;  1PCE A;  2NU2 I;  2WCY A;  3TJQ A;  1LR7 A;  2NU0 I;  2QQD A;  2SGP I;  1DS3 I;  3QTL D;  5JHW C;  4SGB I;  2GKT I;  1OYV I;  1CHO I;  2N17 A; 
#chains in the Genus database with same CATH topology
 1S20 A;  2P6A C;  2SGF I;  3E2I A;  1R0R I;  2ENZ A;  2A20 A;  1CT4 I;  3TO9 A;  1WTJ A;  9WGA A;  4E1R A;  1Z7K B;  1WGC A;  3OXF A;  2K9H A;  2ORV A;  2W0T A;  3OXG A;  1MJA A;  2UVO A;  1Y1B A;  3VDU A;  1MT1 A;  2OU2 A;  1CT2 I;  1YTP A;  5E3R A;  3VE5 A;  5CCM A;  1IW4 A;  3QWP A;  1IY5 A;  1FYB A;  1DS2 I;  5HQ8 A;  1LR8 A;  2NU3 I;  2DB6 A;  3GOX A;  1ULM A;  4MPI A;  1BUS A;  3TO6 A;  1W4R A;  2WVJ A;  2QQE A;  3FSX A;  1ULK A;  1TBN A;  3R5A A;  1M8B A;  1NXU A;  1TUS A;  1XA6 A;  3E59 A;  2QQ0 A;  2V53 A;  2GVI A;  2JW6 A;  1TGS I;  3TOB A;  1K7U A;  1OMU A;  2CWF A;  2ARP F;  1K7T A;  1P9G A;  2CWG A;  2DIP A;  3OL0 A;  1LR9 A;  2ERW A;  2YQP A;  4HGU A;  5FUY A;  3UFF A;  1HJA I;  3UGL A;  2LB7 A;  1CT0 I;  1UVG A;  1KBF A;  2KMQ A;  1SGN I;  2OZU A;  3B4V C;  2QPO A;  2KMO A;  2M5X A;  1HPT A;  1CSO I;  3FC3 A;  5FUV A;  1X74 A;  1CGI I;  2ORW A;  4UXJ A;  5EX3 A;  1PJU A;  1TBO A;  2XRC A;  2GKR I;  3SGQ I;  2N52 A;  2B0U C;  4UXI A;  4DNC A;  1OVO A;  1N13 A;  4WP4 A;  1AN1 I;  1TBR R;  3RU0 A;  1VDD A;  1YU6 C;  4B6D A;  1FY7 A;  1KMA A;  2JYY A;  1NUB A;  2F3C I;  4OVO A;  2LEO A;  3MEK A;  1TBQ R;  2KMR A;  2J9R A;  3R5D A;  4AML A;  1SGE I;  3TO7 A;  1HDL A;  7WGA A;  2JXD A;  1UUC A;  1XBT A;  2ELI A;  2FNF X;  4E1P A;  1SGY I;  3CXL A;  2KCX A;  3R5B A;  2ROW A;  5DAE A;  1SGR I;  2OD1 A;  4FKD A;  1OMT A;  2SGE I;  2JZM A;  1X4S A;  1BMO A;  1TUR A;  3QAH A;  2QQC A;  2GKV A;  5EX0 A;  1CE3 A;  1V1I A;  2L7X A;  2KMP A;  1TIH A;  2NU1 I;  4GI3 C;  5FUX A;  2X3T A;  5HI7 A;  2N1A B;  1P9Z A;  3UEY A;  1PTR A;  2SGQ I;  3SEK C;  2UZ3 A;  1PPF I;  1ULN A;  2B8T A;  1IY6 A;  1SGQ I;  3HH2 C;  1PTQ A;  1WKX A;  1U5K A;  5FUW A;  2BUS A;  2DKV A;  1XX6 A;  1M8C A;  2SGD I;  1SGP I;  2N71 A;  1K7V A;  1Y1C A;  3UGD A;  5CCL A;  1RFH A;  1SGD I;  2WGC A;  1UVF A;  3OVO A;  1CGJ I;  5J8F A;  2ODD A;  2YUU A;  3OXL A;  1MJB A;  2JA1 A;  2L8E A;  3FSY A;  2OVO A;  3KY9 A;  2LUY A;  3R5C A;  2CJS C;  1H0Z A;  2E73 A;  2E5R A;  4L9M A;  1UHA A;  2J87 A;  1Y8F A;  3SGB I;  3VDP A;  4A24 A;  2NU4 I;  2RC4 A;  3BJI A;  1Q9B A;  1MJ9 A;  1HEV A;  2VRW B;  1KBE A;  1Z2I A;  1TOT A;  1PCE A;  2NU2 I;  5E3P A;  3UGI A;  2WCY A;  2X52 A;  1W3S A;  3TJQ A;  3PDN A;  1LR7 A;  2ENN A;  4JCV E;  2V1C C;  1V1H A;  2NU0 I;  1FAR A;  2RIJ A;  5J8C A;  2QQD A;  2SGP I;  3D00 A;  1DS3 I;  5E3Q A;  3UOE A;  2GIV A;  3TOA A;  2CWH A;  1R79 A;  3QTL D;  5JHW C;  3UEJ A;  4UXH A;  1FAQ A;  2Y0M A;  4SGB I;  2GKT I;  2V1C A;  2PQ8 A;  1OYV I;  1CHO I;  2N17 A;  1WGT A; 
#chains in the Genus database with same CATH homology
 2P6A C;  2SGF I;  3E2I A;  1R0R I;  2ENZ A;  2A20 A;  1CT4 I;  4E1R A;  1Z7K B;  3OXF A;  2K9H A;  2ORV A;  2W0T A;  3OXG A;  1Y1B A;  3VDU A;  1MT1 A;  3VE5 A;  1CT2 I;  1YTP A;  5CCM A;  1IY5 A;  1FYB A;  1IW4 A;  3QWP A;  1DS2 I;  5HQ8 A;  1LR8 A;  2NU3 I;  2DB6 A;  3GOX A;  1BUS A;  1W4R A;  2WVJ A;  2QQE A;  1TBN A;  1M8B A;  1TUS A;  1XA6 A;  3E59 A;  2QQ0 A;  2V53 A;  2GVI A;  2JW6 A;  1TGS I;  1OMU A;  2ARP F;  2DIP A;  3OL0 A;  1LR9 A;  2ERW A;  2YQP A;  4HGU A;  5FUY A;  3UFF A;  1HJA I;  3UGL A;  1CT0 I;  1UVG A;  1KBF A;  2KMQ A;  1SGN I;  3B4V C;  2QPO A;  2KMO A;  2M5X A;  1HPT A;  1CSO I;  3FC3 A;  5FUV A;  1X74 A;  1CGI I;  2ORW A;  4UXJ A;  5EX3 A;  1PJU A;  1TBO A;  2XRC A;  2GKR I;  3SGQ I;  2N52 A;  2B0U C;  4UXI A;  1OVO A;  1N13 A;  1AN1 I;  1TBR R;  3RU0 A;  1VDD A;  1YU6 C;  4B6D A;  1KMA A;  2JYY A;  1NUB A;  2F3C I;  4OVO A;  2LEO A;  3MEK A;  1TBQ R;  2KMR A;  2J9R A;  1SGE I;  1HDL A;  2JXD A;  1UUC A;  1XBT A;  2ELI A;  2FNF X;  4E1P A;  1SGY I;  3CXL A;  2KCX A;  2ROW A;  5DAE A;  1SGR I;  2OD1 A;  4FKD A;  1OMT A;  2SGE I;  2JZM A;  1X4S A;  1BMO A;  1TUR A;  2QQC A;  2GKV A;  5EX0 A;  1CE3 A;  1V1I A;  2L7X A;  2KMP A;  1TIH A;  2NU1 I;  4GI3 C;  5FUX A;  5HI7 A;  2N1A B;  3UEY A;  1PTR A;  2SGQ I;  3SEK C;  2UZ3 A;  1PPF I;  2B8T A;  1IY6 A;  1SGQ I;  3HH2 C;  1PTQ A;  1U5K A;  5FUW A;  2BUS A;  1XX6 A;  1M8C A;  2SGD I;  1SGP I;  2N71 A;  1Y1C A;  3UGD A;  5CCL A;  1RFH A;  1SGD I;  1UVF A;  3OVO A;  1CGJ I;  2ODD A;  2YUU A;  3OXL A;  2JA1 A;  2L8E A;  3KY9 A;  2OVO A;  2LUY A;  2CJS C;  1H0Z A;  2E73 A;  2E5R A;  4L9M A;  2J87 A;  1Y8F A;  3SGB I;  3VDP A;  4A24 A;  2NU4 I;  3BJI A;  2VRW B;  1KBE A;  1TOT A;  1PCE A;  2NU2 I;  3UGI A;  2WCY A;  1W3S A;  3TJQ A;  3PDN A;  1LR7 A;  2ENN A;  4JCV E;  2V1C C;  1V1H A;  2NU0 I;  1FAR A;  2QQD A;  2SGP I;  3D00 A;  1DS3 I;  1R79 A;  3QTL D;  5JHW C;  3UEJ A;  4UXH A;  1FAQ A;  4SGB I;  2GKT I;  2V1C A;  1OYV I;  1CHO I;  2N17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...