1DS2I

Crystal structure of sgpb:omtky3-coo-leu18i
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
50
Chain Sequence
b'VDCSEYPKPACTEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE B (SGPB)
publication title Contribution of peptide bonds to inhibitor-protease binding: crystal structures of the turkey ovomucoid third domain backbone variants OMTKY3-Pro18I and OMTKY3-psi[COO]-Leu18I in complex with Streptomyces griseus proteinase B (SGPB) and the structure of the free inhibitor, OMTKY-3-psi[CH2NH2+]-Asp19I
pubmed doi rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
total genus 13
structure length 50
sequence length 51
ec nomenclature
pdb deposition date 2000-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1ds2I00
1LR7A 2QQCA 1CGII 1FYBA 1UUCA 1CT0I 1YTPA 2WCYA 2NU4I 2LEOA 2GKRI 1OVOA 1SGQI 2N71A 3OVOA 1BMOA 3SGQI 1Z7KB 3B4VC 1TBQR 1Y1CA 2GKTI 2KMRA 2NU2I 1SGPI 1M8CA 1SGNI 1DS3I 2B0UC 1Y1BA 5JHWC 1CGJI 1M8BA 1UVGA 1PCEA 2ERWA 1CE3A 1HJAI 1TBRR 1TGSI 2N52A 4GI3C 2KMPA 1IY5A 1SGYI 1SGDI 1CT4I 1OYVI 2JXDA 4HGUA 1MT1A 4SGBI 1YU6C 2GKVA 2SGFI 1PJUA 2NU3I 2KCXA 1IY6A 2F3CI 2SGEI 1N13A 1LR8A 4OVOA 1H0ZA 2SGPI 1TURA 2N17A 1PPFI 1NUBA 2JZMA 2NU1I 1TUSA 2JYYA 1LR9A 1UVFA 2KMOA 3HH2C 1SGRI 2OVOA 2M5XA 2SGQI 1SGEI 2QQDA 1HDLA 2KMQA 1AN1I 1CSOI 1OMTA 1IW4A 2V53A 2XRCA 1HPTA 2BUSA 1OMUA 1DS2I 3SEKC 1KMAA 2ARPF 1BUSA 1TIHA 3QTLD 3SGBI 3TJQA 1R0RI 2SGDI 5DAEA 2P6AC 2NU0I 1CHOI 1CT2I
chains in the Genus database with same CATH superfamily
2VRWB 1LR7A 2QQCA 1MJAA 1CGII 3TOAA 1FYBA 1XA6A 4E1PA 5HI7A 2LB7A 1UUCA 1CT0I 1YTPA 2WCYA 2RIJA 3R5AA 4B6DA 1PTQA 2NU4I 2LEOA 2UVOA 4JCVE 2L8EA 2GKRI 2ORWA 1V1HA 2E73A 1OVOA 3QAHA 1SGQI 2N71A 2DKVA 5EX0A 2CWHA 1PTRA 2E5RA 3MEKA 3BJIA 3OVOA 1BMOA 4MPIA 3R5CA 3SGQI 1Z7KB 3KY9A 4AMLA 1K7VA 2ELIA 2V1CC 2DIPA 2V1CA 3B4VC 2B8TA 5E3RA 2L7XA 1TBQR 1Y1CA 3QWPA 2GVIA 2GKTI 2KMRA 5J8FA 2K9HA 1MJBA 5HQ8A 1TBOA 2NU2I 3UGIA 1SGPI 1M8CA 1SGNI 3UGLA 4E1RA 1DS3I 1XX6A 2B0UC 2X52A 1Y1BA 9WGAA 5JHWC 2X3TA 1FY7A 3TO9A 1CGJI 1M8BA 3CXLA 1UVGA 1UHAA 1TOTA 1PCEA 2ERWA 1VDDA 5E3QA 1CE3A 1NXUA 1WGCA 2WVJA 2OD1A 1HJAI 1WGTA 1TBRR 2LUYA 2YUUA 3UEJA 1TGSI 2N1AB 2N52A 2W0TA 4GI3C 1X4SA 1XBTA 4L9MA 3UGDA 2KMPA 1MJ9A 1IY5A 1WKXA 3D00A 2ORVA 1SGYI 3PDNA 1SGDI 2CJSC 4UXIA 1FAQA 1ULMA 1CT4I 1KBEA 1OYVI 2JXDA 4HGUA 1MT1A 1S20A 2PQ8A 4SGBI 3RU0A 3TOBA 2A20A 3UOEA 1KBFA 1YU6C 2WGCA 3UEYA 5EX3A 2GKVA 3TO7A 2SGFI 3FSXA 1W4RA 1PJUA 2NU3I 2KCXA 2RC4A 5E3PA 1IY6A 3OXFA 2F3CI 5CCLA 2SGEI 1ULKA 2FNFX 3OXGA 4A24A 7WGAA 1N13A 2YQPA 1ULNA 1LR8A 2DB6A 1V1IA 3UFFA 1U5KA 1Q9BA 2CWGA 2JA1A 2OU2A 3VDUA 4OVOA 1H0ZA 2SGPI 1TURA 2N17A 1PPFI 1NUBA 2JZMA 2OZUA 2UZ3A 3R5BA 3R5DA 2NU1I 1TUSA 4UXHA 2JYYA 1LR9A 1UVFA 1Z2IA 2KMOA 3OL0A 4FKDA 5J8CA 3FC3A 3HH2C 1SGRI 2QQEA 1P9ZA 2OVOA 2ROWA 3VE5A 5FUWA 1Y8FA 2M5XA 2SGQI 1SGEI 2QQDA 2J9RA 5FUXA 1HDLA 1K7UA 2KMQA 1P9GA 3OXLA 3FSYA 1AN1I 2ODDA 2ENNA 1CSOI 5FUVA 1OMTA 2ENZA 1IW4A 2V53A 2XRCA 4UXJA 5CCMA 1HPTA 2GIVA 2BUSA 4WP4A 1RFHA 1OMUA 1DS2I 4DNCA 1HEVA 3SEKC 1K7TA 1WTJA 2J87A 2QQ0A 1KMAA 2ARPF 1BUSA 3TO6A 3GOXA 1TIHA 3E2IA 5FUYA 3E59A 3QTLD 3SGBI 3TJQA 1R0RI 1W3SA 2SGDI 3VDPA 1R79A 1FARA 2Y0MA 5DAEA 2P6AC 2JW6A 2NU0I 1CHOI 1CT2I 1TBNA 2CWFA 1X74A 2QPOA
chains in the Genus database with same CATH topology
2VRWB 1LR7A 2QQCA 1CGII 1FYBA 1XA6A 4E1PA 5HI7A 1UUCA 1CT0I 1YTPA 2WCYA 4B6DA 1PTQA 2NU4I 2LEOA 4JCVE 2L8EA 2GKRI 2ORWA 1V1HA 2E73A 1OVOA 1SGQI 2N71A 5EX0A 2E5RA 1PTRA 3MEKA 3BJIA 3OVOA 1BMOA 3SGQI 1Z7KB 3KY9A 2ELIA 2V1CC 2DIPA 2V1CA 3B4VC 2B8TA 2L7XA 1TBQR 1Y1CA 3QWPA 2GVIA 2GKTI 2KMRA 2K9HA 5HQ8A 1TBOA 2NU2I 3UGIA 1SGPI 1M8CA 1SGNI 3UGLA 4E1RA 1DS3I 1XX6A 2B0UC 1Y1BA 5JHWC 1CGJI 1M8BA 3CXLA 1UVGA 1TOTA 1PCEA 2ERWA 1VDDA 1CE3A 2WVJA 2OD1A 1HJAI 2YUUA 1TBRR 2LUYA 3UEJA 1TGSI 2N1AB 2N52A 2W0TA 4GI3C 1X4SA 1XBTA 4L9MA 3UGDA 2KMPA 1IY5A 3D00A 2ORVA 1SGYI 3PDNA 1SGDI 2CJSC 4UXIA 1FAQA 1CT4I 1KBEA 1OYVI 2JXDA 4HGUA 1MT1A 4SGBI 3RU0A 2A20A 1KBFA 1YU6C 3UEYA 5EX3A 2GKVA 2SGFI 1W4RA 1PJUA 2NU3I 2KCXA 1IY6A 3OXFA 2F3CI 5CCLA 2SGEI 2FNFX 3OXGA 4A24A 1N13A 2YQPA 1LR8A 2DB6A 1V1IA 3UFFA 1U5KA 2JA1A 3VDUA 4OVOA 1H0ZA 2SGPI 1TURA 2N17A 1PPFI 1NUBA 2JZMA 2UZ3A 2NU1I 1TUSA 4UXHA 2JYYA 1LR9A 1UVFA 2KMOA 3OL0A 4FKDA 3FC3A 3HH2C 1SGRI 2QQEA 3VE5A 2OVOA 2ROWA 5FUWA 1Y8FA 2M5XA 2SGQI 1SGEI 2QQDA 2J9RA 5FUXA 1HDLA 2KMQA 3OXLA 1AN1I 2ODDA 2ENNA 1CSOI 5FUVA 1OMTA 2ENZA 1IW4A 2V53A 2XRCA 4UXJA 5CCMA 1HPTA 2BUSA 1RFHA 1OMUA 1DS2I 3SEKC 2J87A 2QQ0A 1KMAA 2ARPF 1BUSA 3GOXA 1TIHA 3E2IA 5FUYA 3E59A 3QTLD 3SGBI 3TJQA 1R0RI 1W3SA 2SGDI 3VDPA 1R79A 1FARA 5DAEA 2P6AC 2JW6A 2NU0I 1CHOI 1CT2I 1TBNA 1X74A 2QPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LR7 A;  2QQC A;  1CGI I;  1FYB A;  1UUC A;  1CT0 I;  1YTP A;  2WCY A;  2NU4 I;  2LEO A;  2GKR I;  1OVO A;  1SGQ I;  2N71 A;  3OVO A;  1BMO A;  3SGQ I;  1Z7K B;  3B4V C;  1TBQ R;  1Y1C A;  2GKT I;  2KMR A;  2NU2 I;  1SGP I;  1M8C A;  1SGN I;  1DS3 I;  2B0U C;  1Y1B A;  5JHW C;  1CGJ I;  1M8B A;  1UVG A;  1PCE A;  2ERW A;  1CE3 A;  1HJA I;  1TBR R;  1TGS I;  2N52 A;  4GI3 C;  2KMP A;  1IY5 A;  1SGY I;  1SGD I;  1CT4 I;  1OYV I;  2JXD A;  4HGU A;  1MT1 A;  4SGB I;  1YU6 C;  2GKV A;  2SGF I;  1PJU A;  2NU3 I;  2KCX A;  1IY6 A;  2F3C I;  2SGE I;  1N13 A;  1LR8 A;  4OVO A;  1H0Z A;  2SGP I;  1TUR A;  2N17 A;  1PPF I;  1NUB A;  2JZM A;  2NU1 I;  1TUS A;  2JYY A;  1LR9 A;  1UVF A;  2KMO A;  3HH2 C;  1SGR I;  2OVO A;  2M5X A;  2SGQ I;  1SGE I;  2QQD A;  1HDL A;  2KMQ A;  1AN1 I;  1CSO I;  1OMT A;  1IW4 A;  2V53 A;  2XRC A;  1HPT A;  2BUS A;  1OMU A;  1DS2 I;  3SEK C;  1KMA A;  2ARP F;  1BUS A;  1TIH A;  3QTL D;  3SGB I;  3TJQ A;  1R0R I;  2SGD I;  5DAE A;  2P6A C;  2NU0 I;  1CHO I;  1CT2 I; 
#chains in the Genus database with same CATH topology
 2VRW B;  1LR7 A;  2QQC A;  1MJA A;  1CGI I;  3TOA A;  1FYB A;  1XA6 A;  4E1P A;  5HI7 A;  2LB7 A;  1UUC A;  1CT0 I;  1YTP A;  2WCY A;  2RIJ A;  3R5A A;  4B6D A;  1PTQ A;  2NU4 I;  2LEO A;  2UVO A;  4JCV E;  2L8E A;  2GKR I;  2ORW A;  1V1H A;  2E73 A;  1OVO A;  3QAH A;  1SGQ I;  2N71 A;  2DKV A;  5EX0 A;  2CWH A;  1PTR A;  2E5R A;  3MEK A;  3BJI A;  3OVO A;  1BMO A;  4MPI A;  3R5C A;  3SGQ I;  1Z7K B;  3KY9 A;  4AML A;  1K7V A;  2ELI A;  2V1C C;  2DIP A;  2V1C A;  3B4V C;  2B8T A;  5E3R A;  2L7X A;  1TBQ R;  1Y1C A;  3QWP A;  2GVI A;  2GKT I;  2KMR A;  5J8F A;  2K9H A;  1MJB A;  5HQ8 A;  1TBO A;  2NU2 I;  3UGI A;  1SGP I;  1M8C A;  1SGN I;  3UGL A;  4E1R A;  1DS3 I;  1XX6 A;  2B0U C;  2X52 A;  1Y1B A;  9WGA A;  5JHW C;  2X3T A;  1FY7 A;  3TO9 A;  1CGJ I;  1M8B A;  3CXL A;  1UVG A;  1UHA A;  1TOT A;  1PCE A;  2ERW A;  1VDD A;  5E3Q A;  1CE3 A;  1NXU A;  1WGC A;  2WVJ A;  2OD1 A;  1HJA I;  1WGT A;  1TBR R;  2LUY A;  2YUU A;  3UEJ A;  1TGS I;  2N1A B;  2N52 A;  2W0T A;  4GI3 C;  1X4S A;  1XBT A;  4L9M A;  3UGD A;  2KMP A;  1MJ9 A;  1IY5 A;  1WKX A;  3D00 A;  2ORV A;  1SGY I;  3PDN A;  1SGD I;  2CJS C;  4UXI A;  1FAQ A;  1ULM A;  1CT4 I;  1KBE A;  1OYV I;  2JXD A;  4HGU A;  1MT1 A;  1S20 A;  2PQ8 A;  4SGB I;  3RU0 A;  3TOB A;  2A20 A;  3UOE A;  1KBF A;  1YU6 C;  2WGC A;  3UEY A;  5EX3 A;  2GKV A;  3TO7 A;  2SGF I;  3FSX A;  1W4R A;  1PJU A;  2NU3 I;  2KCX A;  2RC4 A;  5E3P A;  1IY6 A;  3OXF A;  2F3C I;  5CCL A;  2SGE I;  1ULK A;  2FNF X;  3OXG A;  4A24 A;  7WGA A;  1N13 A;  2YQP A;  1ULN A;  1LR8 A;  2DB6 A;  1V1I A;  3UFF A;  1U5K A;  1Q9B A;  2CWG A;  2JA1 A;  2OU2 A;  3VDU A;  4OVO A;  1H0Z A;  2SGP I;  1TUR A;  2N17 A;  1PPF I;  1NUB A;  2JZM A;  2OZU A;  2UZ3 A;  3R5B A;  3R5D A;  2NU1 I;  1TUS A;  4UXH A;  2JYY A;  1LR9 A;  1UVF A;  1Z2I A;  2KMO A;  3OL0 A;  4FKD A;  5J8C A;  3FC3 A;  3HH2 C;  1SGR I;  2QQE A;  1P9Z A;  2OVO A;  2ROW A;  3VE5 A;  5FUW A;  1Y8F A;  2M5X A;  2SGQ I;  1SGE I;  2QQD A;  2J9R A;  5FUX A;  1HDL A;  1K7U A;  2KMQ A;  1P9G A;  3OXL A;  3FSY A;  1AN1 I;  2ODD A;  2ENN A;  1CSO I;  5FUV A;  1OMT A;  2ENZ A;  1IW4 A;  2V53 A;  2XRC A;  4UXJ A;  5CCM A;  1HPT A;  2GIV A;  2BUS A;  4WP4 A;  1RFH A;  1OMU A;  1DS2 I;  4DNC A;  1HEV A;  3SEK C;  1K7T A;  1WTJ A;  2J87 A;  2QQ0 A;  1KMA A;  2ARP F;  1BUS A;  3TO6 A;  3GOX A;  1TIH A;  3E2I A;  5FUY A;  3E59 A;  3QTL D;  3SGB I;  3TJQ A;  1R0R I;  1W3S A;  2SGD I;  3VDP A;  1R79 A;  1FAR A;  2Y0M A;  5DAE A;  2P6A C;  2JW6 A;  2NU0 I;  1CHO I;  1CT2 I;  1TBN A;  2CWF A;  1X74 A;  2QPO A; 
#chains in the Genus database with same CATH homology
 2VRW B;  1LR7 A;  2QQC A;  1CGI I;  1FYB A;  1XA6 A;  4E1P A;  5HI7 A;  1UUC A;  1CT0 I;  1YTP A;  2WCY A;  4B6D A;  1PTQ A;  2NU4 I;  2LEO A;  4JCV E;  2L8E A;  2GKR I;  2ORW A;  1V1H A;  2E73 A;  1OVO A;  1SGQ I;  2N71 A;  5EX0 A;  2E5R A;  1PTR A;  3MEK A;  3BJI A;  3OVO A;  1BMO A;  3SGQ I;  1Z7K B;  3KY9 A;  2ELI A;  2V1C C;  2DIP A;  2V1C A;  3B4V C;  2B8T A;  2L7X A;  1TBQ R;  1Y1C A;  3QWP A;  2GVI A;  2GKT I;  2KMR A;  2K9H A;  5HQ8 A;  1TBO A;  2NU2 I;  3UGI A;  1SGP I;  1M8C A;  1SGN I;  3UGL A;  4E1R A;  1DS3 I;  1XX6 A;  2B0U C;  1Y1B A;  5JHW C;  1CGJ I;  1M8B A;  3CXL A;  1UVG A;  1TOT A;  1PCE A;  2ERW A;  1VDD A;  1CE3 A;  2WVJ A;  2OD1 A;  1HJA I;  2YUU A;  1TBR R;  2LUY A;  3UEJ A;  1TGS I;  2N1A B;  2N52 A;  2W0T A;  4GI3 C;  1X4S A;  1XBT A;  4L9M A;  3UGD A;  2KMP A;  1IY5 A;  3D00 A;  2ORV A;  1SGY I;  3PDN A;  1SGD I;  2CJS C;  4UXI A;  1FAQ A;  1CT4 I;  1KBE A;  1OYV I;  2JXD A;  4HGU A;  1MT1 A;  4SGB I;  3RU0 A;  2A20 A;  1KBF A;  1YU6 C;  3UEY A;  5EX3 A;  2GKV A;  2SGF I;  1W4R A;  1PJU A;  2NU3 I;  2KCX A;  1IY6 A;  3OXF A;  2F3C I;  5CCL A;  2SGE I;  2FNF X;  3OXG A;  4A24 A;  1N13 A;  2YQP A;  1LR8 A;  2DB6 A;  1V1I A;  3UFF A;  1U5K A;  2JA1 A;  3VDU A;  4OVO A;  1H0Z A;  2SGP I;  1TUR A;  2N17 A;  1PPF I;  1NUB A;  2JZM A;  2UZ3 A;  2NU1 I;  1TUS A;  4UXH A;  2JYY A;  1LR9 A;  1UVF A;  2KMO A;  3OL0 A;  4FKD A;  3FC3 A;  3HH2 C;  1SGR I;  2QQE A;  3VE5 A;  2OVO A;  2ROW A;  5FUW A;  1Y8F A;  2M5X A;  2SGQ I;  1SGE I;  2QQD A;  2J9R A;  5FUX A;  1HDL A;  2KMQ A;  3OXL A;  1AN1 I;  2ODD A;  2ENN A;  1CSO I;  5FUV A;  1OMT A;  2ENZ A;  1IW4 A;  2V53 A;  2XRC A;  4UXJ A;  5CCM A;  1HPT A;  2BUS A;  1RFH A;  1OMU A;  1DS2 I;  3SEK C;  2J87 A;  2QQ0 A;  1KMA A;  2ARP F;  1BUS A;  3GOX A;  1TIH A;  3E2I A;  5FUY A;  3E59 A;  3QTL D;  3SGB I;  3TJQ A;  1R0R I;  1W3S A;  2SGD I;  3VDP A;  1R79 A;  1FAR A;  5DAE A;  2P6A C;  2JW6 A;  2NU0 I;  1CHO I;  1CT2 I;  1TBN A;  1X74 A;  2QPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...