1DS2I

Crystal structure of sgpb:omtky3-coo-leu18i
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
50
Chain Sequence
VDCSEYPKPACTEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEINASE B (SGPB)
publication title Contribution of peptide bonds to inhibitor-protease binding: crystal structures of the turkey ovomucoid third domain backbone variants OMTKY3-Pro18I and OMTKY3-psi[COO]-Leu18I in complex with Streptomyces griseus proteinase B (SGPB) and the structure of the free inhibitor, OMTKY-3-psi[CH2NH2+]-Asp19I
pubmed doi rcsb
source organism Meleagris gallopavo
total genus 13
structure length 50
sequence length 51
ec nomenclature
pdb deposition date 2000-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1ds2I00
1CT2I 1IY5A 3SGQI 1SGRI 1CSOI 3SGBI 4SGBI 1CT0I 1PPFI 1SGPI 2KMOA 1R0RI 2P6AC 1N13A 2KMPA 2N17A 1HDLA 2SGDI 1TGSI 1Y1CA 1DS2I 1SGQI 4HGUA 1DS3I 1LR7A 2GKTI 1TBRR 1KMAA 2M5XA 1LR8A 1TUSA 1UVFA 1SGDI 3QTLD 5JHWC 1FYBA 1SGEI 2SGFI 1IY6A 2NU3I 1UUCA 2V53A 2OVOA 1OMTA 2KMQA 2NU0I 1OYVI 1TIHA 2NU4I 2JZMA 1CGJI 1AN1I 2QQCA 1TBQR 3OVOA 2SGQI 1NUBA 1Y1BA 2LEOA 2SGPI 2JXDA 1CGII 1SGNI 1CT4I 1TURA 1LR9A 1SGYI 3B4VC 2KMRA 2XRCA 1Z7KB 1HJAI 4OVOA 1HPTA 1BUSA 5DAEA 2GKVA 2B0UC 1UVGA 1BMOA 1PCEA 1M8BA 1CHOI 1IW4A 2BUSA 2ERWA 1OMUA 1H0ZA 2NU1I 2SGEI 2NU2I 3SEKC 1CE3A 4GI3C 3TJQA 2WCYA 1MT1A 1M8CA 1YU6C 1OVOA 2JYYA 2QQDA 3HH2C 2GKRI 2N52A 2ARPF 2N71A 2F3CI 1YTPA 2KCXA 1PJUA
chains in the Genus database with same CATH superfamily
1TOTA 3FSYA 3D00A 4UXJA 3OL0A 1CT2I 2V1CA 2PQ8A 5FUWA 3SGQI 1IY5A 1K7UA 1SGRI 1Z2IA 1W4RA 1CSOI 4UXHA 3QWPA 2CWFA 2DKVA 3TO9A 2RIJA 1ULKA 3SGBI 4SGBI 3KY9A 1CT0I 1KBEA 1PPFI 1SGPI 2KMOA 2L8EA 1R0RI 2P6AC 1S20A 2W0TA 3R5DA 5E3RA 5CCLA 1N13A 1FAQA 5EX0A 2KMPA 2WVJA 2V1CC 3R5AA 4JCVE 5FUXA 3TO6A 2N17A 1HDLA 3VDUA 3TOBA 2SGDI 1TGSI 1Y1CA 1DS2I 1FARA 1PTRA 1V1IA 2RC4A 1SGQI 3R5BA 1PTQA 3E59A 4HGUA 3CXLA 4E1RA 5CCMA 1UHAA 2YQPA 1DS3I 1LR7A 1VDDA 2ENZA 3OXLA 5J8FA 2GKTI 1TBRR 2WGCA 4AMLA 2GIVA 2J87A 2M5XA 2ORVA 1KMAA 1LR8A 1TUSA 1UVFA 1SGDI 3QTLD 4A24A 1TBNA 5JHWC 1FYBA 3UEJA 2UVOA 2CJSC 3GOXA 1SGEI 2SGFI 2A20A 9WGAA 1WGCA 2J9RA 2N1AB 2NU3I 1RFHA 4E1PA 1IY6A 1UUCA 2V53A 2OVOA 2E73A 2QQ0A 2Y0MA 2E5RA 1OMTA 3R5CA 2KMQA 1OYVI 1TIHA 2NU0I 1V1HA 2OD1A 5FUVA 4DNCA 2B8TA 2NU4I 1MJ9A 2JZMA 1CGJI 5E3QA 3TO7A 3VE5A 1AN1I 4FKDA 2QQCA 3UGLA 1TBQR 3OVOA 5HI7A 4L9MA 1ULMA 2SGQI 1P9GA 1NUBA 1Y1BA 2LEOA 2ODDA 2SGPI 2JA1A 2JXDA 2FNFX 1CGII 1X4SA 1SGNI 3FSXA 1CT4I 2CWGA 1TURA 1Y8FA 1LR9A 7WGAA 1SGYI 1XBTA 3B4VC 2KMRA 1WGTA 2YUUA 2XRCA 1Z7KB 1HJAI 1WKXA 4OVOA 3UOEA 1HPTA 1BUSA 1Q9BA 1MJAA 1HEVA 2ELIA 3PDNA 2ENNA 2QPOA 4MPIA 1K7TA 2GKVA 5DAEA 3RU0A 3UEYA 2B0UC 2LB7A 1U5KA 1UVGA 1BMOA 1PCEA 1M8BA 2CWHA 1CHOI 3QAHA 2BUSA 3OXFA 2UZ3A 4WP4A 3TOAA 4B6DA 1IW4A 4UXIA 2DB6A 5HQ8A 3FC3A 1K7VA 2ERWA 2GVIA 1OMUA 2ROWA 1R79A 2QQEA 2X52A 1H0ZA 1TBOA 1KBFA 1XA6A 2NU1I 5FUYA 1P9ZA 5EX3A 2SGEI 2NU2I 3SEKC 1ULNA 3MEKA 1WTJA 1CE3A 4GI3C 2OZUA 3E2IA 1W3SA 1XX6A 3TJQA 2WCYA 2L7XA 1MT1A 3UGIA 1M8CA 1YU6C 1OVOA 3VDPA 1FY7A 5E3PA 2JYYA 2QQDA 3HH2C 2GKRI 3OXGA 2OU2A 1MJBA 2N52A 2ORWA 2LUYA 2K9HA 2ARPF 2X3TA 2VRWB 2N71A 2F3CI 3UFFA 1YTPA 2KCXA 1PJUA 2DIPA 5J8CA 1X74A 2JW6A 3BJIA 3UGDA 1NXUA
chains in the Genus database with same CATH topology
1TOTA 3D00A 4UXJA 3OL0A 1CT2I 2V1CA 5FUWA 3SGQI 1IY5A 1SGRI 1W4RA 1CSOI 4UXHA 3QWPA 3SGBI 4SGBI 3KY9A 1CT0I 1KBEA 1PPFI 1SGPI 2KMOA 2L8EA 1R0RI 2P6AC 2W0TA 5CCLA 1N13A 1FAQA 5EX0A 2KMPA 2WVJA 2V1CC 4JCVE 5FUXA 2N17A 1HDLA 3VDUA 2SGDI 1TGSI 1Y1CA 1DS2I 1FARA 1PTRA 1V1IA 1SGQI 1PTQA 3E59A 4HGUA 3CXLA 4E1RA 5CCMA 2YQPA 1DS3I 1LR7A 1VDDA 2ENZA 3OXLA 2GKTI 1TBRR 1KMAA 2J87A 2M5XA 2ORVA 1LR8A 1TUSA 1UVFA 1SGDI 3QTLD 4A24A 1TBNA 5JHWC 1FYBA 3GOXA 2CJSC 1SGEI 2SGFI 2A20A 1IY6A 2J9RA 2N1AB 2NU3I 4E1PA 1RFHA 1UUCA 2V53A 2OVOA 2E73A 2QQ0A 2E5RA 1OMTA 2KMQA 1OYVI 1TIHA 2NU0I 1V1HA 2OD1A 5FUVA 2B8TA 2NU4I 2JZMA 1CGJI 3VE5A 1AN1I 4FKDA 2QQCA 3UGLA 1TBQR 3OVOA 5HI7A 4L9MA 2SGQI 1NUBA 1Y1BA 2LEOA 2ODDA 2SGPI 2JA1A 2JXDA 2FNFX 1CGII 1X4SA 1SGNI 1CT4I 1TURA 1Y8FA 1LR9A 1SGYI 1XBTA 3B4VC 2KMRA 2YUUA 2XRCA 1Z7KB 1HJAI 4OVOA 1HPTA 1BUSA 2ELIA 3PDNA 2ENNA 2QPOA 5DAEA 2GKVA 3RU0A 3UEYA 2B0UC 1U5KA 1UVGA 1BMOA 1PCEA 1M8BA 3UEJA 1CHOI 1IW4A 2BUSA 3OXFA 2UZ3A 4B6DA 4UXIA 2DB6A 5HQ8A 3FC3A 2ERWA 2GVIA 1OMUA 2ROWA 1R79A 2QQEA 1H0ZA 1TBOA 1KBFA 1XA6A 2NU1I 5FUYA 5EX3A 2SGEI 2NU2I 3SEKC 3MEKA 1CE3A 4GI3C 3E2IA 1W3SA 1XX6A 3TJQA 2WCYA 2L7XA 1MT1A 3UGIA 1M8CA 1YU6C 1OVOA 3VDPA 2JYYA 2QQDA 3HH2C 2GKRI 3OXGA 2N52A 2ORWA 2LUYA 2K9HA 2ARPF 2VRWB 2N71A 2F3CI 3UFFA 1YTPA 2KCXA 1PJUA 2DIPA 1X74A 2JW6A 3BJIA 3UGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CT2 I;  1IY5 A;  3SGQ I;  1SGR I;  1CSO I;  3SGB I;  4SGB I;  1CT0 I;  1PPF I;  1SGP I;  2KMO A;  1R0R I;  2P6A C;  1N13 A;  2KMP A;  2N17 A;  1HDL A;  2SGD I;  1TGS I;  1Y1C A;  1DS2 I;  1SGQ I;  4HGU A;  1DS3 I;  1LR7 A;  2GKT I;  1TBR R;  1KMA A;  2M5X A;  1LR8 A;  1TUS A;  1UVF A;  1SGD I;  3QTL D;  5JHW C;  1FYB A;  1SGE I;  2SGF I;  1IY6 A;  2NU3 I;  1UUC A;  2V53 A;  2OVO A;  1OMT A;  2KMQ A;  2NU0 I;  1OYV I;  1TIH A;  2NU4 I;  2JZM A;  1CGJ I;  1AN1 I;  2QQC A;  1TBQ R;  3OVO A;  2SGQ I;  1NUB A;  1Y1B A;  2LEO A;  2SGP I;  2JXD A;  1CGI I;  1SGN I;  1CT4 I;  1TUR A;  1LR9 A;  1SGY I;  3B4V C;  2KMR A;  2XRC A;  1Z7K B;  1HJA I;  4OVO A;  1HPT A;  1BUS A;  5DAE A;  2GKV A;  2B0U C;  1UVG A;  1BMO A;  1PCE A;  1M8B A;  1CHO I;  1IW4 A;  2BUS A;  2ERW A;  1OMU A;  1H0Z A;  2NU1 I;  2SGE I;  2NU2 I;  3SEK C;  1CE3 A;  4GI3 C;  3TJQ A;  2WCY A;  1MT1 A;  1M8C A;  1YU6 C;  1OVO A;  2JYY A;  2QQD A;  3HH2 C;  2GKR I;  2N52 A;  2ARP F;  2N71 A;  2F3C I;  1YTP A;  2KCX A;  1PJU A; 
#chains in the Genus database with same CATH topology
 1TOT A;  3FSY A;  3D00 A;  4UXJ A;  3OL0 A;  1CT2 I;  2V1C A;  2PQ8 A;  5FUW A;  3SGQ I;  1IY5 A;  1K7U A;  1SGR I;  1Z2I A;  1W4R A;  1CSO I;  4UXH A;  3QWP A;  2CWF A;  2DKV A;  3TO9 A;  2RIJ A;  1ULK A;  3SGB I;  4SGB I;  3KY9 A;  1CT0 I;  1KBE A;  1PPF I;  1SGP I;  2KMO A;  2L8E A;  1R0R I;  2P6A C;  1S20 A;  2W0T A;  3R5D A;  5E3R A;  5CCL A;  1N13 A;  1FAQ A;  5EX0 A;  2KMP A;  2WVJ A;  2V1C C;  3R5A A;  4JCV E;  5FUX A;  3TO6 A;  2N17 A;  1HDL A;  3VDU A;  3TOB A;  2SGD I;  1TGS I;  1Y1C A;  1DS2 I;  1FAR A;  1PTR A;  1V1I A;  2RC4 A;  1SGQ I;  3R5B A;  1PTQ A;  3E59 A;  4HGU A;  3CXL A;  4E1R A;  5CCM A;  1UHA A;  2YQP A;  1DS3 I;  1LR7 A;  1VDD A;  2ENZ A;  3OXL A;  5J8F A;  2GKT I;  1TBR R;  2WGC A;  4AML A;  2GIV A;  2J87 A;  2M5X A;  2ORV A;  1KMA A;  1LR8 A;  1TUS A;  1UVF A;  1SGD I;  3QTL D;  4A24 A;  1TBN A;  5JHW C;  1FYB A;  3UEJ A;  2UVO A;  2CJS C;  3GOX A;  1SGE I;  2SGF I;  2A20 A;  9WGA A;  1WGC A;  2J9R A;  2N1A B;  2NU3 I;  1RFH A;  4E1P A;  1IY6 A;  1UUC A;  2V53 A;  2OVO A;  2E73 A;  2QQ0 A;  2Y0M A;  2E5R A;  1OMT A;  3R5C A;  2KMQ A;  1OYV I;  1TIH A;  2NU0 I;  1V1H A;  2OD1 A;  5FUV A;  4DNC A;  2B8T A;  2NU4 I;  1MJ9 A;  2JZM A;  1CGJ I;  5E3Q A;  3TO7 A;  3VE5 A;  1AN1 I;  4FKD A;  2QQC A;  3UGL A;  1TBQ R;  3OVO A;  5HI7 A;  4L9M A;  1ULM A;  2SGQ I;  1P9G A;  1NUB A;  1Y1B A;  2LEO A;  2ODD A;  2SGP I;  2JA1 A;  2JXD A;  2FNF X;  1CGI I;  1X4S A;  1SGN I;  3FSX A;  1CT4 I;  2CWG A;  1TUR A;  1Y8F A;  1LR9 A;  7WGA A;  1SGY I;  1XBT A;  3B4V C;  2KMR A;  1WGT A;  2YUU A;  2XRC A;  1Z7K B;  1HJA I;  1WKX A;  4OVO A;  3UOE A;  1HPT A;  1BUS A;  1Q9B A;  1MJA A;  1HEV A;  2ELI A;  3PDN A;  2ENN A;  2QPO A;  4MPI A;  1K7T A;  2GKV A;  5DAE A;  3RU0 A;  3UEY A;  2B0U C;  2LB7 A;  1U5K A;  1UVG A;  1BMO A;  1PCE A;  1M8B A;  2CWH A;  1CHO I;  3QAH A;  2BUS A;  3OXF A;  2UZ3 A;  4WP4 A;  3TOA A;  4B6D A;  1IW4 A;  4UXI A;  2DB6 A;  5HQ8 A;  3FC3 A;  1K7V A;  2ERW A;  2GVI A;  1OMU A;  2ROW A;  1R79 A;  2QQE A;  2X52 A;  1H0Z A;  1TBO A;  1KBF A;  1XA6 A;  2NU1 I;  5FUY A;  1P9Z A;  5EX3 A;  2SGE I;  2NU2 I;  3SEK C;  1ULN A;  3MEK A;  1WTJ A;  1CE3 A;  4GI3 C;  2OZU A;  3E2I A;  1W3S A;  1XX6 A;  3TJQ A;  2WCY A;  2L7X A;  1MT1 A;  3UGI A;  1M8C A;  1YU6 C;  1OVO A;  3VDP A;  1FY7 A;  5E3P A;  2JYY A;  2QQD A;  3HH2 C;  2GKR I;  3OXG A;  2OU2 A;  1MJB A;  2N52 A;  2ORW A;  2LUY A;  2K9H A;  2ARP F;  2X3T A;  2VRW B;  2N71 A;  2F3C I;  3UFF A;  1YTP A;  2KCX A;  1PJU A;  2DIP A;  5J8C A;  1X74 A;  2JW6 A;  3BJI A;  3UGD A;  1NXU A; 
#chains in the Genus database with same CATH homology
 1TOT A;  3D00 A;  4UXJ A;  3OL0 A;  1CT2 I;  2V1C A;  5FUW A;  3SGQ I;  1IY5 A;  1SGR I;  1W4R A;  1CSO I;  4UXH A;  3QWP A;  3SGB I;  4SGB I;  3KY9 A;  1CT0 I;  1KBE A;  1PPF I;  1SGP I;  2KMO A;  2L8E A;  1R0R I;  2P6A C;  2W0T A;  5CCL A;  1N13 A;  1FAQ A;  5EX0 A;  2KMP A;  2WVJ A;  2V1C C;  4JCV E;  5FUX A;  2N17 A;  1HDL A;  3VDU A;  2SGD I;  1TGS I;  1Y1C A;  1DS2 I;  1FAR A;  1PTR A;  1V1I A;  1SGQ I;  1PTQ A;  3E59 A;  4HGU A;  3CXL A;  4E1R A;  5CCM A;  2YQP A;  1DS3 I;  1LR7 A;  1VDD A;  2ENZ A;  3OXL A;  2GKT I;  1TBR R;  1KMA A;  2J87 A;  2M5X A;  2ORV A;  1LR8 A;  1TUS A;  1UVF A;  1SGD I;  3QTL D;  4A24 A;  1TBN A;  5JHW C;  1FYB A;  3GOX A;  2CJS C;  1SGE I;  2SGF I;  2A20 A;  1IY6 A;  2J9R A;  2N1A B;  2NU3 I;  4E1P A;  1RFH A;  1UUC A;  2V53 A;  2OVO A;  2E73 A;  2QQ0 A;  2E5R A;  1OMT A;  2KMQ A;  1OYV I;  1TIH A;  2NU0 I;  1V1H A;  2OD1 A;  5FUV A;  2B8T A;  2NU4 I;  2JZM A;  1CGJ I;  3VE5 A;  1AN1 I;  4FKD A;  2QQC A;  3UGL A;  1TBQ R;  3OVO A;  5HI7 A;  4L9M A;  2SGQ I;  1NUB A;  1Y1B A;  2LEO A;  2ODD A;  2SGP I;  2JA1 A;  2JXD A;  2FNF X;  1CGI I;  1X4S A;  1SGN I;  1CT4 I;  1TUR A;  1Y8F A;  1LR9 A;  1SGY I;  1XBT A;  3B4V C;  2KMR A;  2YUU A;  2XRC A;  1Z7K B;  1HJA I;  4OVO A;  1HPT A;  1BUS A;  2ELI A;  3PDN A;  2ENN A;  2QPO A;  5DAE A;  2GKV A;  3RU0 A;  3UEY A;  2B0U C;  1U5K A;  1UVG A;  1BMO A;  1PCE A;  1M8B A;  3UEJ A;  1CHO I;  1IW4 A;  2BUS A;  3OXF A;  2UZ3 A;  4B6D A;  4UXI A;  2DB6 A;  5HQ8 A;  3FC3 A;  2ERW A;  2GVI A;  1OMU A;  2ROW A;  1R79 A;  2QQE A;  1H0Z A;  1TBO A;  1KBF A;  1XA6 A;  2NU1 I;  5FUY A;  5EX3 A;  2SGE I;  2NU2 I;  3SEK C;  3MEK A;  1CE3 A;  4GI3 C;  3E2I A;  1W3S A;  1XX6 A;  3TJQ A;  2WCY A;  2L7X A;  1MT1 A;  3UGI A;  1M8C A;  1YU6 C;  1OVO A;  3VDP A;  2JYY A;  2QQD A;  3HH2 C;  2GKR I;  3OXG A;  2N52 A;  2ORW A;  2LUY A;  2K9H A;  2ARP F;  2VRW B;  2N71 A;  2F3C I;  3UFF A;  1YTP A;  2KCX A;  1PJU A;  2DIP A;  1X74 A;  2JW6 A;  3BJI A;  3UGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...