5FUYA

Catalytic domain of thymidine kinase from trypanosoma brucei with dtmp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
181
structure length
165
Chain Sequence
HGRIELIIGPMFAGKTTELMRRVQRHKHAQRSCYIIKYTALTANVSVSNLHDVGDEWRKYDVIAVDEGQFFPDVAAFCSKAADSGKVVIVSALDADYLQEPFEEICLLVSRADSVVKLSAVCMECHNRKASFTYRTVKSDERKLVGGSDMYMSVCRSCYETKRNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords THYMDINE KINASE
publication title Cell Cycle Regulation and Novel Structural Features of Thymidine Kinase, an Essential Enzyme in Trypanosoma Brucei.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 52
structure length 165
sequence length 181
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2016-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 5fuyA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fuyA01
3AVUA 4Y0AA 4M1OA 2C8VA 3CNOA 2WHXA 4MYTA 3GLFE 1Z63A 1J7KA 2WWWA 2GKSA 1W1WA 3D6TB 4WXRA 1VCOA 4KBGA 2GK7A 3K70D 5KPDA 5JWOA 1ETUA 1A4RA 2RGAA 4LHVA 2QAGB 4C0HA 1OFUX 2YUUA 3HWSA 2PZEA 5FPHA 4JSYA 3P27A 1G291 1HA3A 2FZLA 3I32A 1R10A 1W0JA 2ZRHA 1E2KA 4K81B 1WMSA 2CVHA 4HAXA 2AXNA 3WP1B 4C0JA 2EYUA 4F7WA 4ON9A 1TF7A 1G3MA 2BMDA 1GAJA 4E09A 4DZZA 1GILA 2H92A 2F3RA 4DVGA 3NVAA 1Z2CA 2RAPA 2W00A 4Q4JA 2RH5A 3OESA 1XXHE 4JLMA 4PC7A 5AJWA 4JVMA 1OHHD 1HY3A 1LVGA 4URXR 3DO6A 4GMDA 3UEJA 1C9KA 2FE4A 4XTRA 3Q85A 2H5EA 3DM9B 4NYMQ 1D5CA 3TH5A 5CK5A 4XH9B 4DKXA 5DYIA 2ORWA 2C98A 4GZLA 4PZYA 4GOXA 3AUYA 4TYNA 2GTPA 5DHFA 2D06A 4L4UA 3VHXA 3ECCA 2QAGC 2ZJAA 5E95A 3TNFA 2IYQA 2ZROA 1CJVC 5CLQA 3RDPA 3FYHA 3AVWA 4Q7MB 2XZOA 1IQPA 3P4XA 1UBEA 1DAFA 1LW7A 4DSUA 2F1RA 2EWWA 1AQUA 4FMDF 2XB2A 1SGWA 3FTQA 2WJVA 4NH0A 2BHRA 1HEIA 2ZUCA 3U3MA 3SQXA 1BYIA 5LB4A 5HKKA 2IS4A 1JAIA 2QSZA 4Q9IA 1DVRA 2YNMA 3AGPA 1IJEA 2H57A 2V55B 1SQ5A 1EFRA 3SBEA 2D2FA 2V3CC 2QBYA 4CZ2A 1T3HA 1P73A 2CEAA 1Q1QA 4K46A 3R9XA 1EFUA 2WOJA 4IXNA 5P21A 4Z8XA 2CCJA 4LYFA 1Z29A 1ZUIA 2NTYC 3D3QA 3KDSE 2HDNB 1DAKA 1UAAA 4G5OA 2P2LA 1E0JA 4TSFD 3JVVA 1P3JA 5KOYA 3CLVA 4NBSA 3UATA 2CCGA 2FPMA 3AQ4A 3LX5A 3UFFA 3TK1A 3VAAA 4PHFA 4U00A 5JWRA 3R7WA 2IA5A 2IYXA 4I1SA 2QU8A 5H68A 3NWJA 4OK6A 3Q5DA 5EP1A 3PEWA 5BXQC 4OI2A 4Q47A 1EFHA 1DAGA 1I4TD 1G8PA 5CM9C 1G8HA 4FI3C 3ZVLA 1NL3A 2RGCA 3HU2A 1S1CA 4IEIA 1J70A 1U98A 1XF9A 2WJGA 2WOOA 4IRUB 1KKLA 4GZMA 4LJYA 1IHUA 1U8YA 2GJKA 3VMFA 3SDZA 2Z5FA 3CH5A 3W34A 1DG1G 5FUXA 4TYYA 5FUYA 2DY1A 2ZUBA 4AURA 1IXRC 2DBYA 4GFDA 1NNEA 5FTKA 3I62A 2BBOA 2GVZC 4ZCLA 4QL3A 1KO4A 2JLYA 1WQ1R 1Q0UA 4HAUA 1ZP6A 2OG2A 4WIAA 2G6BA 2WWIA 1TBOA 3IO5A 3OHMA 1U0LA 3QVVA 4KI0A 4CYMA 4EIWA 4C0SA 4DC9A 5KYKA 2DWOA 2J5XA 3P26A 1XX6A 1ZCAA 4QBGB 2GK6A 1DAEA 1FUKA 2YOFA 3AF4A 2RGNA 1PLKA 1JB1A 3GD7A 4YMTA 3MUFA 3CRW1 3EARA 3ZJYA 2XOKA 1TMKA 3AVOA 3PENA 3KQLA 5BQ5A 2JIZD 2BMJA 4LHXA 2CCKA 2G83A 3UGLA 1E2LA 2AN9A 2FPLA 2BWJA 3B78A 2EFEB 2O0HA 2QORA 1XBTA 1OXXK 3OEEA 2G77B 3B1VA 1NVWQ 3MSXA 4KV9A 1VCMA 1GL9B 4RZUA 4BGDA 2FOLA 2VTKA 1ZBDA 2ZRAA 2ZJZA 4PC3A 3VR1A 4DJTA 4AKEA 4GP7A 4V03A 3HYRA 4V02A 1DAMA 2F9MA 2KBFA 4BECA 1MKYA 4MITA 4PXAA 5CK4A 4ILEA 4CGZA 2DFLA 1SULA 4M21A 2IYUA 3BD9A 3GJ6A 1W36B 1NLYA 2IUTA 3REGA 4AG5A 3QI2A 3UMSA 4ZV4A 1XZQA 4HYYA 4P0TA 3ZDQA 4QM6A 1K5GA 1VYUA 4NMMA 1UF9A 1XNJA 1AM4D 2ZSDA 2RGNC 4OL0A 5E7JA 2CHVA 4RZ3A 1R6BX 2BVNA 4RD6A 4B3DA 4B35A 5FI0B 4DBLC 3FVQA 4IDHA 3I4LA 3BBPA 3EPKA 4BE7B 2IT1A 2Z4RA 1G41A 2C96A 3HPQA 3HU1A 1M34E 3K8YA 3L2OB 4PANA 5CLLA 5G40A 2ZRLA 2ZS9A 4NCNA 1T8UA 2QAJA 4YMVA 4L9WA 2OEPA 2JJ8A 2QG6A 2LCFA 3SFVA 2HYIC 1TADA 1E2GA 2BIFA 2PLRA 4JLVA 4PC6A 2XJ4A 4BASA 1XZPA 1ZUHA 1S96A 2OCAA 3C41J 3NEYA 3EA5A 3L8ZA 4MGYR 2ZYWX 2FWRA 3Q9LA 2ZRKA 4LX0A 5JS8A 2FNAA 5HKKD 3MWKA 2HJGA 3CR8A 2ODWA 2O8FA 1ZINA 4MGKR 4TN1A 3W9YA 1KTVA 1MH1A 2WZQA 5JRZA 2PLFA 4AG6A 3NBYC 2YJTD 1YHNA 2ZI6A 3GJ8A 4X8OA 5J5CA 3T06B 2ANCA 4XD7A 4DDVA 4JBYA 1NJGA 1US8A 1ZC3A 3AM1A 2YINC 1HQYE 4A0GA 1DAHA 1MRNA 2BDTA 2J46A 4MUBA 3DKPA 5EE3A 1US8B 4RZ2A 4PFSA 4JLBA 4BLSA 3X2SA 2DFTA 1L8QA 3EW9A 1IN5A 2AWOA 1P2TA 1G4AE 2OBLA 2QRNA 1VCNA 3B1XA 4QGGA 2ZREA 3QKTA 2ZE6A 2W58A 2HT1A 1E2EA 1RPZA 4N3NA 5LBIA 1E1QA 2GCPA 4OYHA 4C2UA 3T35A 5IT5A 4QXAA 1NJFA 1YR8A 1P62B 2IEZA 1ZM3A 1XTJA 2DHRA 2IYWA 3K0FA 4D4LA 4YMSA 3LLMA 2W2VA 3RS5A 5B58C 5J4HA 3BFXA 2FSHA 4TMVA 3C16C 2FGKA 2OXRA 3K0FB 3MRSA 1KK2A 3WNCA 3U7GA 2J59A 4A15A 1GKUB 4C30A 3WMEA 2BMEA 1P9NA 4MQBA 2Z6VA 3QJYA 2R44A 2ONJA 4BQSA 4DDTA 1JECA 2GJ8A 2AX4A 5DE3A 3LNCA 2BEJA 1A7JA 4Q4AA 3WHLA 3THWB 4LY6A 1JR6A 1KMHB 1G6HA 2C78A 4URZR 2I1QA 4A2WA 4Q4AB 5BWMA 1VPLA 5CIWA 1M7HA 5GJCA 3TVTA 1RC8A 3SJBA 2F1IA 1QHXA 1CKEA 1ZNYA 4P3YA 2GCOA 4TWZA 4Q00A 4V0ME 5KU1A 1X8KA 4PSKA 3W8NA 2GXUA 2EQBA 1F2UB 1LNZA 1OYWA 2GCOB 2YZ2A 1J2JA 3ASZA 2FNFX 1X3SA 3A1UA 3WMGA 4G5QA 1E2NA 2A78A 2ZR9A 5GJBA 3KJHA 5AUOB 4DXAA 5AUPB 4HUTA 2QP4A 4B6DA 3LRPA 4OJQA 5UKDA 2W2TA 5FI1B 1XDBA 3OIYA 1G8YA 4DCTA 4HDOB 1IY1A 4PX9A 3E2IA 3VTKA 5FOUA 2ZS7A 1GKYA 3JZMA 1KAOA 3C15C 4MUAA 1NN3A 4PZLA 3BH7A 2J0UB 5C4MA 1QHIA 3BC1A 2CL7X 1E98A 3KXIA 2EFGA 1W36D 2D7CA 1W2GA 3A58B 2QQ0A 4OI1A 1CXZA 2ERXA 3KL4A 4P4TA 1HH4A 2J87A 4N1AA 1UKYA 3A4NA 3U7HB 3QVUA 1ZNXA 3M0EA 4G0NA 3SE0A 4RY2A 1KO8A 4A4DA 2J0SA 2QT1A 3CO5A 4LJ5A 2GEUA 1J99A 2IUUA 1VHTA 4EFNA 4OI4A 4IOKA 1ZNWA 1G18A 1H65A 2GXQA 2XNDA 4BEBA 1GP2A 1N5JA 3EXAA 4TT3A 2I1VB 2JLQA 1VG0B 4AYWA 2QE7D 2K5UA 3U4QA 5KO2A 3ICQB 3OIUA 5DGXA 4MRNA 1E79D 2XTNA 5F2EA 4LWZA 2OHFA 2ZU6A 3BH0A 3TVDA 1OXVA 4BFSA 3U4QB 3I8XA 3CF6R 3MGCA 4ACAA 3TSWA 3R8CA 1D9ZA 3NKVA 1YVDA 4PZZA 1QVAA 5CYOA 1BS1A 5AJYA 3H0KA 1RE0A 3KQKA 3TE6A 3LWNA 3EZ7A 1Q12A 5JI3E 1P2SA 2WWFA 4FCTA 3KUDA 4KVAA 3B82A 2FSFA 4ACBA 2G9NA 4PPGA 4TMKA 1IXSB 4RFVA 4EPWA 2QM8A 1MRSA 4URVR 2RGEA 1E0AA 3UPUA 4I1OA 4NYJQ 1AS0A 4U5XA 1NIPA 2CL0X 3VR4A 3W8RA 1AJEA 1SVLA 3C7KA 5FTMA 3VKGA 4M1YA 3NH6A 5AUQA 1Q3HA 5FBLB 4BFVA 1N6NA 4HB0A 4QGFA 4FMCB 2GAAA 3U5ZB 2CDNA 4UKDA 1AS3A 4XD7D 5H70A 1E2JA 4D81A 1XTSA 2YV5A 4ZCMA 4ERNA 1T8TA 2V4ZA 4C7OA 5KNDA 2J0QA 1KIMA 2PEZA 1YR6A 2J45A 5SZKB 1M2OB 3QBTA 2ZRMA 4OHVA 4W7SA 4C7OB 3N5CA 3I73A 2WWHA 4ARZA 3CX8A 4GOKA 5FOTA 4DSTA 3KUCA 3CM0A 1JPJA 4US0R 4HAYA 2NO1A 2HCJB 1HT1E 1NSTA 3K1JA 2IHBA 3TSZA 3VKWA 4BFXA 3CW2A 3X1ZA 4ARZB 2C77A 2J41A 1KSFX 1E9RA 3VNVA 1U8AA 3E1SA 1Z0KA 2FG5A 3K0SA 1OHHA 3I1FA 2FEMA 4D2IA 1PTQA 1C1YA 1V5WA 1XJCA 4V0LA 1XTQA 4YC7A 4AKHA 1OLOA 4CW7A 4TQ9A 3EIHA 2BCGY 4ZCIA 1KI2A 1TBNA 2IUSA 4GPTA 2QZ4A 4LDJA 2VHCA 4AK9A 1XB2A 2EU8A 1GUAA 3NXSA 4LBWA 3RRMA 2DYKA 4GMXA 4M53A 2FSIA 1KDOA 1NLFA 3EIQA 3TQFA 2CJWB 5G53C 2XAUA 4A9AA 3B9QA 1G20E 2HUPA 2A5GA 4DRZA 2ZUDA 5EP2A 1G3RA 4IDOA 2QSYA 2ZXUA 4PPNA 1K8RA 4ZKEA 1Q22A 1E69A 1U90A 2CHGA 3U7EB 3U3KA 2VHJA 3C8UA 1N6PA 3I3SR 3SHFA 2VF7A 1GL7A 4IEEA 3UEYA 1B23P 2OLKA 5FL3A 3GJ7A 4FWIB 2OE2A 4NP6A 1LF0A 1NKSA 4XOIA 3QOFA 1JALA 3NC1C 1T4GA 3FMIA 1RJ9A 2V6JA 2VHUA 2XTZA 1SVWA 4OJKA 1NN0A 5J4KA 1WB9A 2BOVA 4MYUA 1JJVA 4G5RA 3TUIC 2R6AA 4B2PA 4PC2A 2ZYUX 1RJ9B 1KYIA 3AVVA 4FCVA 4LJ6A 2A9KA 4PPQA 2WAXA 4TLCA 1RRFA 2C04A 2B7BA 2RKOA 3DL0A 1E2DA 4FMCF 2Q6TA 4TSFA 5J4VA 3U60B 2O52A 1UEIA 2P6RA 4DLRA 4PR0A 1M6NA 2QL6A 1LB1B 3F5FA 2ORIA 4A8JA 3UG6A 1XMVA 3EASA 1N25A 1G7RA 3FPAA 2FDCA 4E5UA 4YMUA 2P5TB 1OKKA 4A8JB 5M04A 2AKAB 2XXAA 4DHEA 3AVYA 4JIMA 2EYQA 3HJNA 1R5NA 5JHGB 4I4LA 1KBFA 2OBNA 5JWHA 1YZLA 1QG2A 4ZIRA 1IJFA 4TLDA 4TZ0A 1CR4A 1FMJA 3A1TA 1GDDA 2BJWA 4IDQA 4ZIRB 2HJVA 3GEEA 4KU4A 1WP9A 2QA5A 1ZIPA 3GJ3A 1E2FA 2VP5A 3KJGA 4AKIA 1AZTA 1P2UA 2N42A 3DMDA 3GEHA 5FOSA 3V00A 4A6XA 4IJMA 2GZDA 1YZTA 2XNDD 4FMBB 3RRZA 3IHLA 3SEAA 3KQHA 1NVVQ 1QBKC 4TT3D 1EX7A 4MKIA 3UMFA 3QPWA 3OIVA 4JJKA 3CRMA 3SYLA 2KE5A 3PUVA 4AI6A 1HTWA 1NMXA 1QHHA 2QP9X 1RFHA 4TMZA 2WWXA 4C0BA 5DHAA 4LYAA 5HPYB 2NPIA 4FIDA 5ELXA 3A1WA 2ZETA 1TEXA 3W6PA 2D7DA 1KK1A 3VR6A 3CPJB 1S3SA 4R2IA 1VIYA 1XPUA 1Y8FA 2V7QD 2ZSBA 4A8JC 3CR7A 2B8TA 1QVRA 2NPFA 2X2EA 1CU1A 2J0VA 4DWJA 3GCGA 4L5BA 4OKSA 4C0QC 2OZEA 2JIZA 3KXLA 3LXRA 4O2LA 1S2MA 1WA5A 4AIIA 3DPUA 1B0UA 2YHSA 1X1RA 5G41A 3RWOA 4Q48A 1KY2A 2IYZA 4M4SA 2WV9A 2QAGA 3KQNA 1ZYUA 3VU9B 2IBMA 2ZAOA 3KKOA 3LH5A 4EPRA 3B1ZA 1E9BA 2OESA 1TQ2A 3IHWA 3S1AA 4BPBA 4LPSA 3EPHA 1DO0A 5JJKA 1G64A 2GNOA 2C5LA 3S1AB 5C4GB 1GITA 1Q3TA 4GT1A 1PV4A 4Z8YA 2BV3A 2REBA 1KJZA 2ZU0C 4DLVA 4XWAA 3KZ1E 3WXMA 1FW6A 3AKCA 4RKFA 3AVPA 2Z43A 2PH1A 1FMLA 4IVRA 3UXMA 4DT1A 3U6BA 2C95A 5L3VA 4QJ4A 2BBSA 4DDWA 4PHTA 3U3JA 4DT1B 3B13B 2OSBA 2MMCA 4JVLA 2FV8A 1E96A 4CIDA 3K0AB 4JMPA 4Q01A 1NY5A 5KTYA 1ZIOA 2PBRA 1ZRHA 3KFXA 3QUSA 3I61A 2XB4A 4S2EA 3EZ6A 1OH8A 2GRJA 5CJ2A 2PMDA 1FTNA 2A5YB 4JS0A 4V0MA 1AN0A 2CNWD 1EGAA 2EFCB 1CR0A 1DE0A 1QHYA 2KSQA 3WNDA 3A4MA 1O3YA 2QMEA 4IDNA 1OH5A 1GRNA 2ZRCA 4Q9HA 5KUTA 3JZAA 1GFIA 2IX3A 2ZJ5A 5TXGA 4G1UC 3X1DA 2AXPA 2QN6A 2AWNA 3BK7A 4PO9A 5AWFC 2WMNB 3L43A 5CDFA 4NCKA 1YKSA 3BH6A 1JXMA 3D7MA 1KI3A 1VYTA 1GIAA 4MYHA 4Q9KA 1Z6YA 2MSDB 5SZIA 1M7BA 1TPZA 1J8MF 1YE8A 1BO6A 1T9HA 2SHKA 3IIJA 5J4YA 2QGNA 3QSYA 3O8BA 3SHWA 3CWQA 3O8CA 4JZKA 4LBYA 4DB2A 2Z0MA 1E99A 3SZRA 3B9PA 1OT3A 4X8MA 3V4RA 3LDAA 1Q1ZA 3EA0A 3WBKA 3W6NA 2HF9A 4JLOA 4LBZA 4RD2A 3RWMB 5BN4A 3M6AA 3AF2A 4POAA 1Z5ZA 5DO9A 4L8GA 3MJRA 4JBWA 1YZNA 3ICEA 2OV2A 4M1SA 3EWAA 2JDIA 3Q8XB 1FNMA 2R62A 3VFDA 1EK0A 1GRRA 3K0CA 2REOA 4C0LA 1UPTA 4RD4A 3VNUA 1FP7A 4Z51A 3SI7A 4AWXA 2WSSD 1F5NA 4KJZA 2B92A 4G5SA 1QRAA 1Z0DA 1XPRA 1LS1A 1OKKD 1W46A 3KKQA 4DLYA 3HPRA 5B57C 4NCHA 3DZ8A 3B5JA 5TV2A 4KBFA 2NGRA 1YZGA 2D3WA 3NC0C 3QXXA 1GM5A 1TTTA 2F3TA 5FTNA 1N3BA 3QKSB 1ZD9A 4LJ7A 1G3UA 5TARA 1R2QA 2VHQA 4JL5A 2JLUA 1KI1A 4B71A 1IY2A 2O8CA 4QBIA 4C0KA 1IM2A 1L4YA 3AKEA 1S9DA 4IDPA 2GXAA 2O8CB 1A2BA 3NH9A 4RZXA 1W2HA 5AR1A 2AFIE 3CX7A 3FWYA 4QC2A 5GJVC 1G6OA 1DELA 4RCZA 1F60A 2VP6A 4L9MA 4CEIB 2VRWB 3CRRA 2A3RA 521PA 1GNRA 1LV7A 5HE8A 4B3XA 4HAVA 2ZI7A 4UNPA 5ANRB 5JEDA 2Q3HA 4Q4LA 3AP2A 3LQQA 3DEFA 4R98A 1S0UA 4QOSA 4GSYA 4O3MA 1U94A 1N5IA 1N0WA 2H16A 3FB4A 3K0CC 4KCGA 4YONB 4H1VA 1R5OA 3GJXC 2VLIA 3Q3JB 3T1VA 3GJ4A 3MJHA 4BFUA 1T6NA 3IBYA 5KNCA 2R65A 4JLKA 1OIVA 4EPTA 4O0MA 3K9HA 4NYIQ 1T5LA 4FCWA 2XX3A 3VR3A 3T61A 1XRJA 2D62A 3CONA 4HI0E 3TAUA 4A1FA 3GLHA 3IIMA 4JKYA 2Q9AA 2JLXA 4FN5A 1FX0B 1W4AA 3GLHB 4OK3A 3AF3A 2BBTA 3EC2A 3I5YA 2E9SA 3A36A 3FHTA 2Y8EA 2HYDA 3B8HA 1NVXQ 4R9UC 1KNQA 1TU3A 3BE4A 2R2AA 3FDIA 3LO5A 4NONA 1TNDA 2AD1A 1KMQA 3QKUA 1RFLA 3THWA 2L0XA 4IVPA 3W5IA 2IS1A 2QPTA 3EIEA 3ZQJA 3LFUA 1CJUC 2RGBA 2WIBA 2WKPA 3OFND 4NCJA 4KYUA 2QQEA 4QFMA 621PA 1RYHA 4ASUD 4MRVA 3I8SA 4IVQA 3JVUA 4ZO4A 2ORVA 1VG9B 3PCRB 2EFHB 5DI9A 3UGDA 1NBMA 1TQ6A 2XTMA 1II8B 3LW7A 3NG1A 4S35A 3SYNA 3SFZA 3N2IA 3AV0B 1ZD1A 2GXSA 2QROA 1KOFA 3VR5A 1IBRA 3P1JA 5BYJA 1CLUA 3X1XA 1XD8A 1KAGA 1U2RA 4HATA 3L0OA 4LHZA 4C9BA 4FINA 3ND9A 1X1SA 2O5VA 2QE7A 3DKVA 3KFVA 3PG5A 2N1BA 3LD9A 1GL6A 4LOAA 5DISB 1E79A 1CJMA 5TMPA 121PA 1KDTA 2PL3A 3CF0A 1JQLB 1RW4A 3A1SA 2OXCA 3FMFA 1UBCA 5E4FA 5C1BA 3EZ9A 3LXXA 2JA1A 4WAUA 5L3SB 1A5TA 3AVTA 2ZITA 3AH8A 2UVQA 3MMPA 1G4UR 4JVNA 5DNYB 4KITB 5FBVB 1P9WA 1WXQA 2UZIR 2OAQ1 4OHXA 2PCJA 1G9XA 1W36C 4OBEA 3LX8A 5JZVA 3B2EA 2ZSFA 2B7CA 4A0RA 2BEKA 2A7QA 1M1YE 4FD2A 4WOPA 5EQTA 5FBRB 1SVMA 2ZSEA 1KK0A 2PZGA 4MRPA 3K9GA 2IXEA 4D6PA 2PJZA 2W6ID 2R8RA 4EFLA 3GEIA 2VQSA 1TF2A 3LBNA 5F9HA 1LS6A 1E4VA 4QHYA 4B73A 3NTUA 4LJ9A 1R7RA 2ODEA 4XJXA 4HEJA 4XWOA 1Z0IA 1ZMXA 3IGFA 2ZE8A 2QI9C 4D26A 2QY9A 2NZ8A 4OK5A 2NOAA 4Q1CA 2JDID 2OCYC 3PEVA 3CBQA 4QBFA 4V0NA 5LDDC 3A37A 1GWNA 4PC1A 4GI7A 5EE0A 4A2QA 2DPXA 1ZM7A 3FFBA 1A82A 3KXKA 4B2LA 3TR0A 4DUGA 4RD3A 3CB4A 3R9IA 3TBKA 1LF5A 5BW8A 821PA 3AVQA 4JL8A 1OXSC 4Q19A 2C9YA 3KB2A 4GL2A 2WJHA 5KDLA 2D4HA 4BLRA 3T1QA 3TAHA 2RGXA 3QF7A 1W0KD 2C9CA 3LW8A 3ADCA 1UEJA 3IKJA 3QE0A 2IYVA 1TUIA 3KKMA 3WP0A 1HURA 5JFGA 3WY9A 1YZUA 1XMIA 3ZYCA 5SZJA 4XVQA 1G7CA 3CH4B 4ZDKA 4D25A 2KBEA 2ERYA 2VHTA 4KFUA 3GLIB 1E9CA 2HXSA 3SJCA 4KLZA 3FFAA 3WBJA 5EP4A 1KMHA 4DCSA 4C2TA 5FOWA 1WCV1 1X6VA 2QTHA 2QRZA 221PA 1I4DD 1KSHA 2BKUA 2YOHA 3FE2A 3GMTA 3KTAB 1CR2A 2JASA 4GNKA 1J8YF 1FFHA 4OQXA 4X8LA 1M8PA 2JAQA 5E3HA 1FTSA 3PJRA 3L0SA 3LLUA 1Q57A 4MRSA 2Q9BA 1GRQA 3U6KA 4MDFA 1R79A 1CBUA 1E0KA 2EFDB 4R71A 4M22A 4ZI3A 1F2UA 4P4SB 5H1YA 2VEDA 1N2CE 1VMAA 2GAOA 3IO3A 5JEEA 1C4OA 3L0IB 1JJ7A 5JLJA 4AY2A 3T1OA 3GFOA 1IOZA 4ZI2A 3UK6A 2PT7A 2NO7A 4MKHA 3UKDA 4KYIB 4Q9JA 2OUKA 4MYCA 5LPNA 1YZQA 5JHHB 4AYXA 5FOXA 4M9XA 4TLEA 1VKJA 1X86B 4UNSA 5CDFE 5FPSA 1G7TA 2FSGA 1Z08A 2I4IA 2J0UA 1YU9A 2IYSA 3QBVA 1KO7A 4A0HA 2BBWA 3HP1A 4NCIA 4RFSA 4TMTA 4F4IA 2WMOB 3L0PA 5HZKA 3UG7A 1KI6B 1U81A 4LJAA 5KSZA 1OW3B 4RFSB 5FUWA 2GZAA 1DARA 4IFEA 3QG5A 4B3BA 3FKSA 5J47A 2WKQA 1Z0JA 2CK3D 2HXYA 2OO7A 4MRRA 1NBMD 5HZHA 4X8HA 1DS6A 1ONBA 3T5GA 1CEEA 1OJLA 2WM9B 5A0FA 1G3IA 5TVKA 1P4SA 1QHNA 1UADA 2HEIA 3REFA 3GLGB 2O8BA 1EFCA 3IUYA 1R4AA 1E2IA 1KO1A 3TRFA 4I1VA 2O8BB 3TUZC 1G8FA 2X77A 5DI3A 5CITA 1T3SA 3AF0A 2J9RA 3MCAA 2Q3MA 4QHSA 5K8UA 5DI3B 2ZTSA 1AKEA 2ZI3A 2WBLC 3LA6A 3Q72A 1SVIA 4EJSA 4MA4A 4Q21A 1QDEA 2J7PD 4BRUA 5D3QA 1N6HA 4DLZA 4D0NA 5AUNB 3EPLA 2V7QA 4M9SA 2G88A 4EJSB 1E9EA 4TYPA 1KDRA 1GVNB 1MO6A 2GJSA 2F43A 3IEUA 3TUJC 1N0UA 2ZI9A 4G01B 4WZBE 1VHLA 4U02A 3BFKA 2YWGA 2F43B 4TTPA 1ESNA 3AB3A 1OIXA 1E2MA 2ZANA 3DOFA 3OF5A 4KVGA 5HCNA 5JECA 3OIWA 2JLWA 4OQFA 1ZM9A 5B2ZA 4Q1FA 5CM8B 4J0QA 5GVRA 3C14C 3L8YA 1TAGA 2VF8A 5AJVB 3K9NA 4BUJA 5E7MA 5JRJA 4M9QA 1JBKA 2GF0A 4GRAA 1UKZA 4F91B 1MO4A 4CDGA 1NY6A 1LFDB 4DB4A 4I1UA 4BLQA 3QKRA 5HCIA 1BYUA 3EAQA 4FW9A 4DUGD 4MH0R 1VECA 1YRBA 3TW4A 4EJSC 3GLHE 3QKRB 2VL7A 4TZ6A 4UXJA 3HYTA 3QNUA 2ASEA 2ZJYA 3SOPA 1Z3IX 5FUVA 2UKDA 1N6IA 1CF4A 2FU5C 5EXTA 3T15A 3MWJA 4ZDJA 5FTLA 1NG9A 3U61B 2CNWA 1IAQA 1KY3A 2HLDD 1Z22A 4LV8B 3RAPR 5IK2D 3CIOA 1AGRA 2IYTA 5KPJA 1NKTA 2IC5A 1JR3A 2VP9A 1R0ZA 4O25A 1A1VA 2UZ3A 2QT0A 1TEVA 3O47A 4KODA 4JYCA 4E22A 1RRPA 3ZS8A 2VH5R 2CJWA 2GWHA 4NYMR 1MV5A 1KNXA 2WWGA 2OT3B 1NBME 2H18A 2GZHA 2WVJA 2PX3A 1E94E 1KDPA 3E70C 1E9SA 3PQCA 3ETLA 1KKMA 4QJ3A 2XZLA 3GJ0A 2FF7A 2ZSAA 5K8TA 1D2MA 4JL6A 4PQFA 3ZLJA 2ZPTX 1RYFA 2WPDD 4QG7A 3CNNA 5C2JB 4A36A 3ZZ0A 3U44A 2E87A 4IHQA 5FR1A 5C18A 3OZXA 2ZRIA 5EJEA 3U44B 4PAMA 4CEHA 1W49A 4BFTA 3ZD6A 1XEXB 4Q1BA 4IOJA 4P32A 4Q03A 4G5GA 5FBWB 1MABB 1XEWX 4YDHB 3ZVMA 3PEYA 3B1WA 3ADDA 2KWIA 5B30A 4CEHB 3AVXA 4O2RA 2P5SA 4LK2A 2BJVA 1N6LA 5KDDA 2JLSA 1XJQA 3LBIA 4NPHA 1EXMA 5HTKA 4M2LA 1Q20A 2IHYA 5FPYA 1R0XA 3RS0A 1XFAA 4W5WA 2A2ZA 4Q7KA 3U3RA 4Q02A 1EESA 2P6UA 4M8NE 4A6PA 4W5JA 2ZQ5A 4MGIR 3OAAD 1KZGB 1SKQA 2WSSA 1G19A 3NBFA 3O8RA 3B6EA 2CXXA 2NO0A 1WRBA 2V54A 5DIFA 2G1JA 2R6DA 3FKSD 3RS4A 2OFOA 4C3ZA 2IL1A 3W6OA 3NHBA 2JLZA 5F3WB 3IILA 1XCPA 2XSZD 2IF0A 3GFPA 3MG9A 4L9SA 4KXFB 1D8TA 3VR2A 2AHOA 5KSOA 1ZM4A 2HF8A 1YZKA 2V1XA 5JJLA 1E1RD 2W0MA 4D82A 1TU4A 5A4JA 4Q18A 3BXZA 1H8EA 1YJ5A 4NZYA 2W6JA 3J81k 4MDEA 1KGDA 4H9GA 1IN6A 3P32A 4B34A 2FN4A 4LBVA 4B3FX 5J4LA 1MR3F 1Z6AA 1FARA 4OI0A 5JJIA 1E32A 3NDBB 3ADKA 2IWHA 1KZ7B 2G3YA 3K0EA 3E5HA 1D2EA 1P5ZB 2GVDC 1RKBA 4LC1A 2O8DA 4F93B 1EWRA 1KSGA 1KI9A 3PV0A 5J40A 4UXIA 1GNQA 421PA 2HT6A 4HUQA 4B43A 1XTRA 4WZAE 4E03A 2DWQA 4PTLA 2O8DB 4KAXA 3L82B 1FL9A 1Z07A 3IBGA 2O8EB 4PHGA 1WDTA 4HUQB 2ZJ2A 3OE7D 4XSGA 2IWRA 3GLIE 4EFMA 5TDHA 3CRQA 5KSPA 4BEJA 2F1JA 2P65A 3UANA 5KHOC 1PLLA 1COWD 1FQJA 3A8TA 3DMNA 1UKVY 1DOAA 5JI2E 2FFAA 2IW3A 3W3ZB 1NF3A 1O87A 1FQKA 1KHTA 3LAWA 4Q66C 3VU9A 3G5UA 1FPMA 2Q3FA 1XMSA 2WJJA 4DCUA 2QGZA 4YQFA 4MKFA 1ZM2A 5DH9A 5JSZA 2C03A 4PSAA 1YQTA 4XVRA 1KI8A 2QENA 4C0AC 4KHZA 3BB1A 4QJ5A 1OXUA 4TL8A 3IEVA 5JSZB 3EG5A 4URUR 5FTJA 4B44A 3LQRA 4YMWA 4TL7A 2YWEA 1N0VC 2R9VA 3TLXA 1E4YA 5GVSA 3VHLB 4RSGA 3RS2A 3DVLA 2CLCX 3OFNA 5TY0A 2ECKA 1BH2A 4IXMA 4ASUA 5F98A 2ZEJA 1XJ0A 1W5TA 3QXJA 4DIEA 3EZFA 1VYVA 5KSYA 1E2HA 2RGGA 1D2NA 1F48A 1PJRA 3PVSA 5L8VA 3TMKA 3K0AA 1EWQA 2PJRA 3VX4A 1DEKA 1Z28A 4AC9A 1SKYB 4LV5B 1E9AA 1WF3A 3NBZC 2YKGA 3ZGXA 4Z1MD 1GSIA 2QMHA 2FFHA 3LVQE 5EXXA 3CZQA 3IIKA 4JLPA 1QZXA 3D31A 3ZIAD 1HV8A 4QGAA 1DBSA 2H17A 2NO9A 3PUXA 4URYR 1M74A 4FXPA 5EXPA 4LCBA 4B2IA 2IXFA 1AGPA 3QG1A 4R7ZA 1PTRA 3NEJA 5LD2B 1JR3D 1SVSA 4BFYA 1E9DA 4URWR 3RSLA 4PHHA 1I2MA 3RANA 1ZCBA 3B85A 4B48A 1ZVQA 2BM0A 3DOEA 2B8WA 2LWIA 2OFWA 4M0LA 3SC3A 3B1YA 5B64A 3GLGE 3PUWA 1VIAA 4RKEA 4LC0A 4Q4JB 1IN4A 1P61B 3RS7A 4TLAA 3ZQ6A 1XTIA 4D80A 3BFVA 5TB5A 4UNNA 1CP2A 4F4JA 1DAIA 4V0KA 1X8LA 4B32A 3EZ2A 1FUUA 2F6RA 4TYWA 4Q1EA 2JLRA 3HR7A 3RHFA 4UJ3A 1KI7A 1IN7A 2W6IA 4L15A 1U8ZA 3I92A 4NDZA 2VSOA 2ODBA 2JJ2D 1U99A 2F55A 3MWYW 3ZS9A 2ZI5A 4UNQA 2RMKA 5E7IA 1S1MA 4NKRA 3FMOB 1ZD8A 2GESA 4YXWA 5LD2C 2Q0HA 3AKYA 2EVWX 2EWVA 3F3YA 1ZNZA 1TQDA 3IQXA 3OEHD 4HLDA 4DDUA 3U7FB 3DDCA 4P33A 1OH7A 4WVFA 4TQUS 4UNRA 2ENNA 1H8HD 1PUIA 2VO1A 3AF1A 4HLQB 1NSFA 4Q9LA 4W9MC 4QHTA 3A1VA 2R6FA 2QUZA 3CZPA 4TYQA 3U2QA 2VPPA 5FL7A 3WHKA 4PQYA 4F38A 1U0HC 2ODNA 3QKSA 2QBYB 4JLNA 2QMOA 2ZRJA 1W0KA 1JEEA 4W5HA 1L2TA 3BJIA 4WW0A 3WYAA 2CBZA 1Z6XA 4LJ4A 3HU3A 4CEJA 5BYKA 1E9FA 1KSJA 1OE0A 5DYGA 2ROWA 1P2VA 3LV8A 2P67A 1UBGA 3W5JA 3V9PA 1Q44A 4JBXA 3WYGA 2JJ1A 4LJ8A 2GJ9A 2ZE5A 2FFBA 4CEJB 4YLGA 3BWDD 1H8ED 1XTKA 3NIBA 4M1KA 3BS4A 2W6JD 2VRWA 2YWFA 4CEIA 4BZPA 3KY9A 3MFYA 3R7WB 3THOA 1I4LD 2ZVQX 1BKDR 2AL7A 1KJWA 2ZRGA 3VX3A 2JCSA 5DSZA 4QKQA 2PCLA 3BORA 4L16A 4IKEA 4FKDA 2W0SA 3IDQA 4BZXA 1UDWA 2ZRDA 5DLQC 4LUCA 3EPJA 1SXJA 2CLDX 2G0NA 1FP6A 3DZDA 3QF4A 3RC3A 2A30A 1GG2A 1MO5A 4EPVA 3SJZA 1SXJB 2A5JA 2D2EA 1NN1A 3QF4B 3UWKA 4DCNA 3CX6A 1W48A 1V43A 1XEWY 3IPXA 4QNMA 5IF9A 4B76A 3NBXX 1R8SA 2ZAMA 4HDQB 1S9HA 1K5DA 1TF5A 1JR3E 4M1WA 4Y0VA 4IW3B 2DFNA 4NL4H 3CUEF 3H4MA 1QG4A 1AIPA 1AZSC 4D0GA 1FX0A 4B3CA 3UIEA 3BJIC 3QEOA 5CB8A 3TKLA 2WWYA 1VCIA 3RRYA 1NG1A 1QHSA 3WYFA 3FHOA 5C46F 4GBMA 1W5SA 1G5TA 2OILA 5FBQB 1VG8A 1CTQA 2GDJA 1BMFD 2V6IA 4JKIA 4M1TA 2AK2A 4BRWA 1ANKA 3ZH9B 3EWSA 3QEJA 3WNBA 3FOZA 2MSEB 1X8JA 4CT5A 1VTKA 3UWOA 1P7CA 4KSCA 1N6OA 1WBBA 3BB3A 3IPYA 1RVDA 3NHAA 3KJEA 2HV8A 1II8A 1LY1A 4BLTA 1SXJC 3TR5A 1GZSA 1EG7A 1P60A 2CK3A 5DN6A 4K8OA 2X2FA 1G21E 5A5GA 3AUXA 1I2DA 2G1KA 4M9ZA 3M1IA 2IYLD 5D3MA 2BKEA 1HQCA 2O0KA 3THXA 5D3MB 4HDCA 1Z6TA 1WE2A 3RSOA 5EE9A 2AK3A 1DADA 4P4UA 4B33A 1W0JD 4LI0A 2IEYA 3THXB 2VP0A 2XGJA 2P3SA 2RB4A 3BIFA 4BLPA 3QQ5A 1EFTA 2FGJA 2FPKA 5FOVA 4LGMA 3CKLA 3C4JA 1CJKC 4P31A 2ZS8A 5L3SA 1ZW6A 4DLSA 3AP3A 4DLTA 4RD1A 2IYYA 2V8OA 1L4UA 2X1VA 2VBCA 2B21A 3Q7QA 3SBDA 4EPXA 4HLUA 3N2EA 2VP4A 2VSFA 4WXPA 1KI4A 2J7PA 5KDOA 4DIDA 3T1TA 3LY5A 2CMKA 4BFWA 1AK2A 1UFQA 3R9WA 1OB5A 2RGDA 1Z83A 3R20A 4CT4B 3QPVA 4B6EA 4DSNA 1CIPA 1SVOA 3BGWA 3PEUA 2QMUA 4LPKA 1XD2A 5SZHB 4OHYA 1XD9A 1HUQA 2QP3A 4RD0A 4II7A 1R0YA 3T34A 1XD2B 2MMGA 2OCBA 4JLAA 8OHMA 4A92A 1MO3A 3RRNA 5CYPA 5EE1A 4G3XA 4NYJR 4PSVA 2RCNA 1W4CA 3BAFA 4I99A 3SQWA 4JJZA 2ZR0A 3A4LA 4N0DA 1DPFA 2YVUA 3H84A 1TQ4A 4JYBA 3WRYC 4HZIA 4ZDWA 3Q7PA 1EX6A 2DFKB 3M4YA 4YXWD 2WAYA 3THYA 2WICA 4QM7A 1MOZA 1KJYA 1JAHA 2GA8A 3THYB 4LYJA 2RHDA 1Y63A 3WRXC 2V1UA 2REXB 2DWPA 2BM1A 2ZYTX 2O8FB 1EFRD 1JXOA 1U0JA 4HLUC 4PAQA 4RCYA 2JGNA 5FL7D 4JLDA 1W44A 1XMJA 1L7VC 4QRHA 4BFZA 4DLUA 1CS4C 1R5BA 1XA6A 4LSGA 3G0HA 1J90A 2ZM5A 2WTUA 4PQRA 4NTZA 2P0EA 1RIFA 1UJ2A 1K6MA 3ZZTA 5EP3A 3F0TA 3KJIA 5FPTA 2F7SA 1JEDA 4B6FA 2HLDA 4UJ5A 5HE9A 3GLIA 5AK0A 2JJ1D 5FH9A 1DTSA 3CRVA 5IK2A 1M7GA 4A0FA 1Z0AA 4NU0A 4UXHA 3Q5EA 4F92B 1CULC 1D6JA 3KTAA 1NMYA 3O8DA 3WMFA 1HE1C 2VA8A 5BN3A 3SU8A 2YWHA 2VSXA 1T0HB 4KO8A 2JEOA 1Q1BA 1SKYE 5CIQA 1ZJ6A 1SHKA 2FH5B 3GFTA 3ZZUA 4D4KA 2PZFA 1YR9A 1WBDA 1NVUQ 3AP1A 2WSMA 2AR7A 1OIWA 4P4SA 1SXJD 2YC2C 2FZ4A 3RABA 5IHPA 2WPDA 4MKGA 1XEFA 4B3GA 1OFTA 4BZQA 3B60A 4C4PA 1JI0A 4BWYA 4JSTA 3F8TA 2ENZA 1D9XA 1Y3AA 2GEDA 2GHIA 4PPFA 3U3OA 1W7AA 1CRPA 3TIFA 1IN8A 1XWIA 2IYRA 2X8AA 1OSNA 3GLFA 1Q1EA 3AEZA 4LHYA 1P75A 3KB1A 2W83A 1UM8A 3GLFB 1W47A 4HB2A 1OB2A 2JATA 1T91A 1BIFA 5EUMA 3RNLA 4IFBA 3ZVNA 2WKRA 1SVKA 1OV4A 2VYFA 1XCGB 3W90A 4D4JA 3LBHA 4B47A 3KX2A 721PA 1GKIA 2YOGA 2FMXA 4US1R 1KI6A 4TLBA 5HR5A 3MLEA 1ZC4A 2IF2A 4H1UA 4ZPXA 1F3OA 1S8FA 1SHZA 2XOKD 3OAAA 4IOLA 3VKHA 2QNRA 3H2YA 1T3LA 3W3AA 4BLOA 2O0JA 4HSEA 4TMXA 3GPLA 2LKCA 1CR1A 1XP8A 1P72A 4EUNA 1VG1A 4KFSA 4GP6A 4AD8A 4JT4A 4WZ6A 2ZJOA 3ADBA 1KBEA 4DLXA 1PLJA 1AQYA 2IS6A 1XXHA 3OEED 1JPNA 4US2R 5DN6D 3GLGA 4D0LB 2XSZA 2F1HA 1OFHA 1JNYA 1XXHB 1YRAA 1E1RA 1II9A 2J7KA 1N5KA 4Q7JB 3H1TA 3SNHA 2DB6A 2WJYA 2J1LA 3AKDA 3FMPB 3TQCA 1AKYA 2GETA 5FPKA 2MSCB 1E0SA 1TL7C 4Q5IA 4F4CA 4AKGA 4OQMA 4UQOA 2B6HA 2OCPA 1Z0FA 1S4QA 3EC1A 4CF7A 1G8GA 2ATXA 2HCBA 3MWLA 1DO2A 2FEOA 1P9RA 2ZRBA 4NE2A 1OH6A 1NVVR 2A5FA 2WIAA 3PXGA 3UGIA 1RRCA 1Z8FA 2H1LA 3C5HA 3RVBA 3I72A 4E07A 3VQTA 1F6BA 2XEXA 4NHOA 4AYTA 4EKDA 2IXGA 4LYHA 2R6CA 1NRJB 4RVCA 2PEYA 1FZQA 1GTVA 4OHZA 5EXSA 3OE7A 4B75A 4MGZR 4Q4HA 2FJUA 3MD0A 4EPYA 3X1WA 3BERA 5H8WA 3RLFA 1COWA 4Q4HB 4IOMA 1II0A 5LB2A 3R8FA 1G5RA 3V4FA 4M1MA 4ZKDA 3SJAA 4D4MA 2GF9A 3K9LA 2PX0A 1G16A 4PAOA 3GP8A 1IY0A 4DEXA 2QTFA 1GOTA 4KFRA 2NG1A 2DCUA 4EDHA 1FOEB 2KI5A 2N46A 1SXJE 4QBHA 3FKQA 4XSHA 2Q21A 3KKNA 1G5PA 2ZVPX 4HAWA 2IS2A 4TTRA 2I3BA 2JLVA 2CE2X 1HT2E 2FFQA 1KO5A 2NO6A 1Z2AA 2VIIA 1FAQA 4ITRC 5G3YA 1NLZA 3PR1A 2ZRNA 2C99A 1PUJA 1FNNA 4JLJA 5JBQA 4TTQA 1UKEA 2KJQA 2GBLA 3QXHA 3BOSA 1RRGA 2NIPA 2VP2A 4PO8A 1T0JB 4R2HA 4JT2A 4Q1DA 4CVNA 4DEYA 5GJWC 1U9IA 4Z1MA 1ZU5A 1DG3A 3K70B 2ELIA 4DCVA 5FR2A 3ZIAA 3ZVRA 5EZ6B 5K8IA 2IK8A 3PITA 4CRWB 4ESVA 1ODFA 2WJIA 1QF9A 1OPXA 1ZU4A 4HB4A 3T12A 2GEVA 3PUYA 1BOFA 3NDPA 3SR0A 3PUZA 5F9FA 3K09A 2H7VA 5GADl 4HZUA 3TW8B 3QENA 3MAAC 2TMKA 5EE5B 1E1QD 1KK3A 2GJAA 3UMRA 2NQ2C 4HZUB 2GCNA 3QXSA 5JMTA 1IONA 1ZAKA 4LZZA 4HAZA 2KB0A 3A6PC 3HR8A 1QHGA 5G3ZA 2V9PA 2ZRPA 4WBSA 3DM5A 2XNSA 2GILA 2QEQA 4PO1A 3QPUA 2P6NA 1UBFA 1R0WA 3TGPA 4WA7A 4U7DA 1MT0A 2PMKA 5AJZA 4B74A 4DSOA 1OF1A 1AS2A 2GVIA 1OFIA 2Q9CA 1E6CA 1XEXA 4QNRA 2GBLC 2ZYVX 3T5DA 5L3QA 2DB3A 1MABA 2F9LA 2EW1A 4TMWA 2C2HA 2E1RA 2G0TA 5KNBA 3K70C 3CPHA 2AD5A 1U9IC 5L3QB 2ZR7A 2X19A 2JJ2A 2ZIAA 4Q7LA 4A82A 1N6KA 4OQNA 3QIAA 3N70A 2ANBA 2ONKA 2OFXA 4GOJA 4YDSA 1G17A 6Q21A 2NZJA 3I5XA 4FWTA 1T5IA 1E3MA 2AFHE 1Z06A 4JVSB 5AJXA 4A2PA 2RHMA 3ZD7A 1N5LA 2XZPA 2Z4SA 3OEHA 1W4RA 4KFTA 3TJZA 3K09C 1CRQA 5L3RA 3EX7C 3ASYA 1PZNA 1H8HA 2QM7A 1JQJC 1Z47A 5JS7A 4OHWA 3DHWC 4XVUA 1LTQA 4DLWA 1OXTA 1E2QA 1G3QA 2C9OA 3PFIA 5EUQB 1IXZA 4QGHA 5EZ5A 1N6RA 1UDXA 2BC9A 3P4YA 3RYTC 3K53A 2DR3A 5JCPA 1XU4A 2A5DA 1W4BA 3ONWA 2ZI4A 4KSBA 1HE8B 1RZ3A 3RC8A 2QPAA 4HLCA 1GNPA 4ABYA 5K8LA 4Q1AA 2OLJA 2QPOA 1NN5A 4TL9A 3LVRE 1AA9A 2R6GA 1TX4B 3QXCA 2NMVA 3B7GA 2ZJBA 2YC4C 1CJTC 1P6XA 5IDVA 1OYYA 1NP6A 2CL6X 2PT5A 2OBMA 3SYKA 2Z83A 3KQUA 3G82C 3P20A 2XXAB 1TUEA 1NI3A 4ESHA 4Z54A 4I81A 2E73A 3BRWD 1F2TA 2ZE7A 1XCMA 4XTCS 3FGNA 2O8EA 1NMZA 1R8QA 1PVOA 2D74A 3ND8A 2CLSA 3PIRA 2ZJ8A 4LHWA 5FFMA 2OM2A 1F2TB 4RJLA 4HB3A 2W2XA 1A2KC 2J3EA 3CF2A 3KKPA 3X1YA 4EAQA 2XITA 4XIGS 2ZRFA 4TQAA 5BN5A 2AKYA 2ATVA 1HYQA 2FA9A 2OAP1 3CNLA 3D8BA 3IQWA 4OQLA 4LRWA 3GJ5A 2CHQA 2QTVB 2BMFA 2LKDA 1NIJA 4FMDB 1Q21A 3CPEA 1XPOA 5JCZA 1S3GA 4TL6A 3FHCB 3RS3A 1QHHB 3H86A 1ZUNB 3QY0A 4NYIR 4V0OA 3SS8A 4LV6A 2CVFA 2YYZA 5CJPA 1BMFA 3BB4A 3CXLA 1G7SA 3SN6A 4XWKA 3HDTA 2CE7A 1ELOA 3AGQA 1E2PA 2XJ9A 4KLNA 4ZDIA 3CWZA 1YR7A 2H8KA 4EQ6A 3GQBA 2FX3A 2BCJQ 3C5CA 4N0EA 5IRCD 1Z6GA 1ESMA 1G1MA 1VDZA 4EQ6B 5CB6A 1SZPA 4GDFA 3TSOA
chains in the Genus database with same CATH superfamily
1NJ2A 2FK7A 3KQVA 1CERA 4M1OA 1UVFA 5EERA 1FVXA 2B0UC 1YULA 2WHXA 3KCNA 3KYDB 4MYTA 2A4MA 3NTXA 4HDKA 3SLGA 1J7KA 2WWWA 1D5WA 1DJLA 4QFDA 1PGPA 4JXJA 3D6TB 4KBGA 3PT9A 2I7TA 5KPDA 1ETUA 2C5EA 3TAXA 1NFRA 3DEAA 4BRSA 3EN0A 3QV2A 4W7IA 2JVJA 3M5DA 1M54A 1R0LA 3ZHQA 2O7VA 2X5JO 4AJHA 2HLHA 1M2VB 1JDJA 1ZN2A 3PX2A 2R1TA 3I32A 4YACA 3AJAA 5CHEA 3KKLA 5IT0A 5TE9A 3OLYA 4MVJA 4KX5A 3C5EA 2Y1WA 1UOPA 1WMSA 2AXNA 3STVA 3WP1B 1RD4A 5MGBA 2MWMA 4LTNA 4JUAA 4Q3OA 4BCCA 1GPMA 1H2XA 1MOSA 2YXPX 3I42A 3O1IC 4AZTA 4FEYA 1GILA 4RA6B 2ALJA 1DS3I 3UJNA 7MDHA 1Z2CA 2W00A 4Q4JA 1YV9A 2RH5A 3GXBA 5COBA 3M3DA 2B99A 4F3CA 3BN3A 3JYLA 1OZGA 1Z5WA 1FS6A 1OHHD 3Q6MA 3DO6A 4L57A 1R9NA 2NXNA 4PAWA 3ROMA 1R0KA 3RIHA 4GLOA 2I2XB 1B15A 3DM9B 3TH5A 1Z5GA 4XUEA 4DKXA 1KEZA 3MRXA 5DYIA 2QGFA 5JXWA 3JALA 1CZUA 3EXEB 4GZLA 4GOXA 4D1YA 2QDKA 5AKZA 5T4EA 3X1KA 2QYTA 2GTPA 2WAMA 5ER9A 1SOWA 4D44A 1I2AA 4IHJF 3VHXA 2Z57A 3BWMA 3ECCA 5BV8A 3W8EA 5IN5A 3KSUA 5E95A 3TNFA 2IYQA 2ZROA 1CJVC 5JXGA 3QW2A 3HB5X 4Q7MB 2XZOA 4HDSB 1E5DA 2X9VA 4G67A 1UBEA 3BMQA 2MR5A 4DSUA 1H0KA 2O1WA 1AQUA 2Q0QA 3EPRA 3VHRA 1DZ3A 2RGUA 3VYWA 1NVMB 1IRXA 1GGKA 1Z4JA 4KYTA 3ZKWA 1DS2I 4CM4A 5IJWA 3N2KB 4L4XA 5IT9A 3ORQA 4Y2SA 1KAEA 1A8QA 2P9HA 2ZPAA 1E6KA 3FM9A 3LFHA 3U3MA 3MWGA 1B1AA 3PT5A 3TX6A 5LB4A 1Q7EA 1OLXB 2XECA 1JAIA 3ROQA 2IS4A 3AL3A 5HJ7A 1DJQA 1A72A 2YNMA 2QD5A 4RZQA 3IOMA 4G65A 1N2GA 1U3CA 2VCYA 2RG1A 2WIJA 3S2EA 3WGOA 3LY8A 1YS4A 2H57A 2V55B 1SQ5A 3DB1A 3F47A 3FOAA 4PVDA 3OQOA 2PUFA 4GR5A 4CZ2A 4IIJA 2QBYA 3SHOA 5K6RA 1H9AA 4DMRA 4K46A 3R9XA 1GR0A 2X8WA 1N2HA 4TS1A 2ZYDA 5CDUA 1RWNA 1VKHA 2CCJA 4OATA 2V03A 2IVFA 3ESZA 1ZUIA 2NTYC 3DDZX 3KDSE 1VLVA 2B6NA 1Z16A 1JDPA 2GM5A 5TSDA 5JRDS 2HMAA 1UAAA 3AHCA 3AR4A 5B36A 4KIGA 3JVVA 1P3JA 2P9JA 2NU7A 3RHZA 3BGVA 4DANA 5KOYA 4FKMA 3ZDAA 4IIUA 1BUSA 2FPMA 4O1IA 3LX5A 3UFFA 3VAAA 5DGTA 2QYHA 4P3PA 1NDUA 5FL7D 1DKLA 3R7WA 5JWRA 4XUCA 2IYXA 1DT3A 1GPBA 4IDFA 3LZDA 1WAMA 3MNFA 3QK7A 4UUAA 5H68A 1MLDA 2RHGB 3TRDA 4IIHA 2ZPUA 4MA5A 2JS7A 4K9LA 4QO8A 3PEWA 3TLZA 1ARZA 4OI2A 5C5DA 4Q47A 1NJ6A 4PLHA 1QP8A 4P2BA 4WLOA 4AQDA 2JZMA 3EA4A 5C3UA 1WABA 1FFGA 2PWAA 2X5XA 2JK0A 4M9CA 2F3PA 4EVSA 2W90A 1K97A 1WV0A 1UCFA 1QBGA 2WJGA 4WNCA 3TRKA 4DIOA 5ARDA 1KKLA 2V3WA 2JCVA 3WWPA 2PIAA 1T1EA 3R40A 2K6GA 1KDZA 1U8YA 2FZVA 4N5IX 3RQIA 3IAFA 2GJKA 4X1YA 2RBKA 2TSYB 1EFVB 2YNMC 5CFNA 4XIFA 5DVZA 5JASA 4TYYA 2H9YA 1Z7WA 4HY3A 2KS6A 2JFPA 4MS3B 3VGJA 1XT6A 4MUNA 4REOA 3TTTA 3C3YA 4AURA 2B5WA 2F48A 4LTMA 1U0FA 2XY4A 4TV9A 1I7NA 5FLKA 4H4DA 4OSEA 3PNQA 3LDUA 3LT2A 2HN9A 1WB4A 4RK7A 5CJJA 5HZGA 1WQ1R 1PIWA 3ZWOA 1PSDA 2OG2A 4JC8A 2BUSA 5GONB 1OZFA 2WF7A 1U0LA 3QVVA 3WGGA 1HORA 1WHTA 2Q4RA 2XCUA 3EBLA 4W5RA 3N0VA 3OA2A 5KYKA 2J5XA 3CN9A 1NU8A 1XX6A 1ZCAA 1V8FA 1VHWA 4R9RA 2YOFA 3FLEA 1ENYA 4NIMA 3AF4A 1Y5NA 1JB1A 3GD7A 3M6MD 5DOVA 3KSMA 4ETIA 2V0NA 4I55B 4YMTA 4BO3A 1AD2A 1IJKA 2ZSJA 4G23A 1TMKA 3AVOA 3KQLA 5BQ5A 1Z5VA 4FI3F 4CU5A 1BD3A 2JIZD 2HQOA 3HJFA 3IX7A 2CCKA 3UGLA 4I2NA 2AN9A 3D4PA 1R37A 5EMKA 1ODCA 3CPSA 2EFEB 3RIYA 2AW5A 3OEEA 3SIXA 4PXSA 2G77B 2IFTA 1UMCB 3U1BA 2PUAA 3TMYA 1B8OA 4RZUA 4NQZA 3LHSA 2VTKA 2WG0A 4S0XA 1A5AB 2PSSA 1QAOA 4ER5A 1W88B 1GN8A 1J97A 2QD1A 2R5FA 1PJ3A 2XGMA 3NQ41 1B8VA 1H2WA 1E58A 1GPUA 4V03A 2G80A 3HM2A 3ZW7A 2KBFA 2W4QA 1I3KA 2ZIFA 4PXAA 4F71A 5ESXA 4RLHA 1Q84A 1TIPA 2I6UA 3HI6A 1FNBA 4QTZA 3JR7A 5L51A 3SOZA 5I7VA 1N1MA 1NX9A 1SULA 3DNMA 3GJ6A 1NLYA 1PS8A 2HK6A 2XIJA 4KR2A 5A4KA 3QI2A 1BE1A 3UMSA 5CITA 4U4AA 3U81A 4Q7QA 1O9GA 3WRXA 1HX7A 5L6LB 2N1AB 1K5GA 1VYUA 2ONZA 3BMNB 1JIKA 2ZIUB 3I6YA 3OWOA 5CFMA 2HDHA 3CQ9A 3FDFA 4FFLA 1XNJA 3N2NA 3ETNA 3FUVA 5I7AA 1Z2OX 2C2OA 1BRTA 1G20B 1GZUA 1NONA 3TSCA 3CLSD 4L27A 4TKLA 3M4NA 3NHFA 2CHVA 5E7JA 2BL4A 4D98A 2X8JB 2XEDA 4EHFA 4IFTA 4MUYA 3ZQKA 4RESA 4NJMB 2B9EA 3A4IA 1U0TA 4HQFA 1VSUA 2FPGA 3URMA 4JYZA 2BZ1A 4YAGA 2FWAA 2I2DA 1GUYA 2IHJA 2O07A 1G41A 2OVBA 2P69A 2Z4RA 4JB2A 4QUGA 1DKQA 2QOEA 1ZI9A 3HPQA 3KOOA 1WXEA 3K8YA 4DJJA 7ABPA 2E4WA 3SVLA 2ZRLA 4ZQHA 3BZWA 3CSUA 2DQSA 1MJAA 3EVGA 5JZOA 2EQ5A 5G0TA 2XMSA 3L0ZA 2FN3A 4GZ6A 2JFNA 1QU3A 1W25A 4JA0A 2YJNA 4YP5A 2JJ8A 2PANA 4HVLA 3H11A 1B2RA 4MLDA 1A88A 1TADA 4Z9AA 3EHEA 2C3OA 4E5PA 1P9OA 4JLVA 1XZPA 2OCAA 4MIYA 5JYDA 1U3FA 2OENG 2WWRA 2UUOA 4IYJA 7WGAA 2GFQA 2ZYWX 1C4WA 3Q9LA 5GONF 3VC1A 3IOEA 4BDSA 5JARA 1GUFA 2ZZKA 1XCOA 5JS8A 5ITZA 1RAGA 5HKKD 4M0CA 1IQRA 3HFRA 2ODWA 2O8FA 1ZINA 4MGKR 2HFJA 1KTVA 1MH1A 3TMAA 1KQFA 2PLFA 3IVAA 1PGNA 3NBYC 1BVUA 2I80A 3C6KA 4CV3A 2UU9B 4WKBA 1AO3A 1JDZA 3HL0A 4I55F 5DYWA 5K9ZA 3DLBA 5J5CA 2G5TA 1AKWA 1MB9A 2F90A 3M33A 5CTAA 3T06B 3L9XA 3VPFA 1M3SA 1Z37A 3IUSA 5F2OA 1KQ3A 4F93B 1PR1A 3EXG2 2YINC 1RQLA 3B38A 1CIJA 2VTVA 1DAHA 2UAGA 1X1BA 4UVIA 2NXWA 4EOGA 1US8B 4JLBA 2XHEA 5JT1A 4XZ3A 4Y1EA 4LS3A 2DFTA 4AMVA 4YY3B 2UXCB 4AP9A 4D9FA 2FEXA 4YP0A 1P2TA 1ZXXA 3DF9A 2AMYA 4QDJA 3B1XA 1YB1A 2MSLA 2WFAA 3FVTA 3NP9A 4H7FA 4QGGA 5JY1A 2PVCA 5F3DA 3EQ6A 3KQQA 4C0WA 1YWGO 2E85A 4GC5A 5EJ5A 3TL6A 1PR6A 4UUNA 4H1TA 1RPZA 3CWCA 4DA0A 1KS9A 3HRHA 3LP5A 4RL6A 2C88A 2NUPB 3AR7A 2I2FA 2PZBA 4JEUA 4N18A 3T35A 3K8QA 3PWTA 1XA4A 1NJFA 4U5QA 1Y9AA 4ZJYA 1GTZA 2O5CA 1MUUA 3QUCA 4KO1S 3LLMA 2A9JA 3RS5A 2EL7A 3BFXA 4TMVA 4BV8A 4C7XA 5A3JA 1K9SA 4YDQA 1KOGA 3KSRA 4QUDA 2YQ5A 1NR5A 3WNCA 3U7GA 4CNBA 3TLGA 4UZSA 2H7XA 3KJQA 2CHFA 4FDAA 4GUAA 3DL2A 4C30A 4I14A 2Q1SA 1UK7A 4AT1A 4ZV7A 4MAMA 1Q6YA 3KUXA 4WESB 3RU2A 4MQBA 4KRFA 3QJYA 2ONJA 5EXDA 3BXOA 2HNKA 2ISQA 3PTLA 4FHZA 4ZVOA 5TPWB 2AX4A 1QQ5A 3LNCA 5DTQA 5EMNA 4JQOA 4URZR 1OWNA 2I1QA 4Q4AB 2CZGA 5BWMA 5GJCA 4JI7B 1PR0A 4LNUB 1WPQA 3N05A 3SJBA 1CKEA 2X4GA 3A1NA 1RAHA 2EWMA 3CV3A 5GY7A 5I51A 3L41A 5DRTA 4KE6A 3MT7A 5C9ZA 3IOYA 4Q00A 4TWZA 1U5BA 3CEPB 5EIEA 4N03A 1X8KA 3W8NA 5IKMA 3OCVA 1OYWA 4R6WA 1OASA 4RK0A 4S1PA 3WLJA 5KNCD 4R05A 3SCZA 3JQ8A 3L6RA 3A1UA 1CETA 4KDFA 1QC5A 3B3GA 4NMHA 3ZE8A 3SS7X 1N13A 4UHCA 2A78A 1H42A 2ZR9A 1RAAA 3KJHA 3HCDA 5NLLA 3VR3D 4CN8A 4DXAA 4B4WA 2QBYB 2QP4A 3NT5A 1MC5A 3U4DA 1U4SA 4B4DA 1KPGA 3KVVA 4PO3X 5UKDA 1RACA 4LW8A 4H08A 1SBHA 2PGNA 4X1KB 4D99A 4KDCA 1K7XB 3OIYA 1P9LA 1MJBA 2KCXA 3AY3A 4CM5A 3F6CA 2Y9PB 3E2IA 3SQDA 1W29A 5FOUA 1DX4A 3GDOA 3UN1A 3JZMA 2WHEA 1KAOA 2LGJA 4MUAA 1FDUA 3DMFA 1FDWA 3HH8A 1QVZA 3ENVA 5LIRA 4FBLA 4Y2XA 5C4MA 5EG5A 2WMYA 1MG0A 3LGSA 4N9WA 3KU4A 3F46A 4GQIA 1YVPA 3KPWA 9GPBA 3DAYA 1N7GA 5E9QA 1CXZA 1QPGA 5TLSA 2ERXA 4P4TA 4DMMA 1XNRB 2ZB4A 2XQVA 3HO6A 1H2YA 4C22A 3A4NA 3FOFC 3QVUA 2NNWB 5KYXB 3GUHA 4RY2A 4K9KA 3W05A 5E0OA 1G2OA 2B1GA 2GEUA 1J99A 3GUVA 4N3AA 1TTPB 1NXSA 2EEPA 3IHTA 2YY7A 2BEUA 3M2TA 1RWBA 4B17A 1P7YA 2YIJA 1XR3A 5IZCA 4IOKA 5FO0A 1ZNWA 3P2EA 5ALJA 3TZCA 1FFSA 2F1OA 4CI9A 2O3RA 2XNDA 1ZUWA 4GLJA 1T4BA 2I76A 3EUEA 1JLLA 2PS9A 3BMXA 4TT3A 5ALSA 4DJEC 3PJFA 3A9SA 2VF5X 4EB0A 3HXQA 2E0IA 2R0QC 1LH0A 5DGXA 3RK1A 3BH0A 4BFSA 3TVDA 2YZKA 1EVEA 3TI7A 3U4QB 3CF6R 4D96A 1KBQA 1Y3HA 4LF7B 4X1IA 1D9ZA 2GTHA 4UCFA 1BS1A 1RLUA 1E64A 1QLWA 3H0KA 3KQKA 1G63A 2ATCA 4MV1A 4TWBA 2O3QA 3LWNA 4ZC1A 4B45A 3CHYA 1Q12A 2GGSA 4GC9A 4J9UE 1A9QA 1P2SA 5EPOA 1WKCA 1L4MA 4KVAA 4NPAA 3BTSA 2FWPA 3HVUA 4E12A 2QZ9A 4F9FA 4ACBA 2G9NA 4TMKA 5C5IA 2DIPA 4JAVC 3G6WA 1GQYA 4EPWA 4GM1A 1C3OB 1PJLA 3RYIA 1O6CA 3UPUA 4M7RA 2QX9A 4MUEA 1V1RA 4NYJQ 4UARA 3VR4A 2WK1A 5HGXA 2YRXA 1SVLA 1EJ0A 4MQUA 5GPBA 2GLTA 5D00A 3VKGA 4M1YA 2ZJ7A 3OKAA 3ONEA 2GSWA 1EVZA 5AUQA 5IS2A 1EDBA 4QUEA 1DKMA 3GNQA 5E6RA 2VJKA 1FSPA 5FBLB 4KSYA 4DSZA 1N6NA 4UTVA 1IEWA 1ECLA 2VK1A 1BXGA 4BVFA 2GAAA 4BBPA 1S01A 2CDNA 2FKNA 2ID8A 3JATB 3MS7A 1TFUA 3RVOA 5H7XA 4TKUB 3UUEA 4ERNA 4PG7A 1T8TA 1WXXA 4EVIA 5KNDA 2ZXUA 4IKOA 4DPLA 3KYCA 2PEZA 3M6LA 2FSPA 3HJCA 2AFIA 3ND5A 4XGIA 4OHVA 4W7SA 3ZTTA 2RBGA 2C7RA 5I4KA 4RTNA 1PNVA 2WWHA 1Q0QA 4GOKA 3WLIA 1VLLA 3KUCA 3G1TA 4H60A 4WEQA 1JPJA 3I83A 3GJSA 3ZHRA 3TSZA 1J6UA 4G81A 3X1ZA 4CT0A 3PC3A 1G5QA 1G9SA 4M1QA 3SSOA 3ZTYA 1KGSA 2OOKA 1MOQA 1UFRA 2FFJA 5A6VA 3E4DA 1V7PC 1WCYA 5KJCA 3O31A 1Z0KA 2FG5A 5FBKA 2O54A 1CCWA 1OR8A 2FEMA 3RU9A 3T7IA 4B4OA 1NXUA 4B8WA 3ANMA 1GA4A 4EVRA 1XTQA 3T3HA 3TZKA 4L2IB 1NI4A 1SD5A 4ND8A 4WNAB 1IOWA 1KI2A 4BYMA 1TBNA 1QYDA 1PJCA 3HKDA 4Q3CA 5EJIA 1UK8A 2NVOA 3H5TA 1W5FA 2JHGA 2VHCA 4DV6B 1FU7A 4UC0A 4YYZA 3S8YA 4AK9A 1WPRA 1UQTA 1EVJA 3NHWA 4MW6A 1GUAA 3VV3A 1Q9BA 3GROA 1XOIA 4KH1A 5C0OE 3EIWA 3KJZA 1KDOA 4MS1A 4JQSA 4HSGA 3TZEA 1M0EA 4OJMX 2FCRA 2J07A 1NOIA 2HQSA 2GPWA 1M76A 4TTSA 2EW8A 1XYGA 5BRAA 2YN0A 2QSYA 1ZEJA 2CUZA 3A6LA 3AY0A 4RIHA 4ZKEA 2F3UA 2ZBQA 3W5HA 2LB7A 2CHGA 4IKPA 2QRHA 3K2BA 3V2HA 1P1KA 2VHJA 3P9IA 3A3PA 1N6PA 4Y9DA 2VF7A 2C57A 4RNDB 4WJLA 2ZJ6A 4RHUA 4IEEA 3UEYA 2JEZA 5FL3A 3G0GA 4G84A 5I5EA 2OE2A 4NP6A 1BD4A 1OAOA 3VZRA 1T0PA 4XUGB 3QX8A 4J4HA 4NLLA 1QQ7A 5ITSA 4Y2PA 2V6JA 4Y8VA 1IK6A 2PQ0A 1B1CA 1SVWA 4OJKA 4P3XA 2A3NA 3DGFC 4V39A 1DJNA 1HQDA 5JPIA 2VYCA 3LI2A 4JBLA 1RJ9B 3A6JA 1DO8A 1PF7E 2K2QB 3HH2C 2A9KA 4PPQA 2WAXA 2DF8A 1WXDA 2Z1NA 2BYTA 3RSQA 2I7CA 4X7PA 3MXTA 3IL2A 1E2DA 2OHIA 2Q6TA 3G23A 2IXAA 4IMIB 2O52A 4TSFA 3M70A 4U7HA 5HDBB 2X86A 3ABQB 4HN2A 1OZ0A 3AIIA 4X91A 3U9LA 1ZLYA 5BV1A 1CEYA 1F38A 1B6TA 1SAYA 1PS0A 1BVRA 3DYVA 3SXPA 5HQJA 2A6PA 2Y2VA 1WLSA 3HA2A 5DBFA 1Y1KE 4BX3A 5F52A 3RVLA 2J3IA 4GX2A 4BMNA 1LFAA 3W7AA 4E5UA 2I55A 2YS7A 2P5TB 5EWJB 4A8JB 2XXAA 4PG6A 1JVBA 1VJRA 3WKAA 2Y1EA 4BP8A 3VU8A 1P7ZA 2DY0A 1G0OA 4I4LA 2B37A 3EZNA 3OFVA 1ILEA 1QG2A 3VOBA 4ENWA 2VQEB 2XUOA 3GDGA 2F1KA 4TZ0A 5DLEA 1I7DA 1Q7TA 3EYWA 4W9RA 3D3NA 5IARA 5KCZA 4ZIRB 2HJVA 3GJ3A 4BQEA 1XZIA 2GT1A 2IU6A 2VP5A 1TOTA 4I5IA 2N42A 1YFLA 3C74A 1NMQA 4A6XA 1W6UA 4CM6A 1HT3A 1SCKA 2C1ZA 5B3KA 5BR7A 1P4HA 4UEWA 3ZVKA 4LYYA 4MKIA 4J0IA 1YTLA 3OL0A 4N5HX 1PNOA 4G07A 1IULA 3CRMA 3SYLA 1EP1B 1H2RS 4N7MA 1UJMA 3PUVA 5CGZA 4AI6A 2OZPA 3BMOB 3SSNA 1NMXA 2C7BA 3JQEA 2QP9X 1RFHA 2FB9A 3BYZA 4TMZA 5CVTA 4LYAA 5HPYB 3CLTC 4ZXFA 1FYXA 2ZDHA 3HDYA 4U2KA 4XLLA 3VVBA 4WN3A 3FUUA 4D3XA 1K7TA 2V1CA 4CNQA 2RAUA 2HREA 1GKLA 1N1DA 2QTTA 4H7KA 2OHJA 3LKBA 4KQFA 4MX8A 3RYHB 1O8CA 1VIYA 1Y89A 3CF4G 3GMIA 3AUSA 4ZT3A 1F2VA 4NXMB 2J0VA 1SUSA 2QR5A 3QNWA 2C7OA 3WR5A 3OH8A 1L5HB 3Q0EA 2PYZA 1BKSB 3GCGA 4W9NC 2GHRA 4OY3A 1DBRA 3C3BA 2OZEA 1MX5A 5FPPA 4CL3A 1JSZA 1S2MA 3TGWA 2WM3A 3N6RA 1B0UA 1XRRA 2BZGA 1LPAB 4MV3A 2NV6A 5ETJA 4BY9E 3RWOA 3JWJA 1KY2A 2IYZA 3WMRA 2VDQB 2QAGA 2WV9A 1DX6A 2CWDA 3OPNA 2IBMA 2ZAOA 2BFFB 3FIUA 3KKOA 4PYOA 2FRXA 4MUMA 1E9BA 4PX5A 4EPRA 2XZLA 5AI4A 1YDEA 1DO0A 2BFWA 3VTAA 4NX2A 4QQKA 1SQ0A 5FYDA 3OC6A 3NNSA 1SD2A 3VTFA 1B0AA 4D5GA 2C4NA 4RPCA 1Z8DA 1SOUA 4Z4EA 5F5NA 3RREA 1ESZA 1CQWA 4Z8YA 1U7XA 3L07A 1GLGA 1KJZA 4J03A 4XWAA 3WFJA 3WXMA 4DLVA 4ZYYA 5HQ3B 1FMLA 4UMDA 2WJZB 3U6BA 5L3VA 2V7XA 3DYIA 3GXOA 3C6ZA 5DCUA 4N48A 3LUBA 4KQHA 1LRLA 4Q6WA 4H15A 2QXYA 1TM1E 3B13B 3AZOA 2PZKA 4RFLA 1B8PA 3OO1A 2OCXA 1XC7A 3IEXA 3BD6A 3C3EA 4DL9A 1I7PA 1XP5A 5HZMA 1WY7A 2DULA 4CIDA 1SUDA 3DJFA 5KTNA 1NY5A 3B89A 1QOPB 2PBRA 1ACMA 3EQZA 4NI5A 2XB4A 3I61A 3WIOA 3WXBA 3FGPA 4W1RA 2P4EA 2PWPA 1MX9A 2CNWD 1CR0A 3ZLTA 3RADC 1JQBA 2KSQA 1VHQA 4CV0A 4ED9A 3WNDA 1SH7A 2XMDA 5FWXA 1F8FA 4IG9A 5G1PA 1J0DA 2C42A 4IDNA 1GRNA 1U3WA 3PYMA 1Y1CA 4Q9HA 3V4VB 3A3KA 3JZAA 1GFIA 1RRVA 2ZJ5A 2WM2A 2DUWA 5TXGA 1IHDA 1RYNA 2AXPA 3MEQA 3ZHYA 1BA3A 4PO9A 5I4IA 5AWFC 3OQIB 2ZYIA 1XN4A 3L43A 2Z9BA 5MFZA 5K8JB 4L7VA 4NCKA 4DBZA 3KOUA 1YKSA 5TR9A 1KI3A 1VYTA 5AH0A 4MYHA 4ZEXA 2Q4TA 2CLIB 3M6IA 2MSDB 3ZWKA 3I0MA 5SZIA 2GD0A 4ZO7A 1XA3A 1YE8A 1YS1X 4K2AA 1SBIA 4A16A 3D4NA 1Z2EA 3QWFA 3R3WA 3IIJA 1ZJZA 2QGNA 4MQ6A 4YJ2A 4R1OA 2C2XA 4EYSA 1QMPA 1UKBA 3GEGA 4FFBA 4YCNA 2JYYA 4NHEA 1S8NA 1RE1A 2MDTA 1UBMS 1OT3A 1Q17A 3V4RA 1WQ4A 2UZ1A 2W7TA 3I39X 2UV8A 1RQGA 3QELA 3T7JA 1XQ1A 3KT3A 4TVOA 2XH8A 3D0QA 1YBMA 1AKTA 4RJTA 1P81A 2YWCA 5FYQA 3IXQA 4IGIA 2AQ8A 3AF2A 2DJ5A 4YP1A 2XCRB 3E82A 2OL4A 1ICEA 5DO9A 3LCCA 3ICEA 4JBWA 1OTYA 3I2JA 2OV2A 2ODQA 1CYDA 1XTBA 2N9UA 4RTLA 3Q8XB 4A03A 3CZMA 4K6OA 4KAAA 5KQGA 2R62A 4DTCA 1EK0A 3EXFA 1HK7A 4HWPA 1YMUA 3K0CA 4P84A 4C0LA 2OD2A 1SC4A 3ZY6A 4AO6A 4HFRA 1WB6A 1X0XA 3B8EA 4E5YA 1P4GA 1E7YA 1F5NA 4KJZA 4XYEA 4G5SA 2Z2YA 5DYTA 3PDUA 3P2YA 2IOQA 1LS1A 3DBIA 4KQXA 5ISMA 4P86A 3KKQA 3DZ8A 5DHUA 1BZYA 2NGRA 2D3WA 5DIZA 5AICA 5F78A 1GM5A 2F3TA 3AB7A 1N3BA 3ELUA 5FTNA 3ESYA 5C8VA 5KTMA 5TARA 4JL5A 5JZ9A 1EQAA 4ALJA 2B83A 2GVNA 2C9ZA 4MLPA 1GZ3A 4C0KA 4YP7A 2AJCA 4FDUA 1SGDI 4FOTA 3ZK8A 4JX8A 4JOCA 3RFCA 2FPSA 3ESXA 4BAGA 2NU8A 1P4RA 3FOWA 2PJUA 3Q40A 3TQQA 4MHSA 3FDZA 2VP6A 5AW1A 1B76A 1GZ6A 1VGRA 1OLUA 521PA 1IZ0A 2PFSA 3GCXA 5ALQA 1FLAA 3RSZA 3PKZA 1YUNA 2ZG6A 3REOA 5I7WA 3UFXA 3WAKA 1MU0A 3LZ6A 3OICA 1E3SA 4Q4LA 4TRJA 3AP2A 1KZHA 3TQRA 4ZAGA 1X42A 4DCJA 1M8CA 1KRHA 2G5CA 5A3VA 5KINB 1RWXA 3BCUA 1K7CA 1U94A 3VR6D 1N5IA 1N0WA 2H16A 3FB4A 1ZHFA 3ILSA 3K0CC 1USWA 4INOA 3K16A 4H1VA 4R2JA 1A3CA 1RC0A 2ADFA 2IKSA 2VLIA 3GJXC 4IUCS 3AG5A 4RGQA 3GEDA 5CDGA 1FSSA 4CMEC 1SHUX 1N9ZA 3IBYA 1L7PA 5D5QA 1VKRA 4BMXA 3TYXA 4NYIQ 2H1WA 5AESA 3Q4GA 5DULA 3K4PA 4NU8X 3TQHA 3W0LB 2YFKA 1KQGA 4I46A 2A9OA 2XX3A 5DLYA 3PGVA 1VL6A 1AHNA 2EGGA 3I58A 3VYRB 3WLHA 4KR0A 1A77A 3DZIA 4JKYA 2Q9AA 4DREA 2JLXA 2JIDA 5DNVA 3MZ0A 3PA8A 1MFPA 1X1AA 1CUGA 4BKRA 4BIMA 4KE9A 1UP6A 5FJIA 3AF3A 2NT4A 4DMGA 3EC2A 3FOBA 2LBPA 4EUKA 3A36A 3B1KA 3C4VA 3ZCTA 4CE6A 2QN9A 3B8HA 2WD7A 3Q5GA 5JD5A 3C97A 3BHMA 1DIBA 1G1AA 2FUG1 3JQAA 4LSWA 3THWA 1P91A 2L0XA 4RSHA 3TW6A 2TS1A 4GPEA 3OJCA 5ALWA 1JHDA 3EYAA 3ZQJA 3NASA 4Q6BA 3BDIA 1U9YA 1CJUC 3OFND 2WIBA 3OM0A 2I1WA 4FE7A 4FTWA 1JAYA 4KYUA 3RCBA 3ZC3A 4DQLA 4MRVA 1GXSB 3UHJA 1ULMA 2EX1A 3I8SA 4Q34A 3DQQA 3WAGA 2MYNA 2QMZA 5DI9A 4A8PA 3MIIA 3SYNA 3N7AA 2O20A 3AV0B 5FBZA 5JZMA 2PLNA 2XA1A 3LP8A 1E6LA 3KEOA 1J25A 3O03A 3PC4A 2NZWA 4HF7A 3TG8A 4MHTA 4ISBA 5F9MA 4AZ3A 1KOFA 1V4VA 3VR5A 3LF2A 3P1JA 5BYJA 1CLUA 3X1XA 4RGYA 4CM9A 1KAGA 2JAXA 1USIA 1XXLA 1U2RA 4HATA 5A06A 2XB6A 2NZUG 3GT4A 3PE3A 5U4XA 2GK4A 2AN3A 4M0UA 2O5VA 3KFVA 3PG5A 3MBIA 2N1BA 3LD9A 3QU4A 5KYWA 4LOAA 1K7VA 1ZD4A 4YJ3A 5DISB 1AY0A 1J5PA 1C30B 1FP4B 1SUPA 4AJ1A 2VJYA 1ZOIA 3SZLA 4Q3DA 1PNTA 3FN4A 4ES6A 1XVTA 3AFNA 4QAJA 5TMPA 2OQ2A 1PRYA 1RW4A 1Y33E 3NM4A 2OXCA 3KQWA 3CVYA 1UBCA 3MF4A 2OZUA 3PXCX 5BYAA 4QAQA 4L50A 3II6X 3LU1A 2C0QA 1E61A 3Q9UA 3AVTA 3AH8A 1BU5A 2C4HA 2UVQA 1R6VA 4UMEA 4JVNA 5DNYB 3QU2A 4I08A 2IV2X 1VHDA 2QNBA 1VPEA 1WXQA 2OAQ1 4O63O 2BEWB 4H1WA 4FGWA 4KQMA 4OBEA 5ELMA 3FCCA 2ZSFA 2BN4A 4COOA 3BGSA 2GBPA 4NV3A 3CMCO 4RXMA 4A0RA 3OXLA 1QTRA 1U31A 4BKPA 4Z4GA 4BV9A 1UFVA 3BILA 3BXEA 3D8NA 4XX0A 1SVMA 1FDVA 5EEGA 5FBRB 4EKYA 5JXHA 5CT4A 3IKTA 4UATA 4EX6A 2W6ID 1B7GO 1REQB 3H2SA 3PFFA 2C5GA 5IAJA 4RDXA 5KYGA 1TF2A 2Y93A 1E4VA 2VDRB 5LQMA 1DL5A 2ODEA 5TJHA 5C8YA 4XJXA 5AXDA 3WRVA 4G26A 2IP1A 4IQFA 1BHO1 5AVRA 5TS2A 4CV1A 5JD4A 1ZMXA 2IOFA 3IGFA 3QEMB 3RBZA 4D26A 2RHLA 2NZ8A 1CQIA 1LLCA 3CBQA 4V0NA 1WXGA 2CV1A 4OX9B 1OX6A 4GI7A 5EE0A 1VGVA 2VPZA 3GFBA 5I7EA 4CLOB 4X3OA 1RXWA 2NVUA 3NBMA 4B2LA 4PNPA 4D74A 2HY7A 1PGQA 1LQTA 1PBNA 2IYOA 1N2SA 4X94A 3RUAA 1GLVA 2UUPA 1KR2A 1OYVA 1X92A 3AVQA 1F0NA 821PA 1NAIA 1EBFA 2XUFA 3AWIA 4MQEA 3ZWQA 4LGYA 5EQJB 4LZNA 3TAHA 1XGKA 3QF7A 2F4VB 2C9CA 3MYYA 3QE0A 2IYVA 1W85A 4D4IA 1CYEA 5BR1A 1YNSA 1YCHA 2JBHA 3L7BA 3Q3HA 1YZUA 4PLZA 4C87A 2NAPA 4MR7B 5IUJC 2HHHB 3ABIA 4H7PA 3CU5A 1OMUA 1C0KA 2JJMA 4DMUB 3URKA 4OUDA 1XMQB 3ILYA 3UGKA 2COUA 1MHPA 5F73A 4HG2A 4D25A 2AF4C 4E2WA 2VHTA 4A8TA 2IP2A 4KFUA 3IMGA 4KWEA 4YPFA 4NULA 4DQ0A 5BP7A 1V45E 4KLZA 1B43A 1HYBA 3T9FA 2VK8A 3A1FA 4Y2UA 4ZK6A 1JZSA 2BI4A 3VRHA 4IXDA 1WCV1 2QRZA 3BIJA 1I4DD 3SYMA 4LF8B 3FE2A 3HR4A 2JASA 1BHSA 3ZW9A 5BSTA 2QI9F 4IIGA 4KQKA 1YRLA 2OECA 1M8PA 2NQTA 1Q57A 1J07A 5ILOA 2JAPA 2Q9BA 1RVV1 3OLVA 4OB7A 2P2SA 3E8MA 2IDJA 4G8DA 4H0CA 1R79A 2JGKA 4TN5A 2IDKA 4Y2JA 4M22A 1H0SA 3BIOA 5H1YA 1N2CE 1VMAA 3IO3A 2Z8ZA 4U1RA 1JSCA 1C4OA 1O94A 1UH5A 1NNI1 2VRBA 3L0IB 4GO1A 4IIVA 5IXJA 1YS6A 4EO7A 13PKA 1XLUA 1JJ7A 3KLOA 3CCFA 3T1OA 1KE1A 1JHVA 2JC3A 1C3EA 1N34B 2YMMA 4C1NA 2ZTLA 3JTMA 3UK6A 3NFYA 4ZI2A 2V0GA 2NO7A 3DD5A 3UWMA 4NABA 5EKUA 4ZJPA 2OUKA 3CX3A 5EIXA 3ZWAA 1F12A 3M3HA 1M8GA 3GD5A 2FQ1A 4MQ4A 2ZT6A 3VR6H 2NSJA 4AYXA 4RMHA 1UMBA 4OJYA 3QXGA 4TLEA 4ZOLF 4JP8A 4LE1A 3M2PA 4RACA 2V7VA 4MUIA 2O8NA 4K40A 3EVFA 5J1TB 2HRRA 4H7DA 3BAZA 1HSZA 3EXIB 1YU9A 2J0UA 3C3CA 1JHOA 3QBVA 4YJGB 2UUAB 5CEEA 4NCIA 2G4CA 2BHNA 5HZKA 4P5EA 4ZAYA 1WPGA 1RLIA 3W1VA 1TZCA 1QDUA 5FUWA 3DA8A 2GZAA 3HFJA 5K0ZA 1VE5A 3FKSA 4UULA 1MH9A 5J47A 3QJ5A 4DKJA 2DTEA 2WKQA 3MHTA 3RJZA 1Q92A 1GCGA 4WGGA 4TWIA 4MRRA 3HEBA 4XPZA 3TIVA 5EHZA 2XWJI 2CGEA 2O2HA 1ONBA 1UPAA 4ZQFA 2ZWVA 1RBZA 3CUTA 1A97A 1OJLA 2J30A 2AUNA 2WM9B 3A14A 3KQYA 2A5LA 4MEAA 1P4SA 1Q1AA 1O94C 1UADA 3REFA 3L18A 4EG7A 4DV3B 5D6OA 2DM6A 3WKEA 5CFZA 2IBTA 1WM1A 5C7LO 4ZOCA 4YAUA 3CBGA 1KO1A 5JO9A 4YROA 2IOFK 3JQPA 1GR1A 4CIBA 1E1CA 2Z3WA 1XRMA 4WKPA 3ZE1B 4C20A 3LP6A 4EB3A 4EHNA 1YQDA 4DNQA 1H2HA 2QZJA 3GT7A 1PX0A 1WVIA 4QEDA 3ZPXA 4C06A 4K8RB 1P6QA 1T3SA 3LDHA 5DMXA 2J9RA 1EDZA 2R11A 2B69A 2O3TA 2WUGA 3DMPA 4ZCPA 2GYVA 3ZHVA 4XEUA 4B84A 5E4JA 4QT4A 3G8YA 2UYQA 4TRMA 1RU3A 1GGNA 2DKFA 2XMZA 2H3EA 1O6GA 3K4HA 5KQRA 1NW6A 5DBEX 4BU1A 1EUQA 4M0DA 1TJ4A 3Q72A 3JR3A 2AOTB 4Q21A 5HHTA 3N9IA 4BRUA 2C5AA 5IJXA 4LXXA 5CDYA 4D0NA 5AUNB 4M9SA 4RK5A 2JGFA 2O6HA 4HD8A 2DT8A 3NIFB 1GVNB 1MO6A 1U1DA 1XUOA 2F43A 1WCIB 2GJSA 3FPSA 3AUTA 3NGLA 4DCCA 4EAAA 1AX9A 5THKA 4YRGA 1Q0TA 4WZBE 1VPWA 1XMPA 1FCJA 2QW0X 2P9FA 3DTVB 4TTPA 3B2QA 4YQYA 1OU0A 2DFVA 2AXQA 3JD4A 5EYPB 5HCNA 3F6RA 4DABA 1Z36A 2EKBA 4OL9A 4OQFA 5A7FA