5FUYA

Catalytic domain of thymidine kinase from trypanosoma brucei with dtmp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
181
structure length
165
Chain Sequence
HGRIELIIGPMFAGKTTELMRRVQRHKHAQRSCYIIKYTALTANVSVSNLHDVGDEWRKYDVIAVDEGQFFPDVAAFCSKAADSGKVVIVSALDADYLQEPFEEICLLVSRADSVVKLSAVCMECHNRKASFTYRTVKSDERKLVGGSDMYMSVCRSCYETKRNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords THYMDINE KINASE
publication title Cell Cycle Regulation and Novel Structural Features of Thymidine Kinase, an Essential Enzyme in Trypanosoma Brucei.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transferase
total genus 52
structure length 165
sequence length 181
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2016-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 5fuyA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fuyA01
1QVAA 2UKDA 4QHYA 2QAGC 3ZS8A 4A8JA 3GLIB 4ZCMA 2J7PD 3HPRA 5KOYA 2ORVA 4JSYA 1XXHE 3RC3A 1FL9A 1F6BA 3E2IA 4RZXA 2ZRMA 4EJSA 2ZI9A 4OHVA 1BMFD 4AKGA 3KUCA 1FUKA 4Q4HB 4GRAA 4KITB 2ZJAA 3DPUA 4LYFA 2V54A 3LVQE 4JLMA 2VF7A 3THOA 1EFCA 3HYRA 4TMWA 2WBLC 2ANCA 1WRBA 2A5GA 1NY6A 4JKYA 5FOUA 4C0QC 2ZYWX 1OFTA 2JLZA 2GWHA 3QEJA 2A2ZA 4HDCA 3U3MA 5IF9A 2F3TA 3AKDA 2ZI6A 3QI2A 4EFLA 4ITRC 1JPNA 4AYTA 4NH0A 2QP9X 2YV5A 1CR2A 5GJCA 1GILA 3QBVA 1MO5A 4HI0E 3TRFA 3GJ5A 2BDTA 3ZVMA 4K46A 2NZJA 1VPLA 3RHFA 2J0SA 3BS4A 1Z5ZA 5CB8A 1O87A 1BIFA 1E9FA 3AKYA 3GFOA 4EPVA 3EWSA 4D6PA 2VP2A 4ZKDA 5LPNA 1OSNA 3H1TA 3PUZA 1KOFA 1DAKA 3I8XA 4PHGA 4A9AA 2J0VA 4R98A 4RD2A 3AF2A 4P4SB 1U9IA 4RZ3A 4B6FA 5EUQB 4WZBE 2VHUA 1V5WA 4LBYA 4L8GA 3KQUA 1N6RA 1IN4A 1S3SA 4Q9JA 1NVXQ 2W6JD 221PA 1ZD8A 3CPHA 5FPHA 2E87A 4L5BA 3MMPA 1DAIA 3T61A 1H8HD 4M1SA 4JYCA 2O0JA 2K5UA 2ZTSA 1BKDR 2RGAA 4I1VA 2DB6A 1YRAA 2YOGA 4IXNA 3RABA 4YMTA 3H0KA 4EFNA 2VRWA 1JR3E 4ZKEA 5JSZA 2XOKD 1XEXB 1Z3IX 3L2OB 2QL6A 4V0KA 2X1VA 1KO4A 2ZRBA 2WHXA 2NGRA 1M7BA 5IRCD 2CVHA 4MRPA 3GQBA 3IHWA 4D4JA 2IYZA 1GVNB 4PHHA 2GVZC 4HSEA 3DKPA 4LJ4A 1OXUA 1HY3A 5KNBA 3SU8A 3ND9A 1W36B 4D25A 4IKEA 3WP0A 4HLUA 2J3EA 3IIMA 2PCLA 1ZM4A 1P2TA 4V0MA 4YQFA 1SULA 2G6BA 3HYTA 3R9IA 1EX6A 3KTAA 1PTQA 5UKDA 2O0HA 1TPZA 4PC6A 2RAPA 3WMGA 1OH7A 3AUYA 2C77A 4M1OA 3LDAA 4L15A 2R8RA 3VR1A 3B78A 1WDTA 1AS2A 2A78A 3VTKA 3QPWA 3BE4A 2JA1A 3NWJA 1PLJA 3D8BA 5FBLB 1E2DA 3CIOA 1OH8A 4KBFA 4UQOA 4B73A 1U8ZA 4BLSA 1W4CA 1IJFA 4A6XA 1TQ2A 4E5UA 2X77A 3FWYA 2KB0A 2PZFA 5L8VA 1KDTA 4FWIB 2ELIA 3UXMA 4PX9A 2OO7A 4Q4LA 1Q1QA 3GJ3A 3NVAA 4JBWA 3A1UA 2PX0A 1T5IA 1JALA 4LJAA 4DDTA 3BJIC 4KJZA 5H70A 4HYYA 4HDOB 3UPUA 4NKRA 2F9MA 3EPJA 2AR7A 2ZXUA 3T34A 1KIMA 1SXJE 4C0BA 1NLFA 2ZS8A 1CKEA 2CK3A 4OJQA 5CYPA 2NPIA 2Z0MA 1FMLA 4QL3A 3KXKA 4TYQA 1QG2A 2FNAA 4C0HA 1NN3A 2DYKA 3HR8A 3L82B 1AS3A 1X6VA 1COWD 4GZMA 5EZ6B 1UPTA 4Q5IA 3X1YA 2FPKA 4FMCB 2O52A 2YKGA 2JDID 2D4HA 1TEVA 3ZH9B 5LD2B 1T6NA 4A15A 4AC9A 1A7JA 4FI3C 1N6IA 1Z2CA 2CJWB 2J46A 2WOJA 5B58C 1T8TA 1Y3AA 3GJ0A 4LJ8A 2NPFA 5K8UA 1FNMA 5FTJA 4DIEA 5CK5A 4GFDA 3A6PC 2OSBA 1U90A 2JLVA 1S0UA 2ZIAA 2A7QA 2MMGA 3KUDA 4Y0VA 3WBJA 4DLTA 1D2EA 3GJXC 4PZLA 5EQTA 2G0TA 5GJVC 3EZFA 4BFTA 2L0XA 3LX5A 2FSIA 2OESA 2ZRKA 2OG2A 3EIQA 4DLXA 3TSWA 3K8YA 1KI4A 3LO5A 5DYGA 4V03A 2IF0A 5HKKD 2ZETA 2IXEA 3VNVA 5A4JA 3SBDA 2ZI4A 3JVVA 4PQRA 3ZZTA 5TDHA 2DPXA 3RRMA 2GEUA 1KBFA 3GFPA 1KZGB 1P75A 2KI5A 4V02A 2IYLD 3K0FB 1G5RA 3WNDA 2OBMA 2ZR0A 4CW7A 1KYIA 3HWSA 2OCBA 2DWPA 3Q7PA 4FCWA 3P27A 3K9GA 5ELXA 2GA8A 1ZM2A 3TGPA 3Q8XB 2QBYB 4NYIR 2G9NA 3EIEA 4JJZA 3RRYA 1KAOA 4ILEA 5BN4A 2DR3A 2JJ8A 3K0CA 1E9SA 1E98A 1CULC 4UXJA 3FMOB 1N6KA 4TTQA 1KDRA 3I5XA 2GCOB 4S2EA 4CIDA 1P2SA 4KU4A 1XBTA 3TSZA 4OL0A 2IYRA 4XD7D 1GRQA 3TKLA 1S3GA 2OFOA 2UVQA 3A37A 3EC1A 2IC5A 4LDJA 3N2EA 5JWHA 1KO8A 4MA4A 1Q1ZA 3QG1A 2IYXA 3UMRA 2CE2X 2G3YA 1ELOA 3A4MA 3BOSA 1NVVQ 2CLDX 4EDHA 2FSFA 2AX4A 2P2LA 5EJEA 3W8NA 5AJVB 2R6DA 1F3OA 1X8LA 2LKDA 3I4LA 3PIRA 2NIPA 1W4RA 2WJHA 3K0AA 2F1IA 3CM0A 3CRVA 1PZNA 2BEJA 2WWIA 5G41A 4IFEA 5FOVA 2WPDA 1OXVA 1XTJA 5SZHB 5CM8B 2PZGA 3TSOA 4DCTA 2VP4A 1HA3A 2GZAA 1OFUX 3NHBA 2WKPA 1G3UA 5IDVA 3GD7A 1X1RA 2A30A 2ENNA 1UFQA 3TLXA 3WYGA 3GLFB 2W58A 3QG5A 3UKDA 4D4LA 4Z1MD 2UZ3A 2EFHB 2OV2A 4QM7A 2WWWA 4I1OA 5EXXA 1AN0A 3R9XA 5L3SA 4AI6A 2IXFA 1W4AA 1E2MA 5KSPA 2IHYA 4IEEA 1FX0A 2F43B 3B9QA 4RCZA 3X1WA 1G3IA 3WYAA 5EE5B 4NCIA 1SVKA 2WSSA 4U7DA 1JEEA 1Z6GA 3GLGA 4NONA 4B2IA 3U7GA 1OIVA 5B64A 4PHFA 2X2EA 4NCHA 3O8CA 2GKSA 2E73A 1E6CA 2YINC 3KJHA 1GIAA 3IHLA 4KFTA 4Q9HA 1Z0AA 2ZSFA 4BFYA 1YR7A 2VH5R 3AF0A 4WIAA 1B0UA 1YZNA 5ANRB 2W2XA 3I72A 3QKRA 5AK0A 2EFDB 4OQLA 2V8OA 2ZRCA 4JT4A 5SZKB 5EP1A 1W47A 4DSUA 1VTKA 2CVFA 2GBLA 1LVGA 4LGMA 2XB2A 3GLIA 1EFRA 1NNEA 1N0UA 2ERXA 4WAUA 2P3SA 3NH6A 2YNMA 3SNHA 3V9PA 3LXRA 3SYKA 2ZRFA 2ZQ5A 1W5SA 5JMTA 4OHZA 4Q4HA 1Z6YA 2BHRA 1GSIA 5FH9A 2ZRJA 4D81A 3SJBA 3BH7A 5C2JB 4A36A 3B82A 1UADA 4QNMA 3NBXX 4X8OA 2ZUCA 2P65A 2VSXA 4TLCA 1Z0JA 2JASA 2BBOA 4DBLC 4B3CA 3AH8A 5AUQA 4FMDF 2CDNA 4TT3A 1Z2AA 4IHQA 5C18A 1ZNXA 4MDEA 3E5HA 2PZEA 1CJMA 3TQFA 1TBNA 5FUXA 2DWOA 3RS3A 4GDFA 5DHFA 3V00A 3U61B 1NSTA 4DZZA 1G7RA 2JEOA 1GDDA 3NBFA 4NHOA 1EGAA 3QPUA 4FKDA 3QE0A 3DVLA 1Q3HA 2QY9A 4NYMQ 1DPFA 4M2LA 3MWKA 3L0PA 4B44A 4P4SA 2XJ4A 4PHTA 3O8DA 1NBMD 2WMOB 1R0WA 5SZIA 4LHWA 1S9HA 4FCVA 2PBRA 5JLJA 1OPXA 4TYPA 1PLKA 2Q6TA 4KVGA 3K53A 3FOZA 3IIKA 3BORA 4DEYA 2HEIA 3LY5A 5FFMA 1FAQA 3LAWA 1N6NA 3WNBA 3KDSE 5JSZB 1SGWA 4KHZA 1CRPA 3B8HA 1HQYE 1HURA 1QF9A 1FQJA 2XEXA 1V43A 1DO0A 1XEXA 4N1AA 4PC1A 1Q21A 3FMPB 1P7CA 4Q9LA 3I8SA 1X3SA 4Q9IA 1VDZA 4PSKA 2KE5A 2WJGA 3I32A 1EX7A 1HT1E 4P32A 2MSCB 3IBGA 4LC1A 4Q00A 3WMEA 3ZIAD 5JJIA 2V55B 1IBRA 2C78A 4P3YA 3T1OA 1Q12A 1S8FA 2F3RA 1EWRA 2C96A 5CIWA 4HATA 3GEEA 2BCJQ 1SVWA 4Q1DA 3PJRA 1ESNA 1E0JA 3D31A 5DISB 1BH2A 1J8YF 1EK0A 4AWXA 3QBTA 2C2HA 5HTKA 2GVDC 4A0GA 3NXSA 2ODEA 3PEWA 1ZCBA 4HAWA 1ZINA 1WBDA 1DG3A 2GK6A 3F3YA 1HV8A 5KDLA 3CKLA 4M9SA 1Z0KA 1W0JA 3SEAA 1Q22A 2JJ1D 2ZU0C 1UKYA 2OCAA 3CNLA 4I99A 2VSOA 3REFA 2Q9CA 1P6XA 1KMHB 2RHMA 4RD3A 2VP9A 3A8TA 3FGNA 4ESVA 1E1QA 1DE0A 1GFIA 4DVGA 2V7QA 2O8BB 1NI3A 1FPMA 4JLDA 2IS1A 2QQ0A 4B74A 1ZRHA 1M7GA 5CB6A 3MUFA 2J5XA 821PA 1KY3A 3P4XA 2NO0A 3K09A 2KWIA 1XXHB 3W3AA 4TMZA 3WRXC 2IHBA 1CJKC 1KNQA 3MWJA 3UGLA 2OFXA 1EFUA 1GNRA 3AP2A 2Z5FA 1T4GA 3EZ9A 1KY2A 1KO7A 1Q57A 4QC2A 1NVUQ 2PH1A 2HYDA 1KAGA 1NG9A 3P20A 3ND8A 2CLCX 3AGPA 4UNSA 5G3YA 2H8KA 4ZI2A 3Q85A 2XTNA 4HLDA 1KI2A 2CJWA 4DLYA 1HQCA 4LI0A 4H9GA 4W5JA 2WJIA 5F2EA 2R9VA 4JVSB 4LX0A 1Q20A 3QSYA 2A5JA 4TL9A 1GTVA 1P73A 3N70A 3GMTA 4Q48A 3H4MA 1VIYA 1OJLA 4M53A 3VMFA 2ZM5A 2YWGA 2CNWD 3C14C 2GF0A 3C4JA 1OIXA 4BEBA 5IHPA 4M9ZA 3IILA 1UEIA 4DHEA 2P0EA 2WJVA 3ADBA 4G1UC 5C1BA 4PAMA 3FMIA 1FUUA 4ACBA 1SVMA 2BMEA 4P33A 3SYNA 5LD2C 2C8VA 2Z43A 521PA 1E0KA 1GG2A 5DSZA 4MUBA 2YWHA 4OK3A 4QHSA 3CONA 1W2GA 2JIZA 1XJCA 4US2R 3VX3A 1F2TB 3K0FA 1G4UR 2ASEA 1XMSA 4GZLA 4M8NE 3L0OA 2WSMA 1T8UA 2C9YA 1T3SA 5F9HA 3NKVA 2ZJ5A 1O3YA 2ORIA 2DBYA 4GBMA 2SHKA 3ASYA 2X2FA 2WAYA 4M22A 3UANA 1X8JA 1VCMA 1ZC4A 2ZUBA 1MRSA 3RAPR 4KSCA 3NH9A 1TL7C 4D4KA 4PAQA 3NC0C 4Q1AA 5EUMA 1JJVA 4DT1B 2GCOA 1VG0B 2R2AA 2H92A 2EWWA 1KNXA 1Z22A 3PG5A 4UXHA 3T5GA 1ESMA 3ZLJA 3UGDA 1N0VC 3AB3A 3KFXA 3PXGA 4Q7KA 2C9OA 2QT1A 1XNJA 4QRHA 1NY5A 1U8AA 1L4UA 4LPKA 3UG6A 1AIPA 2VTKA 1HH4A 3B9PA 1IONA 3K0AB 1NL3A 3KY9A 3HU3A 4G5QA 5AJWA 1G8YA 2XZOA 5AUOB 3PEYA 2XJ9A 1L4YA 3WP1B 4AG6A 1Z07A 1NVVR 3EZ6A 1CJUC 3EZ7A 1I2MA 1KMQA 2GNOA 3UMSA 3G0HA 3PUYA 1PUJA 4RD4A 5FUYA 1TUEA 4MRNA 4BZQA 1FARA 2IS2A 2KBFA 4D0NA 1TMKA 2VA8A 3EPLA 3ICQB 2GJSA 2ZS9A 4D26A 2XZPA 2W2TA 1AKYA 1PTRA 1SVSA 3K9NA 2CK3D 1UKEA 2JLSA 2VPPA 5BWMA 1TU3A 1VYTA 2ZR7A 2GDJA 2W00A 3NBZC 5G53C 3SJAA 5L3SB 5KHOC 3FDIA 1W0KA 4S35A 3AVUA 1Z0FA 1IY1A 4LCBA 5BN3A 5BYKA 1FX0B 1CP2A 4TLEA 4LJ5A 4GSYA 3IUYA 1SXJB 3U3OA 1E2NA 2ZJZA 3OESA 1AS0A 4TL6A 1DG1G 1N6LA 3BBPA 1DAHA 4E09A 2HF8A 3B1YA 1J90A 1XD9A 4WBSA 1QVRA 4PQYA 1E9DA 2RB4A 3FB4A 1G20E 5FOWA 4MGIR 1K8RA 1WA5A 2GRJA 4U02A 4C0SA 5KNDA 2ORWA 1Z06A 2Q3FA 2Z4SA 3A58B 4YDSA 4EAQA 1US8A 2PX3A 3LW8A 4LWZA 4Q47A 1QHSA 4JSTA 1G3MA 3FTQA 2GAAA 2ZRDA 3QOFA 4US0R 1BYUA 3OE7A 1W49A 4AYXA 5CK4A 2BWJA 1E2LA 4RKFA 1XCGB 2EYUA 4GT1A 1R8QA 1RRCA 3SJZA 3VR2A 1W7AA 4YMVA 4DDVA 4CRWB 2J0QA 1JEDA 2UZIR 2C04A 4WXRA 2G77B 3HP1A 2ZE8A 3QQ5A 2IYWA 4MDFA 1OT3A 1CF4A 2GCPA 2HJGA 1P2UA 5TMPA 4CDGA 2PMDA 3L43A 3UIEA 2D3WA 3CRW1 3LQRA 4N3NA 1ZU5A 2CHQA 2JAQA 3KB1A 3MWYW 4XIGS 1BS1A 5CDFE 2FF7A 1FMJA 3KQKA 3ONWA 1NRJB 2DFNA 4LJYA 4B6EA 4WOPA 2IT1A 4RZ2A 2NO6A 4BUJA 4RY2A 3VU9B 2PLFA 2BKUA 3IKJA 5EP4A 1E4VA 3CWQA 4F4IA 3A36A 4A8JC 1LF0A 4PZYA 2LWIA 1OHHA 2CL6X 2V6IA 2ZJ8A 4OBEA 3RWMB 1AGRA 1E9AA 3CH4B 1LS1A 2CBZA 3OAAA 2Q0HA 5KU1A 4EJSC 4F92B 4R9UC 1CBUA 1P4SA 2QA5A 1NIPA 4US1R 2BV3A 3Q9LA 2R6FA 1RRFA 4QGHA 1MOZA 3C5HA 4YMUA 1GL6A 4M9QA 4LJ9A 3VR5A 4OK6A 3KKNA 1G19A 2FZLA 1K5GA 3SFVA 4A0RA 2GF9A 1A1VA 5CLLA 1JPJA 3KQNA 4JLBA 721PA 1YJ5A 1U0JA 4QGGA 4KFRA 5J4KA 4MYTA 4M4SA 1IQPA 4NYMR 3AQ4A 1JQLB 2FEOA 3OEEA 4MRRA 4M0LA 4OJKA 2GXQA 4PQFA 4Q4AB 4R2IA 1KI6B 3LD9A 4C30A 1NF3A 1FQKA 4TL7A 2VP5A 3BFXA 5P21A 4HB2A 1JECA 2XB4A 1KGDA 3K9LA 4BLTA 4BFZA 4RKEA 2DFTA 4B35A 4LSGA 1KSHA 1WXQA 3L8ZA 1F60A 3QKSB 3KXIA 2QT0A 4TN1A 5FL7A 3B6EA 5DN6A 1CXZA 4CT5A 5E7IA 1E9CA 1U9IC 1DO2A 1M2OB 4NCNA 1S1MA 2ENZA 1P5ZB 1R5OA 2EQBA 3PUVA 3DOFA 4WXPA 3R8FA 2VP0A 4G5SA 2NO9A 2B8WA 3OEHA 2WSSD 3QF7A 2CCKA 2QTHA 4Q18A 1WP9A 1VMAA 5FPYA 2GXUA 1G21E 5H68A 3VKWA 4A2PA 4G5RA 5K8LA 3UWOA 4MQBA 2I1QA 2QSZA 4WA7A 4TTPA 4ERNA 1H65A 1XMIA 2ZRGA 3B1ZA 2DFLA 3M1IA 1RRGA 3ZVNA 4GOXA 1MH1A 2ZE6A 3ZD6A 3A4NA 2V1XA 4TSFA 3T06B 1YZTA 2ERYA 4CF7A 2IA5A 1T5LA 4IW3B 4JL8A 3CR8A 3T12A 1R4AA 2PT5A 2CXXA 4BE7B 1R2QA 2FDCA 1MV5A 4BWYA 1N6OA 1NP6A 4URUR 2JJ2A 3NEJA 5F9FA 1II8B 1EFRD 4HLUC 3GEIA 1LTQA 5GJWC 1KMHA 1A2BA 1N6PA 3DM5A 2IEYA 3L8YA 2FPMA 2O8BA 3GCGA 2ZU6A 1KK2A 4M1YA 1XD8A 5KYKA 3KKPA 2EFGA 1NLYA 4O3MA 4BZPA 1BO6A 4PO8A 2I4IA 1JJ7A 4O0MA 4YMSA 1XXHA 4EPXA 1A4RA 1GWNA 4LBWA 1UBFA 2ZSBA 2FJUA 1N25A 5DNYB 2FH5B 3A4LA 4F38A 1AQUA 2IYYA 2HT6A 3N2IA 1E2IA 3AVVA 1P9WA 1VHTA 4TT3D 3CZPA 3PVSA 3TVDA 3UMFA 4M9XA 3U7FB 1AGPA 1RKBA 2NOAA 2BOVA 1G5TA 2AKYA 3FFBA 4Q1EA 5FPTA 5BXQC 2OAP1 4FWTA 4DKXA 4YMWA 3IIJA 3U3JA 2V9PA 2XX3A 5AWFC 2QGZA 1KJZA 3I73A 1E2FA 2CMKA 4AKEA 4BFWA 2R44A 4OQXA 1IXZA 2VL7A 1GITA 2RGXA 4V0LA 3OFND 5JRJA 4QNRA 1YVDA 5L3RA 3U2QA 4NYJR 3MJHA 3SYLA 3LLMA 4Q1BA 1CR0A 1DAMA 3W6PA 1T0JB 1ZM3A 2GZHA 3ZVLA 2CEAA 4HEJA 1NKTA 2RGGA 2IWHA 4KO8A 4HZUA 2FPLA 4YONB 5J4VA 3IPYA 4D82A 4N0EA 4TYWA 4JLJA 4DLVA 1ZYUA 3CNOA 5KSZA 3FMFA 2P5TB 2W6IA 3B1VA 3FFAA 3BC1A 2DY1A 2FSGA 1YU9A 1G8HA 4TL8A 4B43A 2J87A 3MD0A 3AGQA 5K8TA 1G8FA 4MGKR 1R0XA 3QNUA 3A1TA 2ZI3A 1F2TA 4BZXA 4C4PA 2YOFA 1EESA 2AWNA 4B48A 2GETA 3GLHE 1KI7A 2BMFA 1KK3A 1JR3A 4P4UA 2MSDB 2LCFA 5FOTA 1DADA 4IOMA 3TIFA 1QZXA 1W36D 1IM2A 4DCNA 3TW8B 3U6BA 4IRUB 4NCJA 2GJKA 2KJQA 1BMFA 4G5OA 2D7CA 1GOTA 1J8MF 2ZJYA 4AURA 2P6UA 4YXWA 4II7A 2IUUA 5JECA 2WJYA 4DT1A 2IYUA 2WJJA 1OKKA 2OCYC 3CF6R 1CJTC 4QBFA 2R6GA 4EKDA 1WMSA 2HYIC 2EU8A 5F98A 3EPHA 4EUNA 3FKSD 5KDOA 2FV8A 1ZBDA 2NO1A 5TVKA 3LRPA 5JCZA 3P1JA 3QKTA 2BMDA 4PC2A 2CLSA 3ASZA 2AXPA 1GRRA 4TMVA 5JJLA 4IJMA 2W0MA 1RYFA 3TK1A 2O8FA 1G6OA 3AVPA 2ZJOA 3G82C 4LV6A 4G3XA 4IVPA 5EE9A 1M34E 1IAQA 5GADl 4DCSA 3O8RA 2YHSA 1N5KA 1U0LA 5FI1B 6Q21A 4GMDA 3FYHA 3WXMA 3K0CC 1Q3TA 2H18A 5TARA 2V7QD 4OI0A 4R71A 5DI9A 4TMXA 1OYWA 3TMKA 3U4QA 3TQCA 4HB4A 1XTRA 1KDPA 3WY9A 4TQUS 2PT7A 2OT3B 2WAXA 4HLCA 1T91A 1IN6A 1HE8B 1AK2A 1XB2A 1MABB 3DZ8A 3AKEA 2DFKB 4BFUA 2QRZA 3EG5A 2JGNA 1R0ZA 1T9HA 2HJVA 4X8MA 3RSOA 1OF1A 1XDBA 2JLRA 1UBGA 3NDPA 4JL6A 4BFSA 1OFHA 3UWKA 3BD9A 421PA 5CLQA 4XWKA 3THXA 3BB4A 3NEYA 1NMYA 4GP7A 2QQEA 1R6BX 1SXJA 2ONJA 1J2JA 2VHCA 3RS5A 2ZYTX 4LK2A 5D3QA 2DB3A 1IY2A 4C7OB 2KBEA 1RRPA 2FA9A 3NC1C 2WIAA 1ZC3A 1US8B 4ZDKA 5GVSA 3BIFA 3B1XA 4C0JA 4C3ZA 1XJQA 4PANA 4IDQA 1L8QA 3BFKA 4ASUA 2O5VA 4BLOA 2YC4C 2GEVA 1IXSB 1L2TA 4ZIRB 2ATVA 4DSTA 1E96A 4FXPA 2P67A 1U98A 1CR4A 4I4LA 1IN5A 4TMKA 1CRQA 4Q66C 4QHTA 1GL7A 4F4JA 2BC9A 3LVRE 1SZPA 4DUGA 2WTUA 1ZM9A 3CX7A 4KLZA 4B34A 1XCMA 1HEIA 5JHGB 4AKHA 5FTKA 4EIWA 1FNNA 3A1SA 3U44B 3A1WA 1NIJA 2YYZA 3U7HB 2FN4A 3BH0A 2EFEB 1CJVC 3TUIC 2JIZD 4HAVA 1P72A 2HLDA 2AHOA 2W2VA 1KI1A 3IBYA 1NN0A 4Q9KA 2CE7A 5FOSA 2VQSA 3CPJB 1NN5A 2A5DA 4HAXA 5FPSA 3TJZA 3BERA 4MKIA 1UDXA 2A3RA 5BW8A 2BMJA 4NE2A 3DKVA 4G01B 3Q5EA 1FP6A 1Q44A 4JVMA 4ZO4A 3VU9A 4CZ2A 4FN5A 3ZZ0A 3ICEA 1KJWA 2VP6A 1G6HA 2GBLC 3DL0A 1KK0A 2ZANA 3GLHA 4TLAA 2AD1A 4I1UA 4I81A 2QORA 4UNRA 1R10A 4OQNA 5JI2E 4GPTA 4DDUA 3AV0B 3EZ2A 2C99A 4AD8A 1MO3A 2IS6A 1ODFA 3OIUA 3DEFA 2OLKA 2BM0A 2RH5A 4UNQA 1LY1A 1G7CA 2J7KA 2OE2A 1DARA 2BJWA 3IO3A 2ZI7A 5FTMA 1HE1C 3KQHA 2D7DA 2C03A 4DC9A 1MO6A 1ZNZA 1XP8A 3H84A 4DSOA 4KLNA 3O8BA 4L9SA 3SHWA 1F2UA 2V4ZA 3WHLA 4B3XA 1G1MA 4Q4AA 2ZAMA 1ZNYA 2A5YB 1KI6A 2RGEA 1I4DD 4KODA 5KO2A 3R7WB 2BBTA 2Q3MA 4URVR 1GUAA 1Z47A 3QIAA 3QXHA 3OIVA 4JMPA 1QRAA 1G8PA 2RCNA 3QKSA 3FHOA 3VHLB 1LF5A 1IJEA 2GTPA 1W0KD 2VYFA 1AA9A 5BYJA 3GFTA 2E9SA 2P6NA 1CIPA 5DH9A 1E69A 1G7SA 1XF9A 3SQWA 1EXMA 3NHAA 5EE1A 1HTWA 2IYSA 1TQ4A 1VYUA 2OBLA 4LBZA 1KSGA 4NP6A 3SQXA 3BFVA 3HU1A 1OH5A 2AFIE 1CLUA 1TF7A 4JKIA 4PR0A 3QVVA 3CZQA 4LZZA 4BRWA 4Q02A 4DCUA 3C5CA 1E9EA 3OE7D 4Z51A 1VHLA 2OHFA 2FGKA 1X8KA 1E2JA 3ETLA 5FBWB 1J7KA 2PEZA 5DHAA 5JHHB 2IXGA 2QMEA 2ZS7A 1K6MA 3D7MA 4XJXA 1R79A 3AUXA 4NDZA 2NO7A 3OIYA 4URWR 1LW7A 3WBKA 1W48A 4Q03A 3ZVRA 3IQWA 4B71A 4DLRA 2D2EA 4OHXA 3B85A 1W36C 1II8A 3ZJYA 5G40A 1NBME 4FMBB 3IPXA 3VAAA 2I3BA 4LV8B 4A2QA 3UK6A 1GRNA 2OUKA 3U60B 5HE8A 1OE0A 1E4YA 2ODBA 3KJEA 4L16A 2QZ4A 3I61A 4IEIA 1FZQA 1E9RA 4D0LB 5KSOA 1PVOA 621PA 4HAYA 1VG9B 4AK9A 4C0LA 2PJRA 4LV5B 4M1WA 4ARZB 2G1KA 1KK1A 1U94A 3BXZA 4GMXA 4WVFA 2E1RA 1R5BA 4QG7A 1OHHD 3T1VA 4D4MA 3UEJA 1F5NA 3OAAD 3PCRB 4PSVA 3RNLA 2FEMA 4EPYA 4ESHA 3QF4B 2XNSA 1TAGA 4NYJQ 2WMNB 3L0SA 3KJIA 2EW1A 2OILA 3W5IA 2RGCA 1JAHA 1YZQA 1Z28A 1X1SA 4Q4JB 2O8EA 4DLWA 3K09C 3F0TA 4F93B 3RC8A 5C46F 1HT2E 1TADA 2IL1A 3IO5A 3IDQA 1OB5A 3AVTA 3GJ4A 3SS8A 4IFBA 1XEWY 1YZKA 4POAA 4R7ZA 2XNDA 5AJXA 2GK7A 4QFMA 2R65A 2XTMA 1NN1A 4B2PA 1TTTA 3B7GA 4HZUB 4BASA 1TQDA 4DIDA 2EVWX 4H1VA 1DEKA 5BN5A 3RS2A 3C15C 3HPQA 1E1RA 5J40A 1KKLA 2OEPA 4FMCF 1KI3A 2B21A 2Z83A 4ON9A 2F1HA 4O2LA 1II0A 4C0KA 1S9DA 1M8PA 2FOLA 5FL7D 5IK2A 2WWGA 3RSLA 5DN6D 4M1MA 2YC2C 2FMXA 4HUQA 4MITA 1N6HA 4EPWA 1W44A 5HCIA 4HAUA 4HDQB 4OI2A 4QBHA 2KSQA 1FFHA 1X86B 2RGNA 3CO5A 1W4BA 2ECKA 2B6HA 4UNNA 4M1TA 3R8CA 3RLFA 3UG7A 2ZI5A 1G291 3OEHD 2BVNA 4HB3A 4ACAA 1RYHA 3AM1A 3KZ1E 3VKGA 2JATA 1OH6A 2ZAOA 4MYUA 2QNRA 2QTVB 4A6PA 2GAOA 4GOKA 4B2LA 1E2KA 2RGDA 2QPTA 3TR5A 4XOIA 1E2EA 2FFBA 1M6NA 3MSXA 1DELA 4TSFD 5AJYA 5EXTA 1NSFA 5L3QA 2Q9AA 3RANA 3TE6A 3W90A 2XZLA 1BOFA 2AD5A 1C1YA 4AIIA 5KTYA 2O8FB 5H8WA 4P31A 3CXLA 3S1AB 8OHMA 5M04A 3IQXA 4KYUA 1AJEA 1YHNA 1XPOA 2JJ2D 3M4YA 5B30A 1LV7A 4TQAA 2X19A 1OXTA 4IOKA 3LW7A 3U4QB 4KYIB 1ZD1A 2QE7A 1C4OA 2PLRA 2C5LA 4D0GA 1I4LD 2Z4RA 3F5FA 1MR3F 1RW4A 3KKQA 3PV0A 4Q1FA 3SZRA 1XMJA 2R62A 4TMTA 5EE0A 2DCUA 3IEUA 5CYOA 2PCJA 4DXAA 1FW6A 1QHXA 4OI4A 2HDNB 2QPAA 4JS0A 4NBSA 1MABA 5CJPA 1S1CA 1OIWA 1UBEA 4KSBA 3JZAA 3THXB 1W5TA 4B47A 2GXAA 3K70B 4KXFB 2N42A 2O0KA 4MKHA 2QGNA 2GVIA 1R8SA 1VG1A 1MKYA 3GJ8A 2BBSA 1SKQA 3KXLA 2WWYA 3X2SA 2ZVPX 2FG5A 3Q72A 2AL7A 3SI7A 4C7OA 1SKYE 5KUTA 3J81k 5SZJA 2CHGA 1RPZA 4PZZA 3UEYA 4V0OA 4C0AC 4V0ME 1AZSC 2BKEA 4ZPXA 4BGDA 4YLGA 2IW3A 2ZREA 3TH5A 4FCTA 4FW9A 3CWZA 4ZIRA 5HR5A 2F55A 2H57A 2QAGA 1JBKA 1U81A 3EIHA 2QM7A 3CLVA 4PC7A 1DAGA 2F6RA 1SVLA 3CX8A 3VFDA 2YUUA 1P3JA 1RJ9B 1NKSA 1SHKA 2AK3A 2AKAB 2NG1A 3QPVA 5JFGA 5JBQA 3CNNA 3MCAA 1T0HB 3IEVA 2VO1A 3LWNA 4EQ6B 3U44A 5KPDA 3U7EB 5DI3A 4TZ6A 1FOEB 1XZQA 4C2TA 5LBIA 2BEKA 2ZROA 1IN8A 4FMDB 3LA6A 2WKQA 4CT4B 3LBHA 3QKUA 3TVTA 1JR3D 1QHIA 2OCPA 2XXAB 5JI3E 4O2RA 4GNKA 1XU4A 1E99A 4CEHB 3GJ6A 4JJKA 4RSGA 3RDPA 1KO5A 1QHYA 4JLOA 4TQ9A 1TF5A 4LJ6A 1CTQA 2EYQA 3GP8A 3HR7A 3GLHB 1DAEA 4OKSA 2A5FA 2VEDA 2YWEA 2REBA 4YXWD 1WF3A 3E70C 3OHMA 4L4UA 4P4TA 3FHCB 1G8GA 4QJ3A 1M74A 2ZR9A 1OKKD 1WBBA 1E2HA 3T15A 1Z0DA 2HXSA 1NLZA 2J0UB 3B2EA 1ZNWA 4PSAA 5BQ5A 2FE4A 5HCNA 1OLOA 1S2MA 1IXRC 4BPBA 3EASA 3BK7A 1KZ7B 2DHRA 5JWOA 3LH5A 4WZ6A 3ZS9A 4TWZA 1GM5A 3H2YA 2N1BA 4Z8YA 1J99A 5FTLA 1FTNA 3THWB 1A5TA 1F2UB 1XD2B 3BAFA 4TZ0A 2WPDD 4AYWA 4KBGA 2ZE5A 2AFHE 4A0FA 1XWIA 2GHIA 4LHZA 2D06A 4ZI3A 1J70A 1GKUB 2WV9A 1KSJA 1AKEA 2HUPA 4B3FX 2WOOA 4PXAA 2MMCA 3R7WA 2WVJA 1SHZA 2AK2A 1GP2A 2NTYC 1L7VC 1XEWX 1H8EA 4LOAA 2N46A 2H16A 2IYTA 4IDNA 1G16A 3RRNA 1TQ6A 3SDZA 1N5JA 5CITA 1U0HC 2NMVA 1Q1BA 1KBEA 3AF4A 2CNWA 3EWAA 1MRNA 4UNPA 1M7HA 3K70D 2VHQA 1KI9A 3T1TA 1SXJD 5KSYA 1B23P 3DM9B 2HF9A 2G1JA 3AKCA 3MLEA 4XSGA 4MRVA 4LJ7A 3ZYCA 1ONBA 3HU2A 4B6DA 4QXAA 5EP3A 2WM9B 2JLYA 1DOAA 4B75A 4YDHB 5E95A 5TXGA 4TLBA 3ZGXA 3SN6A 3P32A 2OZEA 1Z08A 4ASUD 4JLNA 1EG7A 3R9WA 4DSNA 1LB1B 4MH0R 2NQ2C 3CF0A 3DMDA 5JS8A 4JBYA 3C8UA 3T5DA 2IUTA 2GILA 4YC7A 3Q5DA 3KFVA 1SQ5A 2B7CA 2Q9BA 4DUGD 2H1LA 3TUZC 1IHUA 3VQTA 1CU1A 2J1LA 2ZSEA 3LXXA 3BJIA 4MKGA 4Q7MB 4AKIA 2HCBA 4N0DA 3PITA 3NDBB 2BIFA 3AF1A 3PUXA 1NJFA 4B32A 2HLDD 4PPFA 1D9XA 3LLUA 1TF2A 1U2RA 4CEIB 4A2WA 4NMMA 5KPJA 4IDPA 2B7BA 5JWRA 3I62A 3SBEA 1Z6TA 1XTSA 1AZTA 2WWHA 1NJGA 2YJTD 5AJZA 2JLXA 3LX8A 2ZRIA 2CL0X 4ARZA 1QHNA 3CF2A 4G0NA 3PFIA 4OK5A 1UDWA 4PO9A 4RVCA 1E3MA 1JAIA 5FTNA 4KFUA 5CIQA 2MSEB 2B8TA 1R5NA 1UEJA 5TV2A 3AVWA 5CDFA 2FSHA 3TW4A 2VBCA 4LHVA 5FPKA 2XSZA 1XPRA 3QF4A 3I1FA 5E3HA 1JR6A 2GEDA 5J4YA 4BLRA 3QENA 1OB2A 4BFXA 1E94E 1GZSA 4XVQA 2O8EB 1UM8A 4A1FA 3H86A 3GLGE 3MG9A 3RWOA 1G17A 4Q4JA 3T35A 1Y63A 4BLPA 2JCSA 3LBNA 1T3HA 3CW2A 1DTSA 3BGWA 5EXPA 1VCIA 3GJ7A 3DMNA 1RFLA 1YR6A 3LFUA 3FKQA 4IVQA 1E2QA 4NZYA 5DYIA 4DWJA 2WWXA 4JT2A 1E79A 1R7RA 2JLWA 1KDOA 4BLQA 4MUAA 4IVRA 4NU0A 4EPRA 2DWQA 4BRUA 1QDEA 2XAUA 5A5GA 4MGZR 5K8IA 1G18A 2RKOA 4MYHA 5LDDC 1Q0UA 2F1RA 3AP1A 1ZD9A 3WYFA 1G64A 2H5EA 1Y8FA 4HUQB 3C7KA 3GLIE 4AY2A 4LYHA 3X1DA 1JXMA 3F8TA 3LBIA 2V6JA 1P9RA 4LYAA 2H17A 2QROA 3CUEF 3PR1A 2PJZA 4Q19A 2VF8A 4HLQB 4UJ5A 5TY0A 1GL9B 5LB4A 2V3CC 1S96A 2VSFA 3TNFA 2QUZA 3TUJC 4XVUA 3LV8A 2QSYA 2J7PA 3LQQA 4CGZA 2WIBA 3RVBA 2OLJA 3OIWA 4GP6A 3AP3A 2IK8A 2O8CB 2IF2A 4DCVA 2QAJA 2GESA 4LHYA 4GI7A 4LHXA 1KO1A 2LKCA 4PPQA 4B33A 3CBQA 3GPLA 1IN7A 3KKMA 1TX4B 2GZDA 4L9WA 4QKQA 1AM4D 1LS6A 4QGAA 5L3QB 4V0NA 5H1YA 1RFHA 1W0JD 3CRMA 1D2MA 3MRSA 4XVRA 4TTRA 3THYB 1WQ1R 1GNQA 3M6AA 4PFSA 4J0QA 4Q1CA 1XCPA 2BM1A 3MWLA 4ZDWA 3UATA 1PV4A 2Z6VA 3B13B 2QG6A 2W83A 3S1AA 1OW3B 1T3LA 4PPGA 3RS4A 1XTIA 1OXXK 3CR7A 3SOPA 5HZKA 2XGJA 3ECCA 3I5YA 2ZSDA 1E1QD 3C41J 5JEEA 4KV9A 4ZDIA 3DHWC 4XTCS 3ADDA 1ZCAA 4M1KA 4PC3A 5HE9A 4W5HA 2G83A 1QHHA 1G9XA 4XSHA 1UKVY 1E32A 1YR9A 2QMOA 1KKMA 1Q1EA 1VCOA 1ZIOA 2AXNA 3B5JA 3AEZA 4OQFA 1G7TA 1XA6A 2OM2A 1GNPA 4RFSB 3MJRA 2J59A 2O8DB 5GJBA 2W6JA 3EXAA 5J4HA 5DGXA 3TBKA 2RGBA 4CVNA 3DDCA 2R6AA 2JLUA 3U5ZB 1H8HA 5D3MB 2REOA 2D2FA 1N0WA 2QMUA 4K8OA 1G3RA 1R0YA 4WZAE 4U00A 4DLSA 3REGA 4CEJB 2NZ8A 2XOKA 1NVWQ 3VX4A 3VR3A 4A82A 2D62A 1GKYA 1Z0IA 4E03A 2RMKA 1PUIA 4TYYA 2ZE7A 2Q21A 3BH6A 3NIBA 5EXSA 4B3BA 1IOZA 2H7VA 2D74A 1CR1A 2W0SA 3VR6A 4LRWA 1NMXA 3FE2A 4B3GA 3RS0A 1W46A 2QAGB 2XNDD 4GOJA 4K81B 1Z8FA 4NTZA 5F3WB 4LYJA 3UFFA 5L3VA 5E7MA 4LBVA 4MRSA 4DLUA 3IGFA 4PTLA 1N2CE 2YVUA 4UJ3A 3K70C 1PLLA 1ZJ6A 4URXR 2QN6A 1YKSA 4D2IA 1SXJC 3CB4A 5J4LA 1E1RD 1RJ9A 3TAUA 2BJVA 2ZRNA 2G0NA 3QXJA 4TYNA 4DEXA 4B76A 1K5DA 3VNUA 2GJAA 5DI3B 1ANKA 4UKDA 3WNCA 2JLQA 4Y0AA 4EQ6A 5EE3A 5C4MA 1ZW6A 5IK2D 2I1VB 4W9MC 3VR4A 2EWVA 1A2KC 5FUVA 4OHYA 3PEVA 1G3QA 3BB3A 2IUSA 3RRZA 1EFTA 1TEXA 1P60A 5AUNB 4MKFA 4A8JB 5J47A 4DJTA 1CS4C 2XXAA 4E22A 1ZIPA 3MFYA 3ZQ6A 4CEHA 3M0EA 5B2ZA 1FTSA 4LUCA 4TLDA 4HUTA 4EJSB 2P6RA 2IX3A 1E9BA 3DZDA 1DS6A 3PQCA 4O25A 4G5GA 5EZ5A 5FL3A 2YWFA 1QBKC 3HJNA 2FU5C 2CCJA 1DVRA 4RFVA 5FBVB 4ZCLA 2Y8EA 1MO4A 2XITA 2ZITA 3PUWA 1ZVQA 4OYHA 2QTFA 5KNCA 3KKOA 4IXMA 1XRJA 2J0UA 3CX6A 4FINA 1IY0A 2OXCA 4JBXA 4X8HA 5A0FA 4QGFA 2P5SA 1I4TD 1KSFX 2CL7X 2FGJA 4A92A 2HT1A 1COWA 4A4DA 1ETUA 1RVDA 4UXIA 2ZJBA 2JDIA 1E2GA 3THWA 1D2NA 2QE7D 1XD2A 3CRRA 4JZKA 3V4RA 3W8RA 5GVRA 5C4GB 1D6JA 2YZ2A 4PAOA 4JLAA 4CYMA 4EFMA 1ZUHA 1VCNA 4URYR 2TMKA 4OI1A 4X8LA 3ZD7A 1ZAKA 2CCGA 3C16C 4JLVA 4KFSA 1CEEA 1SVOA 3OFNA 5JCPA 2FX3A 3MAAC 3TAHA 4W5WA 2IBMA 2FWRA 2ZVQX 2IWRA 1OXSC 3UGIA 4Z8XA 3W34A 1VECA 3QVUA 2ZRPA 4NL4H 2FFAA 3CRQA 2QM8A 4R2HA 5J5CA 4ZV4A 2IYQA 5AUPB 1LFDB 1OFIA 4PO1A 2VRWB 5HKKA 1YZGA 1UF9A 2FFQA 4BECA 4XWAA 3QEOA 1W1WA 2QMHA 3I3SR 3P4YA 3W3ZB 1SVIA 4A0HA 3EX7C 3VHXA 5FI0B 3W6NA 3Q7QA 3NG1A 4B3DA 1Z83A 1XZPA 4BQSA 2F7SA 2FZ4A 2J41A 1E2PA 1ZU4A 4Q7JB 1VKJA 3BWDD 2WZQA 1SKYB 2XTZA 3HDTA 4I1SA 3ZQJA 3NTUA 3D3QA 5HPYB 1P61B 2VHTA 4C2UA 1ZM7A 2WICA 3VKHA 3KTAB 121PA 2OFWA 1RIFA 5FR2A 1JB1A 3OF5A 3PEUA 1YZLA 2HXYA 5B57C 3V4FA 1JNYA 2IS4A 4XD7A 1JXOA 1UBCA 1GKIA 5JRZA 2VHJA 3NBYC 5DLQC 1W2HA 3FKSA 3R20A 4EPTA 5FUWA 2ODWA 1WE2A 2QRNA 4H1UA 4CEIA 2G88A 1RC8A 3K1JA 3AVXA 3GEHA 2WKRA 2AWOA 1II9A 1YRBA 1E0AA 1ZUIA 1U99A 3DOEA 2J45A 4XWOA 5E4FA 1AQYA 1P2VA 3GLFE 1XMVA 4RD0A 3AVQA 3QJYA 4Q21A 4DB4A 2IEZA 4E07A 2PMKA 4Q7LA 5DO9A 1VG8A 3BB1A 2BCGY 4JLKA 2F1JA 3U3KA 4U5XA 3SJCA 4Z54A 3ADCA 3W6OA 4IDOA 1Z29A 1VYVA 2GJ8A 1TBOA 3AF3A 5HZHA 4Z1MA 2C98A 1N3BA 4IDHA 1RZ3A 4W7SA 2REXB 3X1XA 4IOJA 1I2DA 1HUQA 1XFAA 4F91B 5IT5A 5JS7A 1UKZA 2QI9C 5LB2A 1ZUNB 3WRYC 3N5CA 3FVQA 4L9MA 1OV4A 1YE8A 4HZIA 1PJRA 2ANBA 3OEED 4DRZA 4ZDJA 1N5LA 1TNDA 3E1SA 3QY0A 4FD2A 2OBNA 3B1WA 3KJGA 3SC3A 1Z63A 4C9BA 1FP7A 3W9YA 3ZZUA 1QHGA 1UJ2A 2ZRHA 3AVYA 4GL2A 3PENA 3ZDQA 3A1VA 3SHFA 1H8ED 3W5JA 1G5PA 3QUSA 3MGCA 2PEYA 1LNZA 2ZYUX 2OXRA 4KCGA 1TUIA 3D6TB 4RZUA 5AR1A 5FOXA 3CH5A 4KVAA 1WB9A 2J9RA 4MGYR 1DAFA 1M1YE 3B60A 3EA5A 1KI8A 2Q3HA 1UAAA 4QM6A 4RD6A 1N5IA 2C9CA 1Z6AA 3LNCA 2RHDA 1E0SA 5CM9C 1BYIA 4QBIA 2FFHA 4RD1A 2OAQ1 2O8CA 2ZSAA 4NYIQ 3SR0A 3AVOA 4D80A 1VIAA 1RE0A 3K0EA 3WMFA 1P9NA 2C95A 5JJKA 2YOHA 1KTVA 1G4AE 1MT0A 2QPOA 2VIIA 1A82A 4JVLA 3THYA 2QBYA 2X8AA 2RGNC 4XTRA 4HAZA 3TR0A 2ATXA 5DE3A 1NMZA 4JL5A 3OZXA 4QJ5A 4MYCA 4DLZA 1YR8A 3L0IB 4DB2A 1WCV1 5KDDA 1GAJA 2CHVA 4AG5A 1XX6A 2VLIA 3EA0A 4HB0A 3FHTA 1ZP6A 1QHHB 1HYQA 4NPHA 3U6KA 3SE0A 4URZR 4XH9B 3G5UA 4JVNA 4FIDA 2R6CA 3RYTC 2A9KA 2ODNA 2WWFA 5FBQB 4OHWA 4RCYA 2FNFX 5E7JA 3KQLA 1NBMA 1S4QA 4JYBA 3SFZA 4DDWA 1TU4A 3JVUA 1Z6XA 1EWQA 1OYYA 3DO6A 3QXCA 4RFSA 3T1QA 3QXXA 2BBWA 1YZUA 2O8DA 4WW0A 2AN9A 2ONKA 4QJ4A 1DBSA 1JI0A 2HCJB 1QG4A 5FBRB 4LC0A 4PPNA 3KL4A 5D3MA 3P26A 5EP2A 1F48A 1YQTA 2PL3A 2XSZD 4JLPA 5FR1A 4BEJA 3KB2A 1D8TA 2ZUDA 3EPKA 4CEJA 1XJ0A 1XTQA 3EW9A 2V1UA 1XEFA 4IOLA 5G3ZA 4F7WA 5TB5A 2QU8A 5CJ2A 4ZCIA 5JEDA 3GLFA 4ABYA 3ZIAA 5DIFA 2QP3A 2GJ9A 4BFVA 1P62B 4F4CA 2QP4A 3WHKA 3EAQA 4JIMA 3K9HA 4M21A 3KX2A 4LPSA 4NCKA 2F43A 4OQMA 3GLGB 1U8YA 4QOSA 2ZPTX 1E79D 1JQJC 4P0TA 4KI0A 3CPEA 2QEQA 2ROWA 1EFHA 1KJYA 3Q3JB 2IYVA 2ZRAA 4KAXA 1XTKA 2ZEJA 2ZYVX 2GXSA 4RJLA 3U3RA 3BRWD 1G41A 2QENA 1ZMXA 5JZVA 3K0SA 2W6ID 4LY6A 1KHTA 2B92A 1XPUA 3QKRB 3O47A 2ZRLA 3EARA 3EC2A 3RS7A 2ZJ2A 1D9ZA 4Q01A 2EFCB 2GCNA 1NG1A 3FPAA 4QBGB 3X1ZA 3I92A 2F9LA 3JZMA 3QXSA 2JJ1A 3ADKA 2HV8A 1C9KA 1D5CA
chains in the Genus database with same CATH superfamily
2R8OA 3SZOA 2QAGC 1OLXB 1V47A 3QUAA 1SNYA 3HPRA 1HYBA 4PYNA 5AI0A 3IUBA 4BNVA 5TMDA 5ALWA 5TQVA 4B0PA 3G6KA 4LXGA 1BE0A 2ZI9A 3DBLB 2HWUA 5CLGA 2O7NA 4AKGA 1SCDA 3KUCA 2PX2A 1QGED 2BUCA 3HUUA 1G98A 1IATA 1NW7A 1H9BA 1DFGA 1BCRA 2OQIA 2ZJAA 4ZU1X 4CIXA 1H0HA 3PX3A 1CVLA 1DT5A 4JLMA 4KW7A 5BV0A 3LF2A 3HYRA 4TMWA 3OO0A 1N8KA 4EKEA 1WRBA 1NY6A 5P8WA 3ROMA 3VR0A 4BV3A 1DEOA 2WC1A 3ENQA 2C0CA 4B4KA 2GWHA 4L75A 3A3YA 1UVGA 3UHAA 3QEJA 1V0JA 3G23A 5BT8A 4RXTA 4AJKA 2NVBA 9LDBA 4G4IA 3BE6A 1AA6A 2BGWA 1KAMA 3M49A 5AVSA 3DEAA 3BJEA 4RVGA 2AOXA 1PTJC 2A1TR 2V6FA 2NSYA 4O3FA 4NH0A 1CR2A 5GJCA 1GILA 2WHYA 1EDDA 3N2LA 2BDTA 5AQ1A 3R5HA 2NZJA 3TLMA 2H52A 3B12A 4ARSA 4P7GA 1CV2A 3U19A 5CD9A 3ZX5A 3QU4A 1K7UA 2VP2A 4ZKDA 1ZD3A 2VZ8A 3A1FA 4J94A 1KOFA 3I8XA 3TBFA 4RD2A 1XMPA 1H4TA 3TO6A 1GTL1 2RGWA 5EUQB 2FQWA 4WZBE 3Q0TA 2VHUA 2EP5A 2X8LA 3D5EA 1IHPA 4Q4DA 1S3SA 5MN4A 3RK4A 2ALJA 1VL0A 5DM1A 5LQMA 4J0HA 9LDTA 2DUJA 4L3VA 1WTAA 3MMPA 1EEHA 3C2QA 2CXSA 1UJNA 1DAIA 3IKMB 2IPXA 4M1SA 3T61A 1C80A 5BYBA 3TDNA 1NNLA 2VT2A 1RSZA 2Q1XA 4JLUA 3U39A 3ZGYA 1BKDR 2RGAA 3MN1A 2DB6A 4IXNA 3RABA 3W6UA 5JANA 4EFNA 2DEUA 2WJ6A 1COZA 1JR3E 1IIRA 3S8MA 4XIIA 5JIBA 3R6WA 4NECA 1YZ3A 3FNQA 5AI5A 4MV8A 3VR3D 1KO4A 4KLRA 2NU8A 4DDHA 1VE9A 2AS0A 4PM4A 2FWIA 3SM3A 1C3OA 5FQNA 4MRPA 1PAUA 2CLFB 4CLRB 2GTHA 1NZJA 1IL0A 4ZREA 1O1YA 4OY3A 5BV1A 3C1OA 5CFMA 1MAHA 1UDCA 4J0DA 1ADFA 2QUKA 3DKPA 3IP3A 1N3LA 2CY0A 3DAFA 2X6TA 4OMFG 4PPYA 1IEQA 1RPJA 1W36B 2E48A 4D25A 2NADA 4IYRA 3OJCA 5AI9A 3RPEA 3DLTA 4DR7B 1UAYA 5T6BA 1P2TA 1ZMRA 3GCXA 3T52A 4E08A 5H3CA 4YQFA 1KJQA 3HYTA 1EX6A 2Z2ZA 3KTAA 2HADA 2YDYA 2NU0I 1N77A 1QRRA 2B69A 2O0HA 1SQSA 1GPYA 2BLNA 4QXPA 1GTSA 3MTEA 1RZUA 3I2JA 4D3ZA 2AN4A 2QD4A 3AUYA 3TLCA 4M1OA 4W4TA 3UPDA 3DMFA 5HJ5A 2A78A 3QPWA 4GNRA 4EMBA 3EEQA 2JA1A 3KR1A 1VE3A 3IEKA 1BCSB 1G2QA 3RKRA 3TFOA 3BAZA 1ABBA 3CIOA 4KBYA 4B8YA 2YFKA 2BD0A 2VAPA 3E7DA 4B73A 5HMMA 5AKYA 2L8EA 2J0EA 4K5QA 5ALUA 3Q8KA 3G9XA 2E4ZA 3V4ZA 3HHPA 5K2MA 1TQ2A 2EBFX 5ALHA 2HRDA 4RVFA 1NWHA 3E1GA 4NMWA 3SEQA 3UA4A 1JFFB 1LRJA 1EVQA 2OO7A 3RJZA 2M5XA 1RIIA 1YRYE 3SWWA 4ADSG 1ULMA 3L7YA 2PX0A 3TZQA 1T5IA 2OD9A 1M2VB 2MR6A 3FRHA 1EA5A 2FPSA 2OZPA 5B4TA 1IDOA 5HFNA 5FDFA 5AVTA 1L4HA 2IYOA 3C87A 2F9MA 5IYZF 3LQ1A 2I67A 3B51X 2HGZA 4P4LA 1F7UA 3UT0A 3GPCA 5B7NA 3IOCA 4Y2UA 5FLKA 1DUIA 3FZGA 3O4IA 1VJ5A 2ZS8A 3WMRA 2CVQA 5KJ1A 3TECE 4I0WB 1T26A 1N1MA 3TIIA 3V7FA 1V1HA 3TRJA 1Y3FE 4CG0A 1DRKA 2CZQA 4C0HA 3W5HA 4XZ3A 1C4WA 3HR8A 3OA0A 2PKQP 3OKPA 4TWAA 4GZMA 1BS9A 4JXZA 2X15A 4P2GA 3X1YA 3KQVA 1O6FA 2AOVA 3I5UA 1L7PA 1TEVA 3WQQA 4W1QA 4BMNA 1J8DA 2JD1A 1Z4QA 3ZCVA 1OV6A 2JHGA 1BA2A 2JK0A 4J1SA 3AR4A 2BZ1A 4K87A 2RHLA 5IT9A 3CUTA 3WI7A 4QODA 1GDTA 1CHOI 5FTJA 5CK5A 3CCCA 3RHZA 2H2FA 2GIVA 3ZOZA 2FRVA 1N7IA 2PQ6A 4OD0A 3USES 2ZIAA 2A7QA 1DT3A 2AFHA 3FYSA 3LWDA 1YQGA 3LS2A 4ARVA 5I47A 5KYYB 3PNVA 5D5QA 5TS2A 1WVGA 1AV7A 1AY0A 3GJXC 3KSMA 1ULBA 4QOEA 3GLRA 2HHCA 4OVKA 2FSIA 2ZRKA 4IS3A 5FXMA 3STVA 1EGMB 4DGSA 1E60A 3TSWA 1KI4A 3I23A 4C1BA 2A3NA 2D4AA 1JKFA 2P2SA 4R8LA 3VNVA 2R00A 3GVPA 1R18A 3JRXA 4X1YB 5A4JA 3DFIA 3F9CA 2GEUA 2G4LA 3KR2A 3ZJ4A 3PYLA 3GFPA 4MI1A 1GU1A 5KWEA 4YJDA 5KYWA 3SM9A 4J0FA 3V6MA 1QWSA 2OCBA 4Y6PA 3FJOA 3Q7PA 1Y3HA 2X58A 4UVHA 3J80A 1FDSA 2W2PA 5JSYA 3ZHBA 5J5VA 3ZXYA 2GA8A 1BN7A 1ZM2A 2JL1A 1GNLA 3ODPA 3Q8XB 4NYIR 4BKUA 4BXOA 1YZVA 4QSMA 4BP8A 1ORTA 1W5EA 4NPCA 3LCUA 4ZZ2A 5BN4A 1VHDA 1B76A 2J32A 1V9SA 3S27A 5J1SB 5B6IA 7WGAA 2JJ8A 3VO1A 1E98A 1TEZA 1OX4A 1HFKA 1HO3A 1CY8A 1FVHA 1ILEA 1GNSA 1XBTA 1JKXA 4ZOLF 5EERA 1QFJA 4XUCA 1DZIA 2V4UA 3WNQA 4K3UA 1YMQA 3N2GB 4CUZA 3ND6A 1THGA 4GW3A 2Q0SA 2UVQA 4HXEB 4LDJA 2IC5A 5JWHA 1EXDA 4EJ2A 4CT0A 4K9LA 1IUPA 2PLNA 5AICA 1NVVQ 2CLDX 2K2WA 2CJPA 3CY6A 3GFFA 3UJ3X 3W4IA 3HCDA 4F04A 2C7VA 3P9SA 5EJEA 1WAMA 3VH2A 1Z6ZA 3FW1A 2VJAA 3GGDA 3I0MA 2IFTA 1M2WA 3LF1A 5CEEA 1JHQA 3CM0A 3CRVA 1PZNA 3QTTA 4O5OA 3NRJA 4M1EA 5FOVA 1O8CA 2VOJA 3FPCA 1XTJA 4ZZ0A 1JNXX 3VNBA 5CM8B 1WX1A 2G76A 4TV9F 1RQ7A 1V8OA 3DKIA 4R8MA 1B3RA 3D43A 3FMVA 3M7IA 3P9PA 4RPHA 4WJZA 2GZAA 1PS8A 3R3SA 5IDVA 3HGQA 1ZH6A 2VZ0A 2DBVO 4IIVA 4X20A 3E84A 2EARA 1O6CA 1A7KA 2XD4A 3T9BA 3TLXA 2D5CA 3GAFA 2W58A 4Z1MD 3GZ4A 5AHOA 2UZ3A 5AVWA 1CUSA 4KE6A 2I8LA 3HEBA 3VTZA 3EVFA 2WWWA 3R9XA 3DXYA 1AN0A 5EXXA 2OVBA 4QPNA 3IUPA 1N1GA 4RVNA 5E9AA 1PJUA 1HE2A 4IEEA 1ZJZA 4CDNA 3I9NA 5J3JA 3H3JA 5JARA 2EV9A 4BNLA 1TT5A 2M6KA 1LFAA 4FGJA 4NCIA 5EE5B 3BFJA 5IDWA 1Q17A 4OP1A 3CVXA 2AZDA 4P34A 1CX9B 2G08A 3ITDA 4J3FA 3WMXA 5C81A 1G4HA 3KXDA 5JNLA 2Y0MA 5IN4A 3ELWA 2X8JA 3L18A 3QZUA 2HDWA 5JOQA 1GIAA 3IHLA 4DRXB 5IFLA 4IIJF 1FSSA 4L8YA 1FNBA 4G0WA 1A3CA 3QVGB 2I99A 4IJ5A 2BGGA 1B0UA 1YDGA 4CF6A 3QKRA 5IAEA 4CMCA 3VR5H 2X40A 3LYUA 2FJPA 1C4KA 4ZMSA 2V8OA 3UMBA 4M1QA 5B1IA 2Z1MA 5TEVA 1IW4A 1T2NA 4LMPA 4U9IS 5DCYA 2NYAA 1PJSA 1OLXA 4LRUA 3C74A 1NNEA 4PZ9A 3THSA 1CJCA 1YL7A 4QXQA 2EKPA 1OGYA 3OQIB 2XUOA 1TVKB 2H1SA 2GPAA 4YBZA 2FPRA 1M1YB 3A0UA 3O92A 3DBLA 3V9PA 3LXRA 5EIHA 1XHLA 1PJBA 3OZUA 2X5NA 3DBHB 3Q7RA 1TM3E 4Y2RA 3U49A 5JMTA 5LL6P 2PQ0A 3ZU6A 1Z6YA 3DDNA 1QIGA 2ZRJA 3SJBA 2XUAA 3B82A 1Y37A 3KZMA 4DN6A 1MQ8B 4QNMA 3DLBA 1IU9A 1W6RA 4JC8A 4G1VA 1LPOA 4RPGA 1CZLA 2BBOA 5DTMA 5JYEA 2L18A 3KWJA 2W2QA 4AJPA 4X6XA 3KQPA 4Q93A 4X00A 2J3QA 4Z3OA 2HKIA 1L7OA 1NV8A 2P27A 3E5HA 1Q2UA 1Z68A 3RS3A 1CEYA 1AN1I 4IHAA 1NJ8A 1R1DA 1DQSA 1Y98A 4NHOA 1C7FA 1GVHA 1C3JA 1NURA 2HEGA 3DV2A 3C6KA 1EGAA 4QDJA 3NGMA 3DVLA 1ZJ5A 2J9GA 4NYMQ 5FLXA 3Q1KA 3AR3A 1DPFA 4ETWA 1CUIA 3WGMA 5K45A 2BUSA 4D97A 2O50A 1NBMD 3D1JA 1JWLA 3FXAA 4JIGA 4RVSA 5SZIA 2NSJA 1LWNA 1NDUA 2F17A 4ZVOA 4E11A 1PLKA 4KVGA 3L92A 1YKGA 4DEYA 4N9WA 5IVIA 3K0BA 4I55F 4OP3A 4IWYA 3G85A 1ODLA 3LAWA 4RL6A 2FWNA 3U3XA 3UJNA 3WNBA 2ODQA 3HM2A 1Q0QA 2V7VA 3KDSE 4RKQA 4C6TB 5IJZA 4FEEA 5JSZB 5U4XA 2O05A 4KHZA 1SOWA 3B8HA 4YB8A 5FLYA 4G67A 1HURA 1QF9A 1SC3A 1HF3A 1CRLA 2XHEA 4HQNA 5FI5A 1DO0A 3KPYA 2Q7DA 1ISJA 1Q6ZA 4G37A 2JAWA 1RZVA 3LFTA 4WD3A 3I8SA 4QUIA 1TZMA 4PSKA 4BNZA 4QELA 2KE5A 4P32A 1DWPA 2Z2YA 4K40A 3Q1LA 1WMBA 1BQ4A 2MSCB 4MUNA 1X13A 5ALYA 5EKTA 4WTOA 3ZIAD 2C78A 2ICAA 2WHPB 4H0NA 1S8FA 1JI3A 1U3DA 3OT5A 3U62A 1SVWA 3E81A 3IE1A 4RY8A 5DISB 1UFOA 1JFSA 1QPBA 2V9ZA 3T9CA 5BRAA 3TAXA 3FYUC 4F11A 6REQB 4AWXA 1OBCA 3QBTA 1SO8A 1P0IA 2GVDC 2X3YA 5LSAA 1QF6A 3OOSA 1A95A 3NXSA 4OGLA 3GXBA 3AZQA 4MQUA 4XXHA 3GLKA 1WMDA 1DG3A 5B55A 2XQJA 5AM4A 2C8JA 2XWBF 3RK1A 4LIPD 3KTFA 3GN1A 1Z0KA 1C41A 4XX0A 3ZHVA 3WLEA 5KZMB 2ZB7A 4L5AA 3WQRA 1TXGA 1Q22A 2AE1A 1BCSA 2Z2JA 1TKAA 4N0QA 2OOSA 2H06A 4JX9A 1ZGCA 2VNHA 5DEIA 2G5GX 1VIMA 4QBKA 1E18A 2WUEA 2Q9CA 4UHJA 2VYQA 3C98A 3LYAA 2ZWVA 3NBKA 3VJRA 1KMHB 4WBNB 1XTVA 2RHMA 4RD3A 2VP9A 5AOCA 1JFFA 3IHTA 2HK8A 4DVGA 1L7RA 2R8EA 2O8BB 5FCDA 3HI4A 4WACA 1BJKA 3HBAA 3OCJA 1JHYA 1ZRHA 2C5EA 3D02A 3EVZA 2ZJ0A 3KYBA 1M2VA 4D9EA 2VNSA 2J5XA 3MUFA 4JFAA 3FNEA 1L7EA 2FW9A 2NO0A 3K09A 1NVTA 1XXHB 3P2YA 4PWYA 1I9CA 4GYJA 2WR8A 4KXMA 1J8FA 1U4NA 1U1DA 4Q3BA 5CFLA 3BCUA 3MWJA 4YO7A 2OFXA 1CVRA 1EFUA 4FFRA 4X1KB 4U7JA 2R5NA 1MG0A 1SKUA 2CMHA 2WJPA 4OHKA 4QC2A 2IKSA 4EY6A 1C1XA 4PZ0A 3LK6A 3PBKA 2HYDA 2DBQA 2I2DA 3JAKB 3P20A 3ND8A 3AGPA 3E1KA 5CNJA 1Y1QA 1KRXA 3DOOA 1KQNA 1KOLA 2C58A 3DFKA 5KX5F 2XTNA 4EW2A 2YIDA 5IN5A 4GBJA 1EWYA 4IVNA 4MR7A 4R8RA 4R84A 1D3AA 1HQCA 4H9GA 3M6LA 1U5AA 1D7AA 4WKGA 4GUAA 3IAHA 1OBOA 2A5JA 4LNAA 3IVMA 3CSUA 5TQJA 4KX5A 3PHIA 4EUKA 3DE2X 2ORED 1RYEA 3GMTA 4M6WB 3HN7A 3VMFA 4R41A 5KYYA 2YMQA 3MC1A 3QV1A 4JGGA 2CXOA 4D8XA 4BNUA 3FOEC 3AM3A 4MVJF 4FLMA 1NV9A 1NYQA 2OMEA 3T3IA 5PGMA 3ADBA 4DA7A 2H2HA 1A50B 1ZVMA 1FUUA 3FMIA 3KC2A 2Q27A 3SYNA 1UBNA 3O26A 2M98A 2NT4A 2GA9A 3H5OA 4X1YA 5MN5A 1WZNA 1M75A 2OHGA 1GG2A 4IDCA 2GKOA 2AJBA 3JR7A 3CONA 5GTDA 2VNKA 1L8OA 1Y6JA 2OV8A 2ZWAA 3DCYA 3P0JA 4KV7A 5KJEA 1FFSA 1G4UR 1DIHA 1N2HA 2ASEA 4NI5A 1XMSA 1X38A 5JSHA 2GEFA 3I64A 3IBFA 1JS1X 3SG0A 3NS7A 2C9YA 3PXBA 1T3SA 3PDIB 5DULA 4F3TA 1KJJA 3NKVA 5BY2A 3T3OA 1AC5A 2AN3A 3SJUA 4TN5A 2X2FA 2CUNA 3UANA 4KXUA 1VCMA 1IY9A 2YJGA 1KHHA 1O9BA 2CN1A 3ECSA 1ADGA 4YRCA 4A23A 1D1TA 1DCFA 1UUFA 3DB2A 3NH9A 1TL7C 3K1AB 3NC0C 5JJ5A 1XMOB 3MWDB 1SHUX 4DT1B 2XUJA 2R2AA 2H92A 1KNXA 4JB8A 4KYTA 3T5GA 4G1FA 3V8EA 5K4GA 1ESMA 2FKAA 3BFPA 1TCAA 1N0VC 1MF7A 3KPVA 4L51A 2R4QA 1DZ3A 1GGNA 3ABSB 3KOWA 5JHWC 4FHGA 1ZG3A 1ZHOA 2P9TA 5A6VA 2ZB3A 1L4UA 1UXJA 4LPKA 2OU2A 4FGZA 3AUSA 3BILA 2QVBA 2VTKA 3NTOA 5AKGA 4CL3A 3B9PA 4HVCA 1UZMA 2LDXA 4G5QA 4Y67A 5AJWA 1G8YA 1PS0A 2C20A 3SOZA 4KMOA 4MB6A 2AOTB 3WIBA 3KM0A 1YU6C 2RG7A 4HEHA 3NAGA 4GWGA 1NVVR 4HNRA 3EZ6A 3ZHQA 4OB7A 3M5CA 4BDSA 3G0HA 1DKRA 4J3JA 4RD4A 5FUYA 4DJFC 5BW4A 5KQRA 1FARA 4MIYA 3UJAA 5FWDA 3UJ6A 2YR0A 1Z2NX 4BC0A 1TT7A 2ZS9A 1IEWA 4CMBA 3DMYA 4CMEC 4Q3AA 3G9ZA 5TNXA 5AK6A 2BAGA 3KQYA 5E1DA 3SEKC 4RL4A 4IGKA 4AZ3B 2NSDA 3N6RA 2A88A 5DBIA 1TU3A 4DREA 1INLA 2ZR7A 1KVRA 3IT1A 3MW8A 4MUFA 4RVUA 2Y3IA 1Z0FA 5BN3A 1KPGA 1OD6A 2YJ3A 3AIOA 4HDNB 4WXMA 5CVVA 3FVVA 3RUPA 4LJ5A 4KVFA 3RRBA 2P41A 4A2CA 3SXJA 2QN9A 3NPAA 5HKOA 1AS0A 4FEYA 3TQRA 3IL2A 4FSDA 4K8RB 3HACA 1A4IA 4ID3A 2FETA 3RWMB 3WRVA 4EAAA 5MDHA 3B1YA 2GZMA 1XD9A 2RKWA 3ZWVA 3EXG1 4IS2A 1GCOA 5FOWA 5J2UA 4MUKA 4JLSA 2XRCA 4PG8A 2ORWA 1Y4AE 2BGIA 2HPAA 2Q3FA 3KVVA 3NNSA 4XPIB 2PX3A 1N8NA 3WK5A 2ZAGA 3KCNA 2C4NA 3L4SO 3E8XA 3FTQA 5D51S 4ZVVA 2ZRDA 3QOFA 4C0SA 1TMGE 4PLVA 1W49A 4L8WB 4LHEA 3FSEA 1Y7PA 2ACWA 1MRZA 2JIMA 1M6HA 2VRBA 1R9MA 4BUZA 4NJEB 3ZWCA 1R8QA 4CLDA 4IKOA 3E9RA 4LVUA 3ZU3A 2SECE 5CR9A 2JVJA 3E3LA 5EWMA 5ALTA 3X44A 3ETJA 3GELA 1CDEA 3DF9A 5TR9A 1RLUA 3H1PA 4C4SA 3IP9A 4UEJA 3INRA 1I13A 5A7FA 1DUSA 2R60A 2W4QA 3OQIA 4REMA 1MEJA 5EJIA 4QDOA 1TVKA 3MMSA 1M1YA 3E4CA 4DMCA 1J1IA 3BMXA 4G36A 5I7SA 2D3WA 3GL9A 1C29B 1IAVA 3DBHA 5TE9A 2EJVA 2A67A 1QIJA 3EVDA 1M54A 1GUYA 2OCKA 1SURA 5EMKA 3MHTA 5IJ0B 1BS1A 1BXZA 1R6VA 3U5TA 4JOCA 2DULA 2X42A 3AR2A 2W90A 1U9YA 4GPBA 1VDDA 4WOPA 1EDZA 2Z1DA 3G0IA 2GARA 4REOA 3RS8A 4HCJA 4RZ2A 3OQBA 4R1LA 1K6EA 3TW6A 4RY2A 1EUCB 3JPYA 1YC2A 4OQPA 2BR3A 5KYTA 1QH8A 2BKUA 3KT0A 2D8AA 2Q5QA 4WUTA 2ZCVA 3UW3A 2EIXA 2GJ4A 1PDOA 2C5BA 2ZJ8A 2WT9A 3CH4B 5ECYA 4DHWA 5KU1A 3OAAA 8GPBA 4AWBA 4EJSC 4G56A 2BH2A 1KMNA 3A14A 3LDGA 4OUKX 2QA5A 4US1R 1NIPA 5KBYA 4KEAA 1TBQR 3Q9LA 2HA7A 3AR8A 2R6FA 1RRFA 4FW8A 1TVMA 1H0KA 1ONNA 1PV1A 1WXHA 4M9QA 1EP9A 2QTRA 3P9XA 1MB2A 3L1IA 4LJ9A 4OK6A 2QOEA 3DQQA 1G19A 3KKNA 4OQZA 5J63A 4QFDA 5AHKA 3SFVA 5CLLA 1E5TA 3N59A 5AK5A 5EESA 4MIKA 4JLBA 2G9UA 4MWZA 4OOEA 2PR2A 4B6RA 4ESOA 4BV2A 1YJ5A 3TQOA 2XGGA 4K6GA 2VWPA 3D1VA 4KFRA 1DKQA 1P2GA 5BSMA 4FR0A 3T94A 4NYMR 3TW0A 2AG6A 2WVHA 4YV2A 2GXQA 2XHZA 2H1FA 3NV9A 2AN1A 1KGDA 3K9LA 1G6Q1 1KJ8A 2P2ZA 3E4DA 4BFZA 4BLTA 5KEIA 1TQ8A 1BOOA 3ENWA 3E3AA 3CS3A 3OC6A 1SC4A 1Y4SA 2XKBA 3L8ZA 1PNVA 3MBKA 4LECA 1TQHA 4LSGA 1VMDA 3ABZA 3KXIA 4KWIA 2QT0A 4GBGA 1IPHA 3C6MA 4JODA 4ERXA 5FL7A 3A0RB 4OXRA 4CT5A 5E7IA 4E1VA 3RKUA 1G2OA 3PUIA 1U9IC 3HJHA 1M2OB 4N47A 4AKTA 4RTLA 4NCNA 1S1MA 4LKRA 4KDCA 4QQNA 1R5OA 5B53A 1AKTA 3DOFA 3LM8A 4F0JA 2WA1A 1H6BA 4N40A 1PSWA 4AMGA 3KHUA 3NJ8A 3GLTA 3KB8A 4R6WA 1Z18A 2BFFB 3QF7A 5FPYA 2QTHA 1WP9A 5H68A 4R5HA 3GARA 3I6QA 4UW9A 4WA7A 4PCUA 1URPA 6REQA 1VL1A 1P3DA 4IIUA 1OWMA 3CU5A 2ZE6A 4GOXA 4KKVA 2R66A 3A4NA 3ZD6A 4RV5A 4DUYB 2OCDA 1TE2A 1DG9A 1V9CA 2V1XA 4PRYA 5F51A 3P2OA 4C4ZA 1YZTA 2VYVA 4W1RA 5F12A 4BU1A 2NU1I 1PHPA 2ERYA 3H3FA 3FR7A 2Q3LA 1T5LA 3OZDA 2PKRA 4HPXB 3ZV7A 1A5BB 4FGSA 4BKQA 1T5OA 4CMIB 1NNUA 3BA6A 3K9QO 1FTWA 3TSAA 3U31A 1MV5A 4BWYA 1E63A 4JUFA 1N6OA 1ZN8A 2BFCB 2IIPA 1G66A 2JJ2A 4CKXA 5F9FA 1II8B 1CUUA 1W2WB 4HLUC 2Z09A 3RJ5A 1LTQA 5GJWC 2VQEB 3HVRA 1KMHA 1J1UA 1GPBA 1N6PA 1U8FO 4BNYA 4NAVA 5K09A 2IEYA 1PJAA 3DTYA 3VSAA 5HK9A 3EZNA 2O8BA 2XY4A 3ACCA 4BNIA 1KK2A 2ZTVA 4PLTA 4ZV9A 5T4HA 1LX6A 1K9SA 1XD8A 2AUNA 2GDZA 3EVCA 5AKXA 2EFGA 1NLYA 3H83A 4BZPA 1BO6A 2I4IA 3VA7A 1FJHA 1XXHA 4XVHA 3GLFB 3NORA 4HRVA 1TLFA 3AHGA 1EHIA 3DL7A 3O9VA 5CM2Z 5FYQA 5DNYB 2C7RA 2FH5B 1D4ZA 1B16A 2A4MA 1XRNA 4HOYA 5JTTA 1DXHA 3FOAA 3VOTA 5I4CA 2WK1A 1EK6A 1QGOA 4Z2AA 1MJ9A 2NUTB 3QPDA 3CZPA 5K4AA 2YJ4A 4B7ZA 3KLBA 3QW4B 1AQLA 5DNVA 4J16A 2OHXA 3EXHB 3HH8A 4XIFA 5M7EA 3SQLA 4BQQA 3W1EA 3DQZA 1KWGA 3BEDA 2QT9A 3JAKA 5F76A 2CWHA 1JZQA 3WFJA 5DBHX 4FWTA 3ENZA 2GM5A 5DIZA 2BFPA 3IIJA 4MP3A 4A0SA 3DWEX 4C06A 2QGZA 3DWGA 1D0SA 3K05A 5J1TB 1KJZA 1E2FA 1EI9A 1EGQA 2CMKA 4Q37A 2R44A 4U39A 5FUBA 1DXQA 1TVCA 4HWOA 3RUEA 2PU7A 4V0LA 3OFND 5JYDA 1EQUA 2CF6A 1UFVA 1SC1A 2C4KA 1XDSA 3LLMA 3SYLA 4Z4GA 2JAOA 4BO4A 1T0JB 3H11A 3OSZA 1WY5A 4UM5A 3H8SA 1LDYA 1SBTA 4M6WA 4CG1A 5K6AA 3PGVA 2XZDA 3OWOA 3G2NA 3H8VA 2GYYA 3OE5A 1RRMA 1VXRA 2QRHA 2NWQA 3S0JA 1NKTA 5BN5B 5ALKA 4RS3A 3KDPA 2IWHA 1F7VA 3MUNA 3KOZA 2VQ3A 3GMDA 3JAWA 2FPLA 4Y2QA 5TMEA 1Z7GA 4ZQBA 5JSKA 4G0YA 5FB3A 3CNOA 3KQWA 5BSGA 3EXIA 4O4HF 4UU7A 3W5UA 2P5TB 3B1VA 1LPPA 2Q07A 3FFAA 1NUHA 2DY1A 2FSGA 4GOND 1P9GA 4GI3C 2V6MA 3T7JA 5L4SA 1ISSA 2QX7A 3MD0A 5TEWA 3AGQA 4ZD6A 4C1NA 2IX9A 4MUEA 4MGKR 3FJ1A 1DOZA 3QNUA 4BZXA 1YQEA 3FSYA 1T1SA 4MWSA 3VZQA 4C4PA 4P38A 2AWNA 1D2HA 2GETA 1YCHA 1YS9A 1I7QB 3R2JA 4E5DA 3SJ7A 5E2IA 1THZA 5AO9A 1EQAA 1QDLB 1SBIA 3PDIA 2BGNA 3UWMA 2LIVA 3TIFA 2VUSA 5AHXA 3G2KA 1W36D 1M83A 1WABA 2BCEA 2EBWA 4UHBA 2HFKA 4GS5A 1GFSA 1RJGA 4ZODA 2LR0A 1GXSB 1BROA 3O7WA 4E5SA 3TW8B 3U6BA 4PAGA 2GJKA 1IB0A 2KJQA 1BMFA 2OV4A 4G5OA 2D7CA 4FNAA 4A6EA 3K1AA 5IJXA 4E21A 2P6UA 4MWBA 2WJYA 3HQ4O 4DT1A 1EK2A 4HQRA 5CBKA 3PX2A 1PZXA 3NDIA 4CLEA 1CQWA 2ZBEA 4QBFA 4D7AA 5A2GA 5K8TA 2HYIC 1JHDA 3JWPA 4AQYB 1L5NA 4WOKA 2BMDA 3C45A 3K92A 1ECGA 1U3UA 1ZOSA 2IZ6A 1RYFA 2W0MA 4IJMA 2O8FA 1LLCA 3CUYA 1G6OA 1HDXA 2CMGA 3AVPA 2X9QA 3G82C 4LV6A 3JQDA 3MEKA 1GAWA 5EE9A 3TLEA 2YHSA 4HRXA 3UWDA 5C51B 1N5KA 1HWYA 3LFHA 4JYPA 3ZU5A 4GMDA 2A86A 3FYHA 1J2YA 4WK0B 3UJ9A 3WXMA 3K0CC 2GKRI 2QB5A 4R71A 1DFIA 4TMXA 4XGRA 1NR7A 1OYWA 3TMKA 3T9AA 2QLJA 4R2MA 2ZIUB 3Q3CA 3UO8B 5JU6A 2YY6A 2WAXA 4L27A 1HYHA 4HLCA 5DNAA 4YP9A 4EKYA 5MHTA 1U02A 1M0SA 2B82A 3HXQA 2P78A 1JDZA 1ZIYA 3L1JA 2WGCA 2DQ4A 3GZJA 2YQPA 2QRZA 3OOWA 4L9AA 3EOZA 2JGNA 3DTVA 2HJVA 4KQ2A 5AXAA 3ZE7A 1UVFA 4R7GA 3ZQUA 2DETA 3CLSD 4Y2SA 1XDBA 2JLRA 2ZOSA 4JL6A 3RSOA 4BFSA 3PD1A 1KP9A 5REQA 1KH1A 5CLQA 4XWKA 3G8YA 4HDNA 2OVOA 4MWDA 3M34A 4GP7A 3MAJA 2XYVA 4CKCB 2X7HA 3VU1A 1ZH4A 3HABA 4TLLB 2DB3A 2CUTA 4C7OB 4B6JA 2KBEA 3HNOA 1C4XA 2L17A 4P6VF 1JT9A 3JVIA 3CISA 2H51A 3ROFA 5GVSA 1IBSA 4C0JA 3RF6A 2GBCA 3ACDA 5AFSA 5BVHB 4RNDB 1VKZA 4IDQA 4XPIA 3SQOA 1GPDG 1L8QA 4M7OA 3KPJA 1H0RA 1U7WA 2JGIA 2O5VA 4K03A 4ASUA 1L2TA 1BE8A 4DSTA 1X4SA 1E96A 1W0CA 3KSDO 1UT5A 4FXPA 2RHBA 4ME6A 4Y3UA 1DV2A 2ZULA 1IN5A 4KE9A 1JDBB 4F4JA 3LGSA 3JZIA 1IHYA 3RARA 3O8NA 4LOKA 3ROEA 1SZPA 3DUWA 4NJEA 2WTUA 2UZAA 3GY0A 2IZOA 4ZCQA 4R31A 3UB3A 5BSTA 3GAMA 4AJ1A 4B34A 1T9BA 4J0KA 1YS2X 3S1LA 2FSSA 2QNBA 3EBLA 1U4OA 1FNNA 3JYHA 2Q5CA 1TIKA 3K1TA 3U44B 3U7HB 3EEIA 2FN4A 4KC0A 2EFEB 2R48A 3TUIC 4DA8A 3EEBA 1N2BA 4P3KA 3G0OA 5JQGB 2DHCA 1H66A 2V65A 1RWMA 2PGOA 3IBYA 3PI6A 4LXQA 4FC6A 1LDMA 4XDGA 1IWBB 1DCTA 3NJRA 2HBYA 2CE7A 4O2BB 4I4TB 2IU0A 2PLAA 1ZHFA 4BV9A 5IS2A 5IJ0A 2P30A 2ZYAA 2R2GA 3CPJB 2A5DA 1EZ4A 2A3RA 1F5SA 2WHRA 4QTUB 4X44A 4WERA 3AZOA 4G01B 3G9TA 3Q5EA 1H5UA 3A3NA 3BXHA 3HFJA 4HNSA 4CPDA 3DL0A 4KRXA 1KK0A 1RXEA 3LBYA 4FHCA 4KUEA 4YP5A 5CFRA 4TKZA 3ROPA 3GLHA 2AD1A 4UNRA 2UZ4A 4ND4A 4OQNA 2QRLA 3FRJA 2O06A 3T5AA 3G7NA 1ODSA 1QKKA 2JFPA 4V39A 3AV0B 2NVOA 2OA0A 4DDUA 6GPBA 5IX8A 2ODDA 2JBWA 4AJ2A 5I8WA 3QTLD 3FVWA 2GAIA 2BM0A 2RH5A 2YFYA 4NX2A 4XYBA 4DQLA 2OE2A 3PUKA 2GKTI 1DARA 3OZEA 4LS3A 1EA7A 1S20A 3KQHA 4OLJA 3IP7A 1U7DA 1H9AA 3KEFA 4F45A 2FMUA 3L0CA 4KN8A 1DTEA 3GV0A 1E3QA 2E4WA 1NM5A 3ZWAA 2V4ZA 1HDZA 3M6XA 4CUJA 2WSBA 4W8GA 4B3XA 1OYOA 4B3HA 4ND3A 4GIBA 3ICCA 4I66A 2DU8A 1N2GA 5AVYA 5JRDS 1XZBA 3B5IA 2AHRA 3EZGA 2D5IA 4KODA 1KZYC 3R5BA 3PC8C 3PDUA 2BBTA 3OPYB 1Z47A 3PA6A 3CSSA 5AIAA 2H5IA 5JZ9A 2FVXA 2P2GA 1BQ3A 4FFPA 4HTFB 4IDDA 1G8PA 2RCNA 3IURA 3FHOA 2LIPA 1O0CA 3S3TA 2JZMA 1W35A 3UM9A 3ZWKA 2M32A 5L3ZA 1ICEA 2VYFA 5DNWA 3TMAA 2BF4A 1EM8A 2H11A 3GFVA 1QLJA 1M2OA 1YCDA 4E6EA 4U2BA 1V25A 3D8UA 1CIPA 2GPSA 1XF9A 1C3VA 1EXMA 1E64A 3L3BA 2WIKA 2YYSA 4GR5A 5TPZA 3G7UA 1TQ4A 3VZCA 3DEYX 5KCMA 2FWPA 4JBLA 1VYUA 2OBLA 1KSGA 3SQXA 4NP6A 3HU1A 1TLLA 1V3TA 2SKEA 2ZUSA 1CLUA 5ELLA 3VVCA 3T1YB 3STYA 5EFZA 3UAZA 4WESB 4P08A 4PTYA 1PJZA 1M66A 4FGWA 4MAAA 4Q02A 3COPA 3FRIA 2VEOA 3PGKA 5EJMA 4D8VA 4DV4B 1THMA 4XASA 3WWPA 4FUQA 3GMSA 3O8OA 4PGGA 2BDEA 1X8KA 2JBHA 4C5AA 1XHEA 1YCGA 1E2JA 1G20B 3ETLA 4H7PA 4FGKA 4TOIA 3T41A 4KZKA 4R1TA 1K6MA 1XRMA 3W2TA 4S0XA 5IBPA 1GADO 3RSCA 1XK6A 4EFKA 5EJ5A 3BT7A 1LW7A 1H22A 3GGGA 3HZHA 3L01A 4MQFA 1GCUA 3VSCA 4OB6A 4MS4B 5BMOA 1GLNA 3DTTA 1II8A 3AL2A 5G40A 3WIEA 2DR0A 4LV8B 3GCZA 4A2QA 4TXNA 4ZHQB 3NT4A 1CPYA 5HE8A 4JI3B 2Y1WA 4CM8B 1ML3A 5EJGA 1HL7A 4JITA 5DSXA 3RIMA 4IEIA 3PYMA 4L76A 2CXTA 3BXOA 621PA 4G5FA 1E4EA 3FBTA 1ZGGA 3W2EA 4LV5B 3H13A 4M1WA 1MVNA 1KEKA 1V45E 1ZK0A 3W1VA 1RAGA 3ZHCA 3BXZA 4LKOA 1QNFA 1SBZA 1FQWA 2E1RA 2VJQA 1B0AA 1D8AA 3EDMA 3LQ4A 1HOXA 4EUFA 5JAOA 1PEDA 4OAOA 1JFRA 3QH4A 1HGXA 1J2TA 1DC4A 3QVLA 5HGXA 1ITZA 1DDGA 4Y2VA 4Z7NB 1F5NA 2YWXA 2D5BA 3OAAD 4INZA 4PSVA 2G36A 5D6OA 1RI3A 3AFHA 1CGJI 3QF4B 4UTNA 5IM4A 5GMOA 4NYJQ 1R37A 5LBTA 2PK3A 3DKRA 3KJIA 3DGFC 2DKFA 3VOAA 4C87A 1YZQA 1LRKA 1PX2A 1LDGA 1WTCA 3JASB 1HYEA 1YH3A 1PDWA 3HDYA 3KAJA 1X1CA 3INNA 2OR3A 1NW8A 1XXLA 1A2QA 1XO1A 2OO3A 3EVTA 3IDQA 3IO5A 4YRDA 3AVTA 1Q7GA 3GJ4A 5DPMA 4IFBA 3SS8A 1YZKA 3EF3A 4PG4A