5FUYA

Catalytic domain of thymidine kinase from trypanosoma brucei with dtmp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
181
structure length
165
Chain Sequence
HGRIELIIGPMFAGKTTELMRRVQRHKHAQRSCYIIKYTALTANVSVSNLHDVGDEWRKYDVIAVDEGQFFPDVAAFCSKAADSGKVVIVSALDADYLQEPFEEICLLVSRADSVVKLSAVCMECHNRKASFTYRTVKSDERKLVGGSDMYMSVCRSCYETKRNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords THYMDINE KINASE
publication title Cell Cycle Regulation and Novel Structural Features of Thymidine Kinase, an Essential Enzyme in Trypanosoma Brucei.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transferase
total genus 52
structure length 165
sequence length 181
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2016-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 5fuyA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fuyA01
2ZITA 1TBNA 2GA8A 1NI3A 4MGKR 3U5ZB 4WOPA 2R6AA 1U9IA 2VP6A 2CLCX 3C41J 2IHBA 2OUKA 4H1UA 2WTUA 1U99A 3CRVA 4Q02A 4DC9A 3L0SA 2V7QA 3RABA 2F3RA 3WNDA 1E1RA 5FOUA 3X1YA 4BFSA 1BIFA 2WWWA 2OT3B 5CLQA 2YJTD 4MUBA 1W2HA 3SBDA 2GZAA 2DYKA 3TR5A 1IHUA 2BMDA 5KNCA 1AKYA 1JAIA 3K53A 3K9GA 4D2IA 4JLOA 1ELOA 3CM0A 1ZJ6A 3SQWA 2L0XA 5AUOB 2PT7A 5JMTA 2YWFA 2R6GA 2XSZD 1Z08A 2EFHB 3TNFA 3OEED 2J41A 2GK7A 1NNEA 1Z8FA 4FXPA 4G5OA 3UG7A 4OQMA 2WM9B 5CDFE 2NTYC 2E73A 4NMMA 4LBVA 3CWQA 3JZAA 1FUUA 4NCHA 2KB0A 1J90A 1VKJA 3VHLB 4ZKEA 5A5GA 2AXNA 5FBWB 4AD8A 4WW0A 4KO8A 4OQXA 1DG1G 3CZPA 1SGWA 4HZIA 5D3MA 4BLSA 2GDJA 1G6OA 1P60A 5EP1A 1CJVC 1X6VA 2LKCA 2PLFA 3KKOA 3MD0A 4JLVA 1Z29A 3VNUA 3NHBA 3EC1A 1W0KA 2P6NA 4DCUA 2ZIAA 4TLDA 2EU8A 3K0EA 3WBKA 4GBMA 3FMPB 2XAUA 4IFBA 4ASUA 1X1SA 4YMTA 2LKDA 1XPRA 4MRPA 4C0LA 2FPMA 2B8TA 3SE0A 1DOAA 3B1XA 3WMEA 1IAQA 4JLNA 5F3WB 4G0NA 3JVUA 4JVNA 4R98A 2D2FA 4NONA 2XJ9A 1EFCA 3I32A 3WNCA 2FJUA 5KSPA 1TQ4A 4B43A 3FKQA 4CEJA 3W5JA 4G5RA 4CVNA 4D4JA 4IDHA 3OZXA 5HE9A 3CB4A 2JLQA 1GP2A 3W90A 2GJ9A 2H18A 1QHIA 2DBYA 3N2IA 4DB4A 1E96A 2ECKA 3AUXA 4PHGA 3HPRA 2GZDA 2OO7A 3PUXA 3K9NA 1ZBDA 4F4CA 3QUSA 1E2FA 5AJZA 1ESMA 4OHXA 4LX0A 4M1MA 4OQFA 4Q01A 3U60B 2A78A 2QG6A 3OFNA 4OI2A 3FB4A 5CB6A 3U4QB 4IXMA 3BBPA 1GVNB 5CDFA 3UGIA 4LHZA 4KSCA 3V9PA 4OK5A 6Q21A 4BLOA 2DFTA 2G77B 5F9FA 4AYWA 4A4DA 2E87A 4EAQA 4EIWA 4F38A 4JKYA 3VR5A 4AK9A 1KI8A 2DR3A 3QY0A 2O0JA 1B23P 2ZJ2A 1KDRA 2QNRA 3CPJB 1FQJA 2ORIA 4PFSA 4HDQB 4TL8A 2W0MA 5KOYA 2ZSAA 1DEKA 1W4AA 2ZRDA 3AKCA 1CKEA 1RW4A 1AIPA 1Z0AA 1B0UA 3LWNA 1IN6A 3TQCA 3X1ZA 2B7CA 5KTYA 5KSZA 3B13B 3VR2A 2R9VA 2A7QA 4TTPA 3FPAA 1W49A 3Q72A 3QEJA 2BIFA 2AFIE 5GJWC 4QM7A 2BWJA 4D0LB 2CCKA 1CXZA 3ADCA 2A9KA 2QTVB 2WBLC 3QXJA 4DZZA 4XWAA 1AJEA 4HLCA 5DO9A 2ENNA 1RJ9B 2YOGA 1KDPA 2JLRA 4Z8XA 4ABYA 1G7TA 1V43A 1SXJD 2TMKA 4LHWA 2O8DB 5H8WA 1ZM7A 4NZYA 5DLQC 2W6ID 1NN3A 1OJLA 2FX3A 1G5TA 1H8HA 2RH5A 1VHLA 1FARA 2V9PA 2WWGA 3GLHE 4C3ZA 2IS2A 2AL7A 4XWOA 3CRMA 2NZJA 1RRGA 1GG2A 4Q00A 5L3QA 2VTKA 1NIJA 1E2NA 2VHCA 4O3MA 2Y8EA 4TZ6A 3K1JA 4RVCA 4PC6A 1LB1B 2CE7A 2ZE5A 2EVWX 3GFTA 1W46A 3W8NA 2I1QA 1EK0A 1UM8A 5BXQC 2G1KA 4PHFA 1T6NA 3OIWA 1E9CA 2RCNA 2J0VA 5EE9A 5DH9A 3AEZA 1F5NA 3ZVMA 4A15A 2QM8A 2VP0A 2YZ2A 1O3YA 4ON9A 1EXMA 2Q3MA 1HYQA 1VYTA 2Z4RA 3DOFA 1DTSA 3S1AA 4JLKA 3GFOA 3TSWA 2KJQA 1IY1A 4GI7A 4XVRA 1S0UA 2Z0MA 1G9XA 3UEYA 3MG9A 2GVZC 3ZLJA 4KI0A 1VCMA 4FW9A 2XB4A 2G0NA 4DEYA 4KHZA 1JAHA 1YZNA 2XZOA 5K8TA 3IHWA 2NMVA 2A5FA 2QTFA 2AXPA 4FCTA 4KCGA 4HI0E 4Q7MB 4JBYA 5DHAA 2CL7X 4PR0A 3SJCA 4DLXA 1OW3B 2GKSA 4LWZA 3A1VA 3VX4A 4U00A 3B1ZA 2IUSA 4BLQA 3BC1A 1KI4A 1KI6B 4TMKA 4EJSB 2WJGA 1F2TA 3P4YA 2CCGA 2IT1A 4JYBA 2WIBA 4ZIRA 1P2UA 3ICEA 1DADA 2N1BA 2ZVQX 3GLFB 2QENA 5FOSA 3F3YA 4RD0A 1HTWA 4CIDA 1Z63A 4KLZA 4A82A 1LFDB 2AD1A 5TMPA 5KU1A 1XD2B 4BE7B 2WAXA 3K0AB 1E2GA 1CR2A 4HLUC 4EPYA 4ARZB 2GESA 2PZFA 2GXSA 3GQBA 4JBWA 3AUYA 1II0A 4MRSA 4PQFA 5E7JA 3EPKA 3I72A 4KJZA 2BMFA 4QHYA 1XEXA 2XTNA 2ERXA 1KSHA 4DVGA 1XFAA 3KY9A 2WSMA 4A8JA 5KSYA 2P5SA 5G3ZA 3N2EA 1AZTA 1JQLB 4YONB 2VL7A 3I5XA 2JLYA 1Z5ZA 3SOPA 4A0FA 1MV5A 2MSCB 1SVMA 4LJ8A 3ETLA 5FPTA 1R0YA 2D7CA 1GILA 3B9QA 1G7CA 1SKQA 1OE0A 3A1WA 1ANKA 4AYXA 1COWD 2UVQA 2FWRA 1E2JA 3M0EA 2BCGY 5J4KA 4FMCF 1IONA 4GOJA 1W0KD 1ETUA 2O5VA 3THYB 4NHOA 1IQPA 1CJKC 4DLZA 3LBIA 2EYUA 3MFYA 3L0PA 4TSFD 3HJNA 5UKDA 3IO5A 4BWYA 621PA 1A1VA 1BOFA 3PEYA 1XB2A 5JJKA 5JJLA 3X1WA 4OQNA 1WA5A 1N0VC 3FTQA 3LV8A 2YWHA 4R71A 4QM6A 3QKUA 3E1SA 3DKPA 1XJQA 2ZUDA 4MITA 1QZXA 3M4YA 1N6OA 4PAOA 4HZUB 4Z8YA 3EZ2A 3NBXX 3T5GA 5B64A 5C2JB 1LS1A 3ZYCA 1P6XA 1FOEB 1YE8A 3ND9A 3VAAA 4BPBA 2D4HA 1DAIA 4B2IA 5F9HA 4ZV4A 4DUGD 3R9WA 3VKGA 1L4YA 2OFXA 1ZD1A 1JNYA 1TX4B 2RGGA 5EZ6B 3THXB 4C0JA 1WQ1R 421PA 4XTRA 2AHOA 4CEHA 2ATVA 1Q3HA 5AWFC 2QUZA 2GHIA 1HH4A 3HR8A 1LF0A 4QGHA 4JLMA 5FBQB 5A4JA 3NWJA 2CVHA 1S9HA 4TL9A 2PMDA 4GSYA 1VCOA 3GEIA 3FKSA 4Q9IA 4JLAA 3TMKA 5JZVA 4DRZA 2GJSA 4ZPXA 3BJIC 1KI3A 4LBWA 2FU5C 1SVIA 3K0FB 4WVFA 4II7A 2GAAA 5FTLA 5M04A 1R8SA 2X1VA 2GTPA 1G8PA 3AB3A 1ZCBA 3LQQA 1M7BA 3U44A 1VG8A 4PX9A 1CIPA 4XVUA 2JDID 3QBTA 4MGZR 2C77A 4TQUS 4LZZA 3TW4A 4OKSA 4Q9KA 2OXRA 4WXPA 4BZPA 1RRCA 2PZGA 3A1TA 4M1YA 1W7AA 3P4XA 1OXVA 1HUQA 1P7CA 4L9WA 4UXHA 1CEEA 4RD1A 3NC1C 5KDDA 4ZI2A 3HU1A 1E9SA 1J99A 3DL0A 3NDBB 1DAFA 1PLLA 3QXCA 5AR1A 2ZU0C 2ODEA 1U2RA 3MJRA 1PTQA 3QOFA 1IM2A 1H8HD 1VCIA 5AK0A 3W3ZB 2RGEA 2HYIC 4M9XA 1P9WA 1XU4A 2WWIA 5DI3A 5IHPA 1MO5A 1KAOA 4LYFA 4A2WA 4PQRA 1W36C 1XDBA 2ONKA 2QI9C 1KMHA 2H16A 1ZU5A 3MWKA 4QNRA 3FE2A 1RIFA 2FZLA 3AP1A 4W7SA 1WB9A 3ZD6A 1TU3A 3B5JA 3UEJA 4JVLA 1RKBA 1YVDA 4HATA 2CK3A 1UJ2A 4IW3B 4KU4A 4V0KA 1FTNA 3I4LA 1Q57A 1SVWA 1G3QA 4DCNA 4MGIR 1WF3A 1L2TA 2D2EA 1JEEA 1LTQA 2QAGA 3B85A 1MO6A 4N0DA 4E03A 1TQ2A 4RY2A 2ZI9A 5IK2D 2AK2A 3TK1A 4RD6A 2K5UA 4TLBA 1OLOA 4Q4JA 3T61A 5CYOA 3Q85A 4DSOA 4AKEA 1JEDA 4GPTA 1H8EA 1JXMA 4EPWA 4ZCIA 3KKPA 2QT1A 2NG1A 2ZJ5A 4QHSA 2XNDA 2O8FA 5DN6A 5EUMA 5B30A 4FMDB 5AJWA 4RFSB 1E1QD 1G5RA 4M9ZA 2IBMA 2JLSA 4C4PA 4JVSB 1IY2A 2FSIA 2O8CA 2CJWA 1OT3A 521PA 3GJ7A 3O8BA 3B60A 1PTRA 3G0HA 4B3XA 3CPHA 2A5JA 4UNQA 1ZC4A 1P61B 1XTRA 2FGJA 3GFPA 4I99A 1K8RA 1U8YA 5HZKA 1QF9A 2YC2C 2CE2X 4IDPA 4B3DA 4PZYA 1E79A 4HUTA 1E98A 1N25A 4BFYA 3REGA 2P0EA 4TMVA 5FUVA 2VYFA 2OCYC 1KJYA 4NYJQ 3H2YA 5EXXA 1TF7A 1CR0A 4TLAA 4DSTA 4LYHA 4NH0A 3SZRA 3D6TB 1E4YA 3T1TA 3QIAA 5IDVA 1CR1A 2OCPA 4ILEA 2JJ1A 1PV4A 2VHUA 4LJ6A 4EFLA 2H1LA 2IXFA 3PQCA 3U3KA 2ZUCA 3KB1A 3FGNA 4I81A 4MA4A 2PEZA 4KODA 3ZH9B 2YVUA 3NKVA 4MDEA 1T9HA 3QENA 4BRUA 3BFXA 3ZVRA 2WWXA 5EE1A 3D31A 4RSGA 4V0OA 4DJTA 3ADDA 5HZHA 3CH5A 1KK0A 2Q6TA 4GRAA 3IKJA 4B75A 4A1FA 1EFHA 4CYMA 4M8NE 3AH8A 2VP4A 1VHTA 3NEJA 4M22A 3KKMA 1TPZA 2CNWA 5FBLB 1FL9A 3KJGA 2W2XA 4E5UA 5F98A 2CXXA 1OHHD 1NN5A 4WZAE 4P3YA 5CIQA 2GILA 2BBTA 4HB0A 1Z0KA 1Q1EA 2H8KA 1AN0A 2EWVA 1UKVY 2F1JA 3MSXA 3EW9A 4YMVA 3P32A 2FV8A 3MWJA 3AVXA 3A8TA 3OESA 4AWXA 4JSTA 3TR0A 2GEVA 2QQ0A 4IEEA 3A4MA 2NGRA 4W5JA 5P21A 4C0BA 4B48A 2OHFA 1NG9A 3WMGA 1AQYA 2GBLC 4MYCA 3QF7A 1RE0A 3RRYA 2XJ4A 2OXCA 4M9SA 4B34A 4ZKDA 1XD8A 1VYUA 1Q1ZA 2VHTA 4PC7A 3UWKA 3VKWA 4BFTA 2ZS9A 2Q9AA 1TMKA 2VSXA 2WHXA 2OFWA 2ZU6A 1UBFA 4B6EA 1NKSA 2WIAA 1NN0A 3A4LA 1JXOA 3FHCB 3GD7A 1TUIA 3OAAA 5DHFA 4UJ5A 1ZM3A 4BEJA 2JASA 4M4SA 4D0GA 2H7VA 1TTTA 1GNRA 1YHNA 1ZUNB 4Q1DA 5GJVC 4MKGA 1F2UB 5BYKA 3RS0A 1OXTA 1I4DD 3SC3A 1G8GA 4V0LA 4ACBA 3TRFA 2FG5A 4RZUA 4P32A 4PHTA 2ORWA 1XEWY 2O8EB 1NMXA 1TU4A 4LY6A 4OHVA 1ZVQA 3LDAA 1BYUA 1VIAA 4QHTA 2WJVA 1JQJC 5HTKA 4BLPA 2J7PA 2ZE8A 2ZXUA 3K70B 4CF7A 3FKSD 1U81A 1KBEA 1Z0JA 1DBSA 2B92A 4QNMA 3G82C 4C30A 3AF1A 4IOJA 4POAA 4BLTA 1MO4A 2ZRAA 3B82A 1W36B 1M7HA 4IDNA 2ZRKA 4LJ9A 3IILA 4NTZA 3DO6A 3AGPA 4A0GA 2OFOA 2BKUA 2AK3A 4MQBA 2PCJA 2O8DA 4KFUA 1XBTA 1IN7A 5HKKA 5JFGA 3SYLA 3GLFE 3VTKA 1T8UA 1NLZA 1ZU4A 1CU1A 3CPEA 3IHLA 3RNLA 2JLZA 1MABB 2ONJA 3U3JA 2EWWA 2GF0A 3UG6A 4CEIB 4IEIA 1E9DA 2IYYA 3AF3A 3C8UA 1E9FA 3HYRA 4MH0R 1AS3A 3HDTA 4BQSA 1PUIA 4ZDKA 4YMWA 1KI7A 1X8KA 4XSHA 1Q21A 1EGAA 1VTKA 3QF4B 3N5CA 2FPLA 3B78A 3EARA 3CF6R 3QXSA 5EP2A 1CJUC 4JVMA 2DFKB 3QG5A 3UMFA 4NDZA 2HXYA 3ZD7A 1NLYA 1NVVQ 3TQFA 2OLJA 4NCNA 3X1DA 1S3GA 3CXLA 4M1WA 1NRJB 4KVGA 1ZAKA 3NTUA 3ZQ6A 4OYHA 4PPQA 1OKKA 4MRNA 4YXWA 3AKDA 3CH4B 3B1YA 1UKEA 1S96A 2XOKD 2YWEA 1R0XA 2PH1A 4HB4A 1DAEA 4BFWA 2FZ4A 1N3BA 2W6JA 4JYCA 3ECCA 2HYDA 4V0NA 3KQHA 2QRNA 2FFQA 3V00A 1GWNA 1MO3A 3F5FA 1QHHB 5TVKA 1UBEA 3T1VA 1G18A 2XNDD 4UNRA 3BB3A 1PUJA 4LHVA 2MMGA 3Q7QA 4N0EA 4GDFA 3SN6A 2GWHA 3WNBA 2ENZA 1YZGA 3F8TA 1R5BA 1KI6A 5BN5A 5KPDA 4BFZA 2NO1A 2HLDA 1Z6YA 1PJRA 3BE4A 3RHFA 2IS6A 4P33A 5EXPA 3MLEA 1W48A 1M2OB 3D3QA 3I1FA 3GLFA 5JJIA 1T5IA 2NO0A 4KLNA 4AURA 2O8BB 4BECA 5C46F 3U7FB 1CR4A 4O2LA 5BW8A 1E79D 4DWJA 3BH6A 4EJSC 1XD2A 1LF5A 1G4UR 2Q0HA 4Q4HB 1G17A 2ZRHA 4AYTA 2WJJA 4PPNA 4ZI3A 4ARZA 3ZVNA 2DFLA 1I4TD 2ZANA 3DKVA 1GL7A 3DMDA 1GRQA 2CLDX 2WWFA 2JLWA 1HEIA 3M6AA 4PZZA 4K8OA 1QDEA 5FBVB 1NP6A 2FEOA 3CNNA 4CT4B 4LSGA 1U0JA 4JT4A 4TQ9A 2GEUA 4C0KA 3GEEA 1AQUA 5J4YA 1T3LA 3CO5A 1YR8A 4NYIQ 4UNSA 4ZO4A 1PZNA 5HCNA 2PX0A 2OBLA 1RZ3A 3JVVA 3BFVA 2G1JA 1N6LA 3DMNA 3KTAA 1F6BA 4GNKA 1UBCA 2IYUA 4C0QC 2J5XA 2J0UB 2Z4SA 2IHYA 2ZYTX 3WRXC 2GXUA 1D9XA 2BV3A 4QG7A 2VRWB 3THYA 2GXAA 1AGRA 3P20A 4KXFB 4ZDIA 5FUWA 2QSYA 4IFEA 2J59A 5TV2A 1N5IA 4EPRA 2HJVA 1ZYUA 1ZM2A 2REOA 1XD9A 1XZQA 1Z6XA 3WYFA 4IOKA 4JZKA 2D74A 1W4RA 4IVRA 4BFUA 1LW7A 2IEZA 4QJ4A 1W4BA 2WKRA 1A82A 2PL3A 1EWRA 4WBSA 1W0JA 5EP4A 4L16A 4L15A 4LYJA 4TTRA 1N2CE 1P72A 2ODNA 1SKYB 2ZYUX 2JCSA 4JL5A 3CX7A 2ZYVX 3KQLA 3ZS8A 4B47A 2R8RA 3AVYA 1LVGA 1VCNA 2BBOA 2CVFA 4TMTA 3OAAD 1JR3E 2P2LA 3Q5DA 5SZIA 3THXA 2DB6A 1ZRHA 3B1VA 2DY1A 3CRRA 2BBSA 4J0QA 4RZXA 1RVDA 5FOVA 1OF1A 3AQ4A 3ICQB 2R44A 1VG0B 3GJ4A 1DPFA 1D2EA 3EWAA 1IN4A 3B2EA 2QU8A 2IWRA 3L8ZA 3P1JA 1D5CA 2CHGA 4WA7A 2QE7A 2ZI4A 5H68A 4DDVA 4B2PA 3PUZA 4A2QA 2D3WA 5G41A 1R7RA 3K0FA 2MSEB 5CK5A 3A4NA 4DT1B 1G5PA 1EX7A 3EPLA 2R62A 1HY3A 1E0JA 2HXSA 2VIIA 3AP3A 1RFLA 3KJEA 4PC3A 1ZNYA 2ZYWX 2QGZA 3ZZUA 5CYPA 2RGCA 3CNOA 5KDLA 2BJVA 1T5LA 1DELA 3BERA 3CKLA 2IXEA 4A92A 2VLIA 4X8MA 3TUJC 4U02A 5HKKD 2H57A 2N42A 2A3RA 2YWGA 3PEVA 2IK8A 5LD2B 4BGDA 1LS6A 4DDTA 4BZQA 3QSYA 1Q22A 3VFDA 2ZREA 1R0ZA 1G1MA 2OAP1 1QHGA 2ZRCA 2AD5A 3DVLA 3REFA 4MYUA 4ESHA 1XNJA 4M1TA 3PUWA 1CRPA 3BH0A 4FCVA 4C0SA 4OL0A 3NIBA 4AC9A 3UGLA 5J4VA 5GJCA 2D06A 4EFNA 2JJ2D 2OILA 2GK6A 3EXAA 3FVQA 1E0SA 2UZ3A 4WZBE 4PTLA 2GEDA 3IBGA 1Z3IX 1JR3A 3CONA 2BKEA 1N6PA 3LAWA 4KVAA 3GJ0A 2VPPA 4TN1A 5K8UA 2FEMA 3DDCA 4Q1FA 2YOFA 4O2RA 1ZW6A 1J70A 1ZD8A 4QOSA 1G4AE 4S35A 1SVLA 2A30A 4LK2A 4F4IA 5IT5A 2PJZA 2QBYB 2IWHA 1KBFA 2CHQA 2FNAA 2NIPA 4A6PA 2FDCA 3NBZC 5KDOA 5B57C 2ZRJA 5DI9A 1KSGA 2WSSD 3EPJA 4EQ6B 2W6JD 4ACAA 1HV8A 4GMXA 4GZMA 1YZQA 2OBMA 3LW8A 2H5EA 3HR7A 4ERNA 3EAQA 3VQTA 2J7KA 2JLUA 3UPUA 1II8B 1KMQA 1EFRD 1OYWA 4QJ5A 2OESA 1KHTA 4B71A 2QAJA 4RFSA 4DEXA 2QTHA 2HT1A 1OH8A 1E2DA 4HLUA 1KI9A 2V6IA 1IN8A 1M8PA 5FI0B 2ZRLA 2HLDD 3SR0A 2EYQA 3GLHA 1NKTA 2V7QD 1GKIA 3BB4A 1SVKA 5FTKA 1E1RD 3RDPA 1QHNA 4FINA 4GFDA 4OI1A 2VP9A 3CRW1 3U3MA 4C7OB 1M6NA 4FD2A 4CT5A 1XMIA 2HV8A 4YMSA 2V1UA 4Q9JA 2RGDA 3RS5A 1NY6A 1VYVA 1P2SA 3KDSE 5J40A 3ZZ0A 1ZM4A 4YDSA 4ZCMA 4FIDA 3UMSA 3WBJA 4WXRA 1JJ7A 4LJ4A 2V8OA 4GOKA 2C78A 3LNCA 1G8FA 4W9MC 4DKXA 3Q9LA 1D2NA 2ZJOA 3WRYC 5BN3A 2C04A 1BYIA 1SHKA 2HDNB 5JHHB 2J0SA 4IKEA 5GADl 4FMDF 4HYYA 2IYVA 1R5NA 3T35A 3KFVA 4RCYA 4V0ME 3QI2A 1UDXA 1YU9A 5DSZA 3AVUA 4NYJR 1E4VA 4WAUA 4Q1CA 3W34A 1TQDA 2WJIA 4MRVA 2QMEA 1A5TA 5TARA 1U90A 3MWYW 4TL7A 5EQTA 1E2EA 3QKSA 2RGNA 4D80A 1Q12A 1N6HA 3RS3A 4ASUD 4Z51A 1Z22A 1KO1A 1NF3A 4KBGA 1S8FA 3LLMA 1GFIA 1XMVA 2IYLD 4UXJA 2ZTSA 4E09A 4LBZA 4KV9A 1OB2A 1ODFA 3EZFA 4M53A 5K8LA 3OHMA 3IIMA 1XA6A 3EC2A 2RGNC 1FZQA 5FL7A 3FMFA 3Q8XB 2C99A 4BFXA 4B73A 1NLFA 2ODWA 4DDWA 2VSFA 4XVQA 2YC4C 3L82B 1M1YE 1CJTC 3CX8A 3C15C 4JIMA 3MWLA 4RZ2A 2H17A 3GJ3A 3LVRE 3J81k 2X2FA 2IYWA 4YDHB 3SNHA 2EFCB 2WV9A 4HAZA 3I73A 4PAQA 3AVTA 4DCSA 3IPYA 3HWSA 5FOTA 3FYHA 3OFND 1TADA 4YLGA 1XZPA 3U6KA 4QBFA 2F1IA 1TL7C 2HCJB 2YYZA 3C16C 4KSBA 1FP6A 1KDTA 4OI0A 1Q44A 5AUPB 4Q9LA 3BJIA 1KJZA 2IXGA 1VPLA 3UANA 3ND8A 1R8QA 3WP1B 4C0HA 1F2UA 1M74A 1FX0B 2QZ4A 3E70C 4V0MA 3EIEA 5KSOA 2ZSDA 2HF9A 4QGGA 1ZNXA 2W2VA 5SZKB 1YZUA 1XTKA 3CX6A 3QKTA 4OBEA 5BWMA 2FMXA 4EUNA 2O8EA 2B8WA 1XXHB 3TLXA 2AWNA 1DAKA 1NBME 2EFEB 2W58A 1L7VC 4NU0A 2ANBA 2BMEA 2KWIA 4LC1A 1Q3TA 2C9OA 1E2PA 1N6RA 4OHWA 3OEHA 3RAPR 1EG7A 4AY2A 1GRNA 2ROWA 4MKHA 4OK6A 4HDCA 1IJEA 5F2EA 4LV6A 3K70C 1XF9A 2C8VA 1T4GA 3AVPA 3HPQA 4M1OA 4Q7LA 4R7ZA 3PUVA 2WAYA 4A36A 1NN1A 4Q1EA 3C5HA 1KTVA 5FPYA 2QY9A 2FSFA 3QVUA 2X2EA 2VF8A 5J47A 5JI3E 2BJWA 3GJ8A 5CJPA 5EE3A 1MRSA 3IEVA 3U2QA 3A1SA 4G1UC 4R2IA 4R9UC 4OHZA 3CUEF 1HURA 1Y3AA 3ZDQA 1MABA 1XMSA 3WY9A 1SVSA 4EFMA 2BDTA 4CEIA 2JGNA 4URWR 4EDHA 4PPFA 5AUNB 2BBWA 3LBHA 3IEUA 4US0R 1UKYA 2DCUA 4WIAA 3E2IA 3VR4A 3FFBA 1R10A 1U0HC 3AF2A 1YZLA 2Z83A 1Z07A 3WMFA 2NQ2C 4F91B 4JLJA 4DB2A 3O8RA 4A0HA 1LNZA 1IJFA 3UXMA 1J8YF 4OK3A 3T5DA 4TYPA 2IYSA 1AGPA 2ZRNA 2ANCA 1KZ7B 1Z06A 4PSAA 1E2QA 3X1XA 1D6JA 1XTQA 1DS6A 1XTJA 3IQWA 2RGAA 4Z1MA 1G19A 2AN9A 1E69A 2GZHA 2CCJA 4IVPA 4Q18A 4LJYA 1NBMA 2CDNA 3IQXA 4TWZA 2NPFA 2V3CC 1XTSA 4JMPA 3IIJA 5JEDA 1KNXA 3V4FA 1NVVR 4O0MA 1OPXA 4DLVA 1TBOA 1QHHA 4NKRA 4QGFA 1HQYE 1GTVA 2IUTA 1P9RA 2C2HA 5E7IA 2J3EA 4PPGA 1Z0DA 2FOLA 4B35A 3PJRA 1SHZA 1G7SA 1ZP6A 3CR7A 3NH9A 2EFDB 4GZLA 2GJ8A 1YRBA 2P67A 1CF4A 2R6CA 3ADKA 3RYTC 1TEVA 3RRMA 3EZ6A 5C4GB 3EA0A 1XCMA 3THWB 1GRRA 2O8BA 3KKNA 1FP7A 1YRAA 2ZI3A 3WHLA 1A7JA 2KE5A 4L5BA 4YQFA 1H65A 4G3XA 2HF8A 4AKIA 1O87A 3PUYA 4L8GA 1HQCA 3IDQA 4Q4HA 5G40A 5JSZB 2CL6X 4TLEA 2ZVPX 4AIIA 5CLLA 4HDOB 2FGKA 1W47A 2REXB 5DGXA 5K8IA 1NSFA 3CNLA 4Q66C 1SKYE 5C18A 2J9RA 3CF0A 5B58C 3PFIA 4D0NA 2C9YA 1NY5A 3TKLA 2YNMA 1GNQA 2R6DA 3DZ8A 5EE0A 3SEAA 1AKEA 1P2VA 4LUCA 4LPSA 4EPVA 2J45A 1P75A 3QKRB 3MGCA 1GNPA 4Q03A 2P65A 5JWOA 2XSZA 4XJXA 1MT0A 3PXGA 1ZC3A 4A8JB 4NE2A 3PV0A 2G6BA 2YOHA 1UPTA 1U8ZA 1XTIA 4Q19A 1KDOA 3QPVA 4TT3A 4LBYA 1T8TA 1G64A 2D7DA 5DIFA 3HP1A 3CR8A 3ZZTA 4PAMA 3EX7C 3TGPA 1X1RA 1DO0A 5TDHA 4AI6A 2J0UA 3N70A 3W8RA 1S4QA 3H1TA 2ZSFA 4MYHA 1OIXA 4Q4LA 5ANRB 2KBEA 2VRWA 2YINC 2GBLA 5JEEA 1MOZA 3BD9A 4DCVA 2OAQ1 4N3NA 2F55A 1J2JA 1Z6TA 2ZAMA 5JBQA 2JATA 4NYIR 5DYGA 1C4OA 4LI0A 3RRZA 1BMFA 4B3CA 1DE0A 2GAOA 1JPJA 2Q21A 4WZ6A 3R7WB 1DO2A 3I8XA 2QQEA 1VG1A 2E1RA 2UZIR 4LV8B 1CJMA 1XCGB 2JIZA 2VF7A 3EIQA 2R6FA 3L0IB 3SFVA 2XX3A 2FFAA 2RGBA 3OF5A 3FWYA 3GJXC 2WKPA 4NP6A 4M21A 4QXAA 4M0LA 4RD3A 4V03A 4Q47A 1QRAA 1JI0A 2HT6A 2OV2A 4TTQA 3U4QA 3BOSA 2Z6VA 1G6HA 5JHGB 2XGJA 2OCBA 5EE5B 4F4JA 3LX8A 4Q1BA 2ZAOA 3IGFA 5JCPA 3G5UA 3QQ5A 3EIHA 3B7GA 3KQKA 3KQUA 4JLDA 2BCJQ 2NO9A 4DXAA 2JLVA 1U8AA 2R65A 2Q9CA 3QXHA 3PENA 4DSNA 3C5CA 1NMZA 1S1CA 4JS0A 2ZI7A 2ZE7A 1IXSB 2BEKA 1U94A 2ZS7A 1DAHA 3EZ9A 1KO4A 4URVR 2AR7A 4ZDWA 2G83A 4PQYA 4TYWA 1IY0A 5AJYA 1OFUX 5FI1B 3TBKA 4UJ3A 5J4LA 3WXMA 5JWRA 4LJ5A 4MKFA 1NIPA 4DT1A 4PC2A 3HU3A 1KYIA 3WYGA 1YKSA 1Z2CA 3UKDA 1KO8A 1YR7A 3PCRB 5CM8B 1OXSC 4D81A 3TAHA 1RJ9A 1CRQA 5FFMA 3RANA 4LJAA 4C9BA 5A0FA 2ZRBA 4FMBB 4DHEA 2CLSA 2A5DA 2BMJA 4GL2A 1R0WA 4DLUA 1F60A 4JBXA 3EA5A 1TF2A 1WDTA 2ASEA 4LDJA 2QP3A 1MKYA 1BS1A 1G8HA 2P6RA 1Q1BA 4AKGA 5E4FA 2G88A 2WPDA 3H4MA 2C98A 1FQKA 2WOJA 2ZI5A 4H1VA 5IRCD 1FW6A 2W6IA 2A2ZA 2QL6A 4KBFA 4M1SA 1V5WA 3EPHA 1D8TA 2DWPA 2JEOA 1IXRC 2CK3D 2PX3A 4PSVA 5LD2C 1GUAA 1RRPA 1GKYA 2F7SA 1PLJA 1XJ0A 2EFGA 3KJIA 2F3TA 3OIUA 4P4UA 4Q4AB 1W5TA 4XD7A 1SXJC 4LV5B 2GJKA 4L9MA 3LA6A 2J1LA 3UGDA 4QFMA 3W6OA 821PA 5L3SB 3A6PC 5FTJA 1N0WA 2NO7A 2QBYA 4K46A 1JR6A 1Z0IA 2VBCA 1YZKA 4NCIA 1T0HB 1H8ED 2IA5A 4A0RA 4NCJA 4DLSA 5DNYB 1HA3A 4EQ6A 3FHTA 3C14C 3IPXA 3B8HA 1E3MA 5FUYA 3WHKA 5DN6D 3KUDA 1Q1QA 3QPWA 5EZ5A 1II8A 3RLFA 1L8QA 1ZUHA 1GAJA 5CB8A 3VU9B 1E94E 5LBIA 4EJSA 4IHQA 4B3BA 2FA9A 1KSFX 3K9LA 1XP8A 4ITRC 3W5IA 2KBFA 4A6XA 1US8B 2ZUBA 4DSUA 4RJLA 3CLVA 3TW8B 4AG5A 4D6PA 3DPUA 3LO5A 4LYAA 2GNOA 4BRWA 4PZLA 1QG4A 1KOFA 4DLWA 1JALA 3K9HA 1GOTA 1KKMA 2GVDC 2QN6A 4W5HA 5KNDA 2ERYA 4O25A 1W1WA 2CJWB 4HAVA 4C7OA 3OE7A 3K0AA 5HPYB 4TYNA 2ZEJA 4HUQB 2ZRPA 2NPIA 3R20A 1OIVA 2WZQA 3BWDD 3L2OB 2IYRA 5EUQB 1Y8FA 4JT2A 3NBYC 3NXSA 3QPUA 2HEIA 4IOLA 2JJ1D 3QVVA 4TZ0A 3TH5A 5BQ5A 5IF9A 4U5XA 3MAAC 2Q3HA 3WP0A 4B33A 2H92A 2IUUA 3LFUA 1U9IC 2W0SA 3W6PA 1G8YA 1Y63A 3B6EA 1F3OA 3CF2A 4EKDA 721PA 3I61A 2IYXA 1EESA 4U7DA 5C4MA 3VR3A 1E9AA 2GCPA 2CHVA 3FFAA 1GZSA 5GVRA 2GCOB 3TSOA 5JLJA 2WWHA 3O47A 1AM4D 2FNFX 4TMWA 2RB4A 1FTSA 2QEQA 1QHXA 4TT3D 3QBVA 2CNWD 1XXHE 3KQNA 2P5TB 2ZE6A 1YR6A 2X19A 3LLUA 1W44A 4H9GA 1DAGA 5L3VA 3BRWD 3IO3A 2CBZA 5SZJA 1WBBA 3AP2A 2IEYA 3O8DA 5JCZA 5E7MA 1COWA 1FMLA 1NSTA 3U61B 4URZR 5FOXA 3BORA 3EASA 4LHXA 1W4CA 4P4SB 3UMRA 2J87A 3MMPA 3GLIB 2V54A 3BGWA 1WMSA 1GIAA 2IYTA 4QBGB 3T1OA 3BB1A 2IF2A 1BMFD 4Y0AA 3RSOA 2YV5A 2XTZA 1E2KA 3F0TA 2IF0A 1G3UA 1W5SA 3CBQA 4HAYA 2I3BA 3U3OA 1N6KA 4TSFA 2F43B 4QRHA 4BEBA 4HZUA 1VMAA 3H0KA 2W00A 2JLXA 4X8HA 1QVRA 2F9LA 1Z47A 1ZMXA 4P0TA 5H1YA 2JIZD 5KYKA 1GDDA 1K5GA 4LHYA 5LB4A 2F1RA 2BVNA 2ZRFA 4PO9A 2VP2A 3SU8A 1UDWA 2ZROA 2HJGA 3DM5A 2FPKA 3PVSA 1WBDA 3X2SA 1GITA 1MR3F 1KGDA 4RZ3A 4OJQA 4B6DA 4B76A 1R6BX 1KO5A 3NG1A 5L8VA 2VEDA 1QG2A 4LGMA 2DFNA 4F93B 5TB5A 3TSZA 2R2AA 2DPXA 4DUGA 3AF0A 2GCNA 1FX0A 3AKYA 3KXKA 5BYJA 1QHYA 4DLRA 1BH2A 2FSGA 3A36A 3BS4A 3DOEA 1RC8A 2FH5B 2J7PD 1P5ZB 3AF4A 1XXHA 2OCAA 1Z2AA 4NYMQ 2BM1A 3GLGB 2SHKA 1S3SA 2ZJAA 4URXR 2W2TA 4B74A 1IOZA 3AV0B 2BEJA 1LY1A 2VSOA 4IDQA 1UKZA 2ZSEA 3RC3A 2WJYA 3P26A 4IRUB 4EPXA 2ZM5A 2XXAB 121PA 3SHFA 4LCBA 3R8CA 2GVIA 3ZVLA 4D4LA 5L3RA 4PANA 1N5KA 5D3QA 2E9SA 4BASA 3KJHA 2JDIA 1T3HA 4FWIB 4IXNA 2X8AA 2PBRA 2ZSBA 2IYQA 2O0HA 1N0UA 4G5GA 1SXJB 3T12A 1PLKA 2DWQA 4LPKA 1QVAA 2VQSA 4JLBA 4G01B 3HYTA 4CGZA 1TNDA 3CWZA 2QRZA 2WPDD 5AJVB 2YHSA 4FWTA 2PLRA 5LDDC 3K0CA 1XPUA 1E2IA 2I4IA 221PA 3CZQA 1NJFA 2REBA 1NVXQ 4HAUA 3I62A 2C9CA 4RCZA 1F48A 3NC0C 4XD7D 1UFQA 1DARA 3U7HB 1G3IA 3KZ1E 3UWOA 1I2DA 4F7WA 1L4UA 3H84A 3LXXA 2IS4A 3A1UA 1OKKD 5KUTA 4US2R 3ONWA 4YXWD 4XWKA 3K0CC 2QPTA 4QKQA 4ESVA 4OJKA 1WXQA 2ORVA 1X3SA 2PEYA 2IS1A 1RFHA 2FSHA 2J46A 1MH1A 1A4RA 2HCBA 1U98A 3B1WA 4ZCLA 1NL3A 1OFIA 1RRFA 1P2TA 4PSKA 4URUR 1VDZA 2BM0A 3P27A 5B2ZA 5IK2A 4V02A 4TYYA 1KI1A 4JKIA 2RKOA 4I1VA 3ASZA 3VHXA 2ZRMA 1CBUA 2DHRA 4QC2A 2O52A 1SZPA 2J0QA 5TXGA 2PMKA 3FHOA 1XPOA 4G5QA 4B44A 2B7BA 5CJ2A 2HUPA 3I3SR 1KJWA 5FR1A 3T15A 4EPTA 1J8MF 5G3YA 2V6JA 1E1QA 4D4KA 3ZIAA 2WWYA 4DIDA 2RGXA 4GP6A 5FUXA 3NBFA 1G291 3THWA 2WMNB 4E07A 1P9NA 5FPSA 3SJBA 3OE7D 3U6BA 4DBLC 3UK6A 4IDOA 5AUQA 1FMJA 5JS8A 3AKEA 2DWOA 1OIWA 1KY2A 3BFKA 1UF9A 4C2TA 1KIMA 1R4AA 1WP9A 2JJ8A 4LJ7A 4FN5A 1NVUQ 1OV4A 4Q48A 5HR5A 5JSZA 2I1VB 2BC9A 4G5SA 4AG6A 3O8CA 2FFHA 3QNUA 2WVJA 5ELXA 3GP8A 2AWOA 1CP2A 3PR1A 3MUFA 4BFVA 5DISB 4TYQA 4DLTA 4BLRA 1YZTA 2IC5A 4JL6A 1XCPA 1ZUIA 2VHQA 4CW7A 5EP3A 3QKRA 4DIEA 2VP5A 3ADBA 2YKGA 1UBGA 2CL0X 1P3JA 2ZJ8A 4MGYR 1LV7A 3D7MA 2FFBA 1ZINA 1N5LA 4Y0VA 4E22A 3A58B 4BUJA 1GKUB 1XEWX 5CM9C 1N6NA 3FDIA 2WJHA 3LRPA 3I92A 2OM2A 2WMOB 3RC8A 5D3MB 1RYFA 3K0SA 3DZDA 4A8JC 4B3FX 1WRBA 1ZNWA 1S2MA 5JI2E 1X8JA 3LX5A 5E95A 3SHWA 2OSBA 3KTAB 1TUEA 4DCTA 5HCIA 3KL4A 2PJRA 1ZD9A 3AM1A 4JJKA 4HSEA 2FF7A 3AVWA 3C7KA 3GPLA 3SFZA 1OHHA 4HEJA 1NG1A 3LD9A 2OEPA 2QT0A 4UQOA 5GJBA 4MKIA 2QORA 3KFXA 3BXZA 1P73A 3GMTA 4P31A 1NJGA 4A2PA 3VKHA 3Q5EA 1Z83A 3R7WA 4HAXA 3SS8A 4RD2A 1FPMA 4M9QA 5KNBA 5KO2A 3BIFA 1Z6GA 3GCGA 3TVDA 1W0JD 3PEUA 4CEJB 1EWQA 1AK2A 5G53C 5JRJA 3M1IA 4MRRA 4QJ3A 2ZJZA 2C95A 3VX3A 1N6IA 1VG9B 1HT2E 4GT1A 1A2BA 1Z28A 2G3YA 3LW7A 2DB3A 2XEXA 3AGQA 1XWIA 1E2LA 4M1KA 3KKQA 4KYUA 4B6FA 3L43A 4KFSA 1J7KA 3SI7A 2RHDA 3RVBA 1E2HA 4NCKA 1VECA 4MDFA 5KPJA 1E0AA 3LBNA 1WE2A 2QMOA 4QBIA 2A5YB 1R2QA 3AVOA 3GJ5A 4PXAA 4Z54A 4GP7A 3Q3JB 4OHYA 1GSIA 1KZGB 2QE7D 2W83A 3AVVA 2FE4A 3W3AA 1YR9A 3RS2A 4D82A 1E6CA 2NOAA 3IUYA 1OXXK 3EG5A 2WKQA 1IBRA 4LC0A 4GMDA 2QMUA 2C5LA 3CIOA 2P3SA 3DM9B 4XTCS 3MRSA 1E99A 2ZRIA 5TY0A 5J4HA 4KITB 3RWOA 5FTMA 3SYNA 1G20E 4JJZA 4PO8A 1BO6A 5CIWA 3D8BA 2BHRA 2G9NA 5J5CA 4XIGS 1D2MA 1VIYA 2OG2A 4W5WA 2QROA 3IBYA 1T0JB 1FAQA 2KSQA 2QP9X 4B2LA 2YUUA 1ZIPA 2WICA 2O0KA 1K6MA 3VR6A 3DEFA 1NMYA 3VNVA 4QGAA 3PIRA 4QBHA 3UFFA 3H86A 3TUZC 4Q9HA 4PC1A 3L8YA 5JS7A 3QJYA 4CDGA 4RKEA 3QF4A 5AJXA 2OLKA 1GL6A 2IX3A 2OE2A 3TAUA 5L3QB 3TE6A 1JR3D 3SJZA 2IW3A 4AKHA 4TMXA 4XH9B 4Q4AA 1CLUA 4D25A 2XB2A 2ZJYA 3L0OA 2LWIA 3Q7PA 4TMZA 1HT1E 1JJVA 5L3SA 1M7GA 1S9DA 4M2LA 3ZGXA 5FOWA 4YC7A 2VO1A 1KKLA 1E32A 3VMFA 4D26A 5LPNA 1DAMA 2B21A 1KK1A 2QPAA 1E9BA 2UKDA 2JAQA 3TIFA 3S1AB 4ZDJA 4I4LA 1WCV1 3MJHA 1AS0A 1TQ6A 1E0KA 3CRQA 2OZEA 2QP4A 4Q21A 2WOOA 3K8YA 1XEFA 2PCLA 2LCFA 3THOA 2XOKA 2F6RA 5FTNA 4CRWB 2V1XA 5BN4A 4PHHA 1YQTA 3BH7A 1XMJA 1Q0UA 1ZNZA 4IJMA 3VU9A 5FPKA 4DDUA 4D4MA 1US8A 2QAGC 3GLIE 1A2KC 3RWMB 1N5JA 4FKDA 4Q7KA 2C03A 2F1HA 2CMKA 5EXSA 4R2HA 3T34A 1YJ5A 3U3RA 2NZ8A 1RPZA 3QXXA 3R9IA 2GETA 3ZIAD 1F2TB 1X86B 1CULC 4ZIRB 5EXTA 2C96A 3KX2A 2JA1A 4JLPA 5H70A 4TL6A 3PG5A 3V4RA 3FMIA 4KFRA 4HUQA 1TEXA 3GLHB 2ODBA 1SQ5A 4FMCB 1OYYA 1OXUA 1Z0FA 4X8OA 3ZJYA 1EX6A 2ZI6A 3RS7A 3SBEA 1FFHA 1X8LA 3A37A 1CTQA 4UXIA 4S2EA 3DHWC 4I1OA 3QG1A 4RKFA 4X8LA 4KAXA 4OQLA 4C2UA 2ZS8A 3QEOA 4MUAA 1XEXB 4KYIB 3OIVA 3OEEA 3RRNA 2ZQ5A 3CW2A 1AS2A 4KFTA 1SULA 1G3RA 8OHMA 2GCOA 1QBKC 1IN5A 2FN4A 2Z43A 4K81B 3PEWA 4URYR 1OFTA 1Z6AA 3T06B 1AZSC 3GJ6A 5DYIA 1KY3A 3U7EB 2ZR9A 2ZR7A 1U0LA 2Q9BA 4FCWA 1FNMA 2ZJBA 3W9YA 4LRWA 3VR1A 3GLGE 1JECA 5FPHA 5FH9A 1I4LD 1KO7A 3JZMA 1TF5A 2XITA 3WYAA 1W2GA 3TVTA 1K5DA 1C1YA 1IXZA 5LB2A 1KK2A 1JPNA 4P4SA 1ONBA 2RHMA 4UKDA 3GLIA 1E2MA 3KXIA 3NH6A 1RYHA 1GM5A 3IIKA 2AKYA 3NEYA 2GF9A 2ZRGA 1C9KA 3QKSB 4PO1A 5FL7D 3EWSA 1EFTA 4F92B 2QM7A 3RSLA 2ZR0A 1FNNA 2RAPA 4IOMA 2F43A 1T3SA 2Q3FA 4HLDA 3LXRA 2PZEA 2EW1A 4Q1AA 1SXJE 2ZPTX 5CK4A 2GXQA 2PT5A 4XOIA 2ATXA 1QHSA 2QMHA 5KHOC 4B3GA 3LVQE 1JBKA 1NVWQ 4I1UA 2XZLA 4UNPA 2GRJA 4DLYA 1R5OA 1XJCA 1TAGA 2G0TA 4MYTA 2GJAA 3NHAA 1AA9A 2KI5A 3KUCA 5GVSA 3R9XA 5JWHA 2QA5A 2AFHE 3KB2A 4L4UA 1DG3A 2MMCA 2EQBA 3EZ7A 4RFVA 5SZHB 4A9AA 4LOAA 3AVQA 1R79A 4I1SA 1G7RA 3U7GA 2F9MA 1CS4C 1I2MA 1OFHA 4CEHB 2B6HA 1ZIOA 3K70D 2XZPA 2AX4A 3HU2A 4Q5IA 3GEHA 4B32A 3BK7A 3W6NA 2V4ZA 1G16A 1S1MA 3GLGA 2BOVA 1OSNA 2QSZA 4HAWA 1XRJA 3C4JA 1UAAA 3LY5A 3OEHD 4HLQB 2D62A 3E5HA 2Z5FA 3R8FA 4YMUA 1W36D 4CZ2A 1P62B 1ZCAA 3BAFA 4P4TA 4N1AA 2QGNA 2OBNA 2XXAA 1OH7A 1OH6A 3SQXA 3I5YA 3U44B 5CITA 1MRNA 3LH5A 5HE8A 3ZQJA 1OH5A 5FR2A 1UEIA 2IYZA 4QL3A 4TQAA 5C1BA 3UATA 1HE1C 4NYMR 3SYKA 2MSDB 1ZM9A 3NVAA 1SVOA 3ZS9A 1FUKA 1UEJA 1SXJA 2V55B 2ELIA 3TUIC 4GOXA 5DE3A 1JB1A 1M34E 1BKDR 3LQRA 4US1R 1II9A 4NBSA 1D9ZA 2AKAB 5DI3B 3T1QA 3RS4A 4FI3C 5FL3A 1KMHB 4NL4H 3TJZA 2VHJA 4XSGA 4OI4A 2RMKA 5E3HA 3NDPA 4HB3A 3K09A 1T91A 5JRZA 1KSJA 2JJ2A 2X77A 1KK3A 1ESNA 3KXLA 1DVRA 3PITA 2XNSA 4Z1MD 1Q20A 1P4SA 4RD4A 4TLCA 4IVQA 2A5GA 2IL1A 1UADA 4Q7JB 4L9SA 5FBRB 2N46A 1NBMD 2QAGB 4C0AC 3I8SA 2NO6A 3K09C 1KI2A 2VA8A 2ZETA 4JL8A 2P6UA 4NPHA 3FMOB 4Q4JB 1G3MA 1E9RA 2VH5R 3UIEA 1KAGA 4HB2A 5EJEA 3QE0A 1GL9B 1EFUA 3B9PA 2XTMA 1KNQA 2WSSA 4JSYA 1G41A 2QPOA 4UNNA 1G21E 1XX6A 1E9EA 3SJAA 2O8FB 3OIYA 3SDZA 1HE8B 2CEAA 1PVOA 3MCAA 1OB5A 1EFRA 3FOZA 2O8CB 3ASYA 5JECA 4BZXA
chains in the Genus database with same CATH superfamily
1GZHB 5TX7A 3EY9A 2XWJI 3I61A 5BMOA 2D7JA 4WOPA 3K6SA 3BJEA 3E9MA 1GZ4A 1ZHHA 1E4EA 2ZYHA 3C41J 1M34A 4H1UA 1PD1A 3RUCA 4ALNA 4DC9A 3L0SA 3EA4A 3DZHA 3IV7A 4LXQA 3WNDA 3X1YA 1TXGA 4ZVOA 1PL6A 4BZWA 3G0IA 5CLQA 3SBDA 4MUBA 1PJQA 1WF6A 1M3SA 2DYKA 2YWBA 1IHUA 1WB6A 3C7AA 5KNCA 3ISVA 3C70A 4OEHA 4QWWA 4R1NA 4ZZIA 1O58A 1KS2A 1U0GA 1BMOA 1ELOA 1R50A 1ZJ6A 1PR3A 2HHLA 4JLOA 4WFJA 3SX0A 4ZALA 4EARA 4EENA 4RTQA 5IG2A 5JMTA 2N9UA 4EG7A 1X7DA 4NMXB 2A1TS 3PXAA 3L6RA 2A1TR 13PKA 2EP8A 3FSRA 4G5OA 4ITUA 4E32A 5CDFE 1YA4A 1PQYA 3KUKA 2OV4A 2EL9A 4NMMA 4N41A 3G2PA 2H4HA 3CWQA 3I37X 3Q0EA 2N0SA 4GWLA 4G85A 4H7DA 1PNQA 1QGYA 3B4VC 2VS1A 4NCHA 3HK2A 1VKJA 3H6HA 5A5GA 3CA8A 5U9CA 4EUFA 5D5QA 2WM2A 4AD8A 4R01A 4WW0A 1B6GA 1JH9A 3K9FC 4ZP1A 3DOUA 4LOIA 2E4YA 1G63A 3DNFA 4I9FA 1ILWA 1FXWF 5A4MS 3Q8MA 5LA6B 4ZYZA 1FNBA 2C31A 1K86A 3MILA 4UOEA 4RPGA 4UOZA 2RHLA 1EUQA 3RTEA 1Y6FA 1Z29A 3NHBA 2QR3A 1W0KA 2NZWA 1IDOA 1EFLA 1W30A 1CG6A 5K5EA 2I3AA 1GU0A 2IZ5A 4JUAA 3CCFA 3F7TA 3WBKA 5CT5A 5I7UA 4IFBA 4W7HA 2G72A 2WJ3A 3CSUA 1WX1A 3EVTA 4LFBB 1M9NA 3N8HA 5IBCA 3IUSA 1IAQA 3LLSA 2NYUA 2VWQA 3KWJA 3L7MA 4YH1A 3KEOA 5CDHA 4BO3A 5JSUA 2PRYA 2XMSA 3LA8A 4FJ0A 1KXJA 1G0NA 3D7RA 2C2WA 1KYYA 3GRCA 4DRXB 2UZ4A 2K2QB 4YCAA 3VPXA 4DSZA 4XR9A 5KSPA 1TQ4A 2XMQA 3I5MA 1BSVA 3ONDA 2EX1A 4B82A 1JI3A 4XM2A 2FPIB 3N9IA 1DRWA 1GP2A 2EG5A 2GJ9A 2QN9A 2DBYA 2JHPA 3IPAA 4NATA 4BQIA 5EINA 4M99A 2EJWA 4LGCA 2O2ZA 2GZDA 4CMIA 1C1XA 2WA2A 3LTEA 2Z2YA 4TVBA 4EHKA 3CVXA 3LY7A 1ZBDA 3O92A 4MWEA 3VSEA 1E2FA 3FVTA 5DB4A 5DTEA 4C14A 1EFAA 2A78A 2V7EA 4A0SA 4CM4B 3L1UA 1PWZA 3OQVA 4KH0A 1JXQA 3DGEC 3P2YA 1QTNA 3TTSA 4AO6A 3U4QB 3UGIA 3UO8B 3T4EA 2CF5A 5EHXA 1AOXA 5EX0A 4YP0A 2YCLA 4N8SA 4JI4B 2IPLA 3G2NA 2E87A 2DGDA 3PQ7A 4A4DA 4EAQA 5F9FA 4F38A 4AUNA 2BTOA 1LSJA 2DBVO 4FTWA 4QDXA 1BFDA 4GBGA 5LYJF 3A10A 3QLJA 1XQ1A 2DR3A 5B3KA 5FWYA 5KWIA 1FRVA 2O0JA 4GMGA 3ANMA 5FWAA 2ZVDA 1ZRNA 2ILTA 2QNRA 3CPJB 3Q9UA 2QJWA 5EJ9A 1NYTA 2XDWA 3LCCA 3DBOB 3MS7A 1Y9ZA 4AN1A 4D3SA 4ER3A 3QUBA 3PP8A 4MVJD 3AKCA 3O0TA 1RW4A 1HZZC 3LWNA 2WTXA 4RJJA 1IN6A 1FFYA 1U3TA 1RLJA 4X1OA 3ZD9A 5KSZA 5KTYA 2IH4A 5HS4A 2R9VA 3FJOA 3EIFA 2HU8A 3JQ9A 4GICA 1EK5A 1UP6A 1T0BA 2HWKA 3L1VA 3U4CA 5GJWC 2AFIE 4QM7A 4TZKA 2BDUA 1NW6A 4UQPA 4D0LB 1CXZA 3A9SA 2PUDA 1BEUB 1L5HB 1XZFA 2QTVB 4DZZA 4XWAA 2J3IA 3SMQA 2ICAA 3ZI4A 4EG3A 1SCNE 4Z8XA 2JLRA 2OB2A 1S6YA 4PZDA 4ABYA 4GL2A 5KC9A 1ZM7A 3AW9A 1ESZA 3BMNB 3SVZA 1XV5A 5DLQC 4G36A 5D6NA 2RH5A 1FARA 4ALIA 3GLHE 1DZ3A 4FSXA 5ALKA 2WF6A 1FNCA 1ZXBA 4KQ9A 4XQ0A 5AKZA 1RRGA 1EGQA 1QR2A 4H17A 4Q00A 3UW1A 5AW2A 1E2NA 3HFJA 4TZ6A 4URHA 2Y8EA 3HG7A 2QXTA 3FFXA 3CEHA 2YZNA 4MV5A 2ZE5A 3MBKA 1W46A 1XWFA 4XPIB 5D1NA 3DE4X 4XPZA 1IVYA 2RCNA 2J0VA 2H2HA 5EE9A 1RI5A 2GN1A 4BO7A 1ZGZA 1WXIA 4A15A 1CE8A 2QM8A 1O3YA 1L7PA 3BKWA 3OLZA 1NFRA 5GGYA 4OLFA 4QRIA 5NLLA 5CFNA 3S1AA 3GDHA 4JLKA 1QS0A 4M8IA 3FYCA 1IY1A 2XADA 3D0OA 1S0UA 4O4HB 1Z5PA 2HRBA 4IH4A 1EP9A 1C1HA 5FBKA 5KOJA 1GPH1 2C84A 2P7HA 4CMJA 2OBXA 2HMYB 2QZ9A 1MQAA 3ASUA 4KHZA 4DEYA 1E92A 1TJYA 2RJ3A 1U7OA 1YZNA 2DBRA 2JLBA 1LK0A 3OTQA 4NK5A 5B1YA 5BXYA 2WSIA 3IHWA 4KWHA 3WDKA 2UYQA 1EVKA 1JQ3A 1M6HA 2AA3A 3FSGA 5FT9A 2AXPA 3KKZA 4RKRA 4FCTA 5I01A 4Q7MB 1A9SA 2NYAA 3RUFA 1OW3B 2GKSA 4KIUA 2NU9A 3A1VA 3LC7O 3VX4A 2GN8A 3B1ZA 1F06A 4IJ5A 5KNDD 1HPTA 3NUQA 5BN5B 1XVUA 3RT7A 3MTAA 5KQPA 2P1RA 2PR7A 2IT1A 3FVVA 4X6XA 2HH9A 1XU9A 4MLCA 4D96A 1DADA 1HMPA 3FJYA 3OZBA 2QENA 2HOQA 2DKFA 3L8GA 5KMGA 4RD0A 1KEKA 1SFRA 5K3AA 4CIDA 4BO9A 2ALJA 1Q7BA 1TGSI 2FPOA 1KORA 4FYHA 1EZZA 4D6XA 3TB6A 2Q2VA 1AUOA 4KN6A 3RSQA 4BE7B 2WAXA 3CX3A 1LH0A 3M8KA 4KQKA 5JSFA 1OX5A 3JQ8B 3HC7A 3SQDA 1IB0A 4AZ0B 3PWSA 2DHDA 3VYTB 1O6FA 2I4MA 3EXEA 4V0RA 5KNCD 4TUYA 2GXSA 4JBWA 3P0IA 2P9EA 4RFLA 4BTVA 5EJ5A 4MRSA 3JY6A 1JMKC 1W9HA 1WUYA 1YS1X 1CVLA 3K5PA 3I72A 3PNSA 4LJKA 2XTNA 2Y1FA 1FJGB 5F12A 5G3ZA 1CZOA 3N2EA 1MG0A 1JQLB 2OQRA 4JOSA 3ZLVA 3ZXXA 1WZNA 2BRUC 1PJ3A 2Y76A 2ZAIA 5JAQA 2BKLA 4AX8A 1SG9A 1Z2DA 2GAJA 2JLYA 4KNVA 4RVDA 3RYFB 3VPHA 4FYWA 4NJEA 3KQMA 2A9QA 3MINB 3ETLA 3EFOA 1ZD3A 2D7CA 4Z5XA 1CUHA 1GILA 3B9QA 3L49A 4M7WA 4ZCQA 1P6QA 3G1UA 1THTA 2DHQA 2HK8A 1WSDA 2C1ZA 2IHVA 2Q1SA 3DEAA 1S2GA 4BNWA 2FWRA 2AB0A 3THWA 4EX6A 4XQGA 4OGLA 5C18A 4JCCA 2BCGY 5AKXA 5J4KA 3D0QA 5JW6A 1W0KD 2O5VA 4C01A 4NHOA 1QONA 1WPQA 5TVGA 1KE1A 1R9JA 3LBIA 4FDTA 5REQB 4CG3A 4FOSA 4OLHA 1A9PA 2FWNA 3MFYA 3KLBA 4ECEA 2Q0XA 1C0EA 2OORA 1LZLA 2XR1A 5B3LA 4D44A 1CZHA 2G9UA 1YE3A 1PDVA 5ALVA 1PWYE 4HT3B 3F7OA 5ADHA 3W5BA 1A1VA 5CB4A 1TLFA 2XECA 3QOYA 4UHFA 5DXFA 1JEQA 1ONSA 5JJLA 1WA5A 1O9GA 4MJLA 5LMNB 1H9AA 1N0VC 1WV0A 3LV8A 4AO8A 5JYDA 4R71A 1V3VA 2O3TA 3EQ8A 5A3VA 4QM6A 3QKUA 4D9IA 4JGBA 5B53A 3M7IA 2ZUDA 4JVOA 3T9EA 1YUNA 1EUCA 1QZXA 5AHWA 1ISHA 3Q7IA 2ZYAA 3NBXX 4WEOA 3TXAA 4I4TA 1FBTA 1U9ZA 3ZYCA 1AT1A 4QDUA 2WI8A 2OZUA 1D4ZA 1YKGA 2MINA 2D4HA 1Z74A 3F5DA 4PINA 5DHTA 1L4YA 4HMQA 1BXZA 2VPWA 1JSRA 3OCUA 4N6OA 1JNYA 1MDFA 4C89A 1ZCFA 4X7PA 5AM2A 4EG6A 5K8CA 2RGGA 5EZ6B 5TNXA 1T24A 9MHTA 3THXB 1MHTA 4GXNA 1I2ZA 1BRTA 1NNLA 1CR6A 4O8ZA 3QMVA 3A25A 1PO7A 2AHOA 4CQMD 5LKAA 3K6RA 2G9VA 3UXYA 4EA6A 2QUZA 2P1ZA 2GHIA 4KUHA 2FMTA 1HH4A 2G5GX 5LQMA 1BXGB 2ZIGA 2XZTA 2RGWA 3NT4A 4TTSA 5IJWA 2ZJ4A 4JLMA 3NWJA 2BSXA 1S9HA 2B4RO 4H35A 1BZYA 3HN2A 1SXHA 2QD1A 4AMBA 4BWVA 5JDIC 4HFMA 3TMKA 1RZVA 2CMFA 3SLRA 1SPBS 1W34A 2ESRA 2GJSA 1KI3A 2J67A 1T29A 3U1TA 1SVIA 3K0FB 3KWMA 4PCAA 4WVFA 5M04A 1XG5A 1QE5A 3DOIA 4XE5A 4DQDA 2X1VA 5CYFA 3AB3A 4OQQA 4MS1A 4GI3C 1UWVA 5BRJA 3JSXA 2HMTA 1OVOA 5E6UA 2QJRA 3VPDA 4O2AB 3V55A 1NR1A 3D8NA 4RSMA 4OKSA 4Q9KA 4WXPA 3D9QX 5JVDF 2PZGA 3AUFA 3NNDA 4W5OA 1W7AA 3MN1A 2X52A 1HUQA 4L9WA 5K3BA 3UMJA 4JBHA 5KQGA 4PTZA 1OBVA 2Q3JA 4JB3A 4ZI2A 1E9SA 1OXMA 3C8DA 3HQ4O 2H1RA 4G1VA 1KEEA 1VXRA 4YDQA 3NB0A 5KTRA 5BSMA 1NRIA 2V5VA 4ZA2A 3P9CA 5DOZA 4UFNA 2VYCA 1IM2A 1B0AA 3E35A 3URKA 3W3ZB 2W43A 1P9WA 1M6VA 2WWIA 6REQB 5IHPA 4XQ9A 3B52X 3HLKA 4PQRA 1P0MA 4ARVA 1TJPB 4G67A 3HCAA 1KMHA 1ZU5A 3MWKA 5CA0A 5BMVB 2NPOA 3FE2A 5CPBA 1CW2B 1DG9A 2V58A 4RH3A 5EXDA 5FORA 2V7UA 3FYTA 2PA0A 4JT8A 4W7SA 3IP8A 3ULKA 4YUZA 4CM8A 3B5JA 5B1DA 4G8CA 2R11A 4Z1OA 4HATA 1C8KA 3BILA 4BVKA 3LWZA 1LD3A 1FP4B 3D4OA 4J16C 1Y8QA 1U7TA 4N0QA 1BW9B 1L4FA 2OMKA 3A2LA 4KJXA 4KU4A 4L9AA 5I7RA 1GY8A 1KJNA 3P9ZA 1SVWA 2ZIWB 1L4HA 2Y9MB 4MGIR 4DTIA 3OJEA 4MV6A 1WF3A 2AOVA 2C5EA 3HE3A 4OHMA 3N1UA 3SDSA 1JEEA 2NX2A 2QAGA 4NV0A 1DOHA 1MO6A 4N0DA 4LHEA 4BMCA 4IS2A 4F1KA 3A4TA 5IK2D 1X4SA 3NASA 3IEXA 1QYWA 1E5XA 1U6JA 4Q4JA 3OE1A 3GB9A 3H0EA 5CYOA 1I94B 3A05A 1NNI1 3Q85A 1AU9A 1UPCA 1JKJA 1PJLA 1JEDA 1Y4UA 1UINA 2IX9A 2QT1A 1VJTA 5SYMA 4IJUA 1FDUA 1NNSA 2D8AA 1DIGA 1W1IA 3FR7A 1P17A 2XNDA 1QF7A 2I66A 4RZSA 5DN6A 3PXEA 2XE6A 2XUOA 2M98A 4IDAA 3H75A 3OHPA 4RFSB 1E1QD 2XVZA 4HZGA 1L5ZA 1UUCA 3FOAA 4NZZA 4M8KA 2VCYA 4WCFB 5KWVA 1RRVA 4PR3A 2O8CA 1O77A 2FYTA 1OT3A 4FPXA 1CQIA 3I9V1 1J2TA 1S5PA 1ZL0A 1PTRA 1TYEB 3PPVA 3UTDA 2GTHA 2BKVA 4B3XA 1RPNA 5JV5A 4PBTA 1SUFA 1TRKA 1ZC4A 2PKRA 1VPTA 3GFPA 3W8EA 1K8RA 4NESA 2YC2C 3OZFA 2IY8A 3WGGA 1RBMA 3T5BA 3PX2A 1N25A 4ZZ0A 4TTVA 5EVCA 1T35A 2VYFA 5DCWA 2OCYC 1FFCA 3O31A 4Y2JA 3ZHRA 2RJNA 4WBXC 4DZRA 4W5RA 1QH1B 3JQDA 4DSTA 1DPGA 3PR3A 4Y2SA 4WZBB 4NH0A 2CZCA 4DY6A 2OCPA 1PV4A 3OH8A 1IB6A 2I6GA 3F3MA 2H4WA 3T7IA 2G5CA 3MTDA 4LJ6A 5FBZA 3RE1A 4EFLA 2ZKLA 3LGSA 3U3KA 1N1GA 4KPFC 4C7KA 3VZBA 1ZMTA 2CZQA 4K86A 4MA4A 3N8IA 3MS4A 1TIPA 4W8HA 1OYVA 1U1FA 2R751 5M7EA 1F7VA 1FS6A 4M1ZA 4MI6A 5LP1A 4EI8A 1WNTA 2COUA 5FP0A 1L5SA 4DJFC 5HZHA 3ZI7A 1GR1A 4GRAA 4A1FA 3IAHA 4C3VA 4CT0A 4CUKA 4LYDA 4PPYA 5LA6A 1OJ7A 3BWXA 3KKMA 4GECA 1UJ4A 1VRCA 3LCVB 4FFRA 5F98A 5INTA 1R64A 1OHHD 2EKZA 2O57A 4OL9A 4P22A 4WZAE 4H7JA 2JAXA 4P3YA 4UM5A 2GILA 2C2GA 2J8ZA 2EWVA 4UUPA 2PUGA 2DKOA 4YMVA 3EW9A 3U56A 4AMLA 2G76A 3I83A 2FV8A 1TUSA 3RH0A 2B34A 3ET4A 5KSWB 3OESA 4JSTA 3F6CA 5JOQA 3OZEA 4UC0A 1Z7YA 4DRXA 5TMBA 5JNLA 2QQ0A 3A2NA 3RC1A 4IEEA 2P40A 1U5KA 4FZ3A 1SBHA 4J91A 2Q5JA 2ECQA 3QFFA 1MN6A 3T3EA 2OHFA 2FPIA 4C0BA 1V6AA 1I4WA 4JUCA 3OOYA 2OFPA 3CY6A 4LGVA 3WMGA 4D9NA 8ADHA 1BUSA 5IARA 2XYVA 2O7QA 4B34A 1XLVA 4ZKDA 2C54A 1Q83A 4OHYA 4PEVA 4WQMA 2WB2A 2VHTA 1QLWA 4PC7A 2NVOA 2C42A 1K7XB 3GVCA 4FC7A 4GYWA 4MLPA 3UWKA 1ZOPA 2VXCA 3L40A 4B6EA 5EX3A 2IU4A 2DP4E 4QSMA 4WLNA 2PIAA 2EFYA 4CM4A 1SKUA 1WUIS 3EVZA 3FHCB 1LQUA 1TUIA 4XYBA 4GLJA 1I2AA 1Y5IA 3H5AA 4M4SA 1A7AA 1YHNA 4PIMA 4Q1DA 1P2FA 3OJLA 4WJZA 4YASA 4YQZA 1Z17A 1NMEA 4EVSA 1OXTA 1L5LA 4PGAA 3EXHB 1J25A 1M0SA 1RM4A 2Y99A 4MQMA 3SZGA 1XVTA 2QUBA 4H1TA 4ACBA 2QQGA 2FG5A 2UYYA 4P38A 4P32A 2HHCA 1S89A 3G0DA 4PHTA 2ORWA 4ZRMA 5JTTA 4QT4A 2O8EB 1TU4A 4LY6A 3LDAA 1BYUA 1VIAA 4RKYA 3SPXA 1W94A 1JQJC 1V1IA 2WD7B 5IZCA 3RARA 1XI2A 1VJGA 3S5JA 5AI6A 5DU2A 3SJUA 3FLAA 1Z5WA 2P6AC 1U81A 5ICEA 3E82A 1DEHA 2XVMA 1H2RS 1YVUA 4K26A 4QFDA 3H1FA 1UC5B 2G4VA 1QM5A 1C41A 1YZVA 3H8JA 1J2EA 2BTEA 3AF1A 4NICA 4YUXA 5SY9A 1FTYA 2GK3A 2IZ1A 2ZRAA 3QEKA 4IDNA 4LJ9A 5DXAA 1UAYA 4N76A 4DDKA 2VR1A 4LTDA 3DO6A 4I3FA 1I10A 1E59A 1G2QA 3C6MA 4UVGA 2QTVA 1L5HA 1L6RA 2B3TA 2PKCA 3PIDA 3H3FA 3E23A 4BMZA 4P98A 2EJVA 3P19A 3D5QA 3IP6A 3K32A 3U26A 3ONVA 5HKKA 3BMNA 3LS2A 2HF2A 4ER0A 2AEMA 3VV2A 1ZU4A 1CU1A 1T9AA 3CPEA 4NNPA 1TECE 2NSDA 1FVOA 3UK2A 2C58A 1NT2A 5LKRA 2GF0A 3UG6A 4CEIB 2X6RA 4QNNA 2IYYA 3C8UA 3EIWA 3A3OA 1AS3A 1FA9A 3CSDA 4M76B 1KI7A 4UPDA 4M0DA 4XSHA 5FRDA 4WBNB 3BPSA 2FPLA 4ZHQB 4CF4A 1I3LA 2ZJ0A 3RADC 1CJUC 3GOHA 2DFKB 3U37A 4QTZA 4DR5B 4UAVA 1KETA 1XVAA 2L19A 4IV0A 4NCNA 3X1DA 4BNLA 2GLTA 3GJYA 4E30A 3VZDA 4JI3B 2HSGA 4RQBA 1GQOA 3AUUA 1ZAKA 2OZLB 3VVCA 2UXDB 5SYAA 1JHUA 1OKKA 1WTCA 4O4HA 2FAXA 2ZTUA 3V7NA 4Z4GA 1OFVA 5TS2A 3ZE6A 1S96A 4O4JB 1N7JA 4KRXA 4MVJF 4E15A 1DAEA 4BGIA 3HSKA 2ZW9A 3WI7A 5CXXA 2C7BA 3OQHA 5B1SA 1M8BA 2R96A 1Z4PX 2PXXA 3EEFA 3DB2A 5AHOA 3V00A 4H08A 5HHTA 5EHIA 3CG4A 4L0CA 3WMXA 3NXKA 2HMUA 2LP4Y 4PCLA 1G18A 3GRPA 1Y7IA 2XNDD 3BB3A 3D3WB 3I9OA 4GMKA 2O5CA 1U1GA 1GFSA 3MYYA 4PCUA 5I8ZA 2MMGA 4CKEA 3SN6A 1T2FA 3ZE1B 3IR5A 2XRMA 1RWPA 3F8TA 2J0EA 1E0DA 5BN5A 4AROA 4J9VA 4KUGA 2HLDA 2CSXA 1XN1A 3BE4A 3PCTA 1I7PA 2Q1XA 3MLEA 3I12A 4U3JA 1SUEA 1W48A 3KKKA 4DILA 1CWUA 4DXHA 4KLNA 4BU0A 1JJIA 2G4LA 3FTEA 2H1SA 3LYLA 4BECA 1GPYA 5BW6B 3U7FB 1DUVG 4O2LA 4RY8A 4YXFA 1YOBA 3BH6A 4DWJA 1AC5A 3SXJA 2IUYA 1LF5A 4B3RB 1PR4A 4IHJA 1IMOA 1G17A 1RBQA 1T26A 2ZRHA 4FW8A 4LRYA 3JQ8A 1JPUA 4J0GA 5ICSA 4L02A 4M8SA 4IQ0A 4AZ0A 5B7PA 2DFLA 1EYZA 2Q6LA 4TQGA 2R00A 4YRRA 4F5WA 4RJIA 1T8RA 4X44A 1DKRA 1IUOA 1Z34A 2EBWA 2R25B 3UHPA 4DNOA 4MINA 1I7QB 2HU5A 4XEHA 5I8PA 2X4LA 1QDEA 5FBVB 1UJ5A 3KLMX 3MPOA 3ZJVA 2C7OA 2Y0PA 2W6CX 4F60A 3WLIA 2BTQB 4JEMA 4JT4A 1M0EA 5IFLA 2NU7B 4BHTA 4HGZA 3RYFA 2NYVA 4UM7A 3H6GA 4KQHA 3MINA 4TTIA 3F46A 3OSZA 5DFAA 1M5RA 4ZMSA 4RMIA 4UNSA 2YVKA 2CWFA 5HCNA 1RIIA 3E9YA 1EE1A 1QFYA 1RZ3A 1Z9BA 3MCWA 4OQDA 1KKUA 2XQJA 5AVJA 3DMNA 2P2ZA 2JI6A 4LE1A 3VO1A 5EIFA 4K7JA 5IBRA 4C0QC 1J97A 3PICA 1PSDA 2Z4SA 3GOXA 2IHYA 4V39A 3WRXC 2W6OA 1GLNA 5BUQA 2BV3A 4QYSA 1T9CA 1EDZA 4QD3A 2VRWB 1Y8RB 4P5DA 4FP9A 2GXAA 2IH5A 3L07A 5D3KA 3CT4A 1SN7A 4GZ6A 2PWZA 1TM2A 1WSBA 1YR1A 3RTCA 2XTJA 1HG1A 3TIXB 1WSAA 2O2XA 3V8RA 2W2KB 4CKBB 2V7VA 3A6EA 1DC3A 1N5IA 4GX2A 1YXMA 5TV2A 1XKTA 3C3CA 4MAFA 1JJAA 2GEBA 4F2HA 1Z6XA 2Q5EA 1QLHA 2RBEA 2PUFA 3A06A 3D8UA 3SEKC 2QAIA 1BXRB 3FRHA 1CGII 4IVRA 5I4CA 4BFUA 4OU5A 2J5QA 1HE5A 1HYBA 1T4BA 4HXEB 3AHGA 2Q3EA 1GQYA 3COPA 1TJNA 3EC7A 3VHQA 1A82A 2XBUA 1BS9A 2QMQA 4XRRA 3F47A 4K40A 2Z3ZA 5ICGA 2FVXA 2YBDA 4F2PA 1FYWA 4Q39A 3M6FA 3U09A 1KYTA 2I2DA 4TTRA 1H2HA 1N2JA 4ZPJA 5H7XA 4C6HA 3SZOA 1XLTA 5LWHA 5JPCA 1U6KA 4TVSA 3ZPXA 3HUFA 4B47A 1QIMA 1ATZA 3QVOA 3CT6A 5AP9A 5SZIA 3THXA 3MBOA 1ZRHA 4TWJA 2O7VA 4MSUA 2PSDA 1NI4A 1JQ5A 2DG2A 5JYBA 2FCAA 1X1EA 1QANA 3MGBA 1FDSA 1OF1A 1R0KA 3HBMA 3GBSA 1BXGA 4HC4A 1ENOA 3M1LA 2O7SA 1MEOA 1VG0B 1GTMA 3DP9A 3K2IA 3EWAA 5FF9A 3M82A 4BWFB 2K7FA 3B2EA 2QU8A 1TM1E 1TDJA 2AC7A 2M6SA 3L8ZA 3P1JA 1TO2E 3SOZA 1D5CA 1RNLA 2PX4A 4PZCA 4WA7A 5A5FA 4XGKA 2VJCA 2ZI4A 3PXXA 2YQ4A 4F85A 1DCMA 1Z68A 2G71A 4OG2A 3PUZA 2ZZMA 2XCOA 4EW3A 1EQ2A 4TKVB 1Z0SA 3DV9A 5EJGA 1R7RA 3K0FA 4JYZA 1I9CA 4FS8A 3A4NA 1IW4A 5CK5A 8MHTA 2L42A 5E3IA 3NV9A 5DXJA 3N0WA 2A57A 4MEJA 1RFLA 3N2LA 4CI9A 4O2AA 2WA1A 1ZNYA 4FGJA 2QGZA 5KDLA 1UVFA 3OFKA 1H2XA 2ZTLA 1DELA 3BERA 1IRIA 1WR8A 4P83A 4KREA 3ESQA 4XWTA 4HY3A 4RYLA 1QQBA 3GUYA 3BMOB 2DWUA 4X8MA 2MT9A 5CFPA 1XNRB 5HKKD 3HCFA 2YWGA 3PEVA 1T9KA 2XW6A 4U7PB 4EYQA 4PTYA 3IEKA 3A6KA 4KX3A 1LS6A 3HH8A 2FW8A 2ZREA 1XZEA 1R0ZA 2HJ9A 2CHUA 3G9ZA 4WLVA 6REQA 3RJ5A 1HDOA 1HORA 1XNJA 3WB0A 6GPBA 1O95C 3WVNA 4AC9A 3TTYA 4YMHA 5BMVA 5J4VA 3VKUA 3T1HB 3H1EA 2GK6A 1OMUA 1M2VB 3HJGA 1OAOC 2OLEA 4GGMX 1JLMA 5BYBA 1PPFI 3QKWA 4PTLA 3RT9A 4CF5A 1Z3IX 3T7AA 2BKEA 1FP4A 3GJ0A 1TK2A 1BW9A 1L4NA 2BGNA 3A26A 3GMSA 3DDCA 1N57A 2AR9A 1GVHA 2HSZA 2D1FA 3QI7A 1EDBA 3OURA 4OXNA 1C50A 4S35A 4DMMA 1P4HA 1SVLA 2A30A 5IT5A 1SCKA 1WOYA 3NGLA 2IWHA 4AW9A 2ZRQA 2YS7A 2GGSA 3BIXA 4A6PA 4X54A 2FDCA 1VL1A 3X1KA 1NDQA 2ZRJA 2IIVA 1Z18A 3QZUA 5DI9A 1EXVA 3IC5A 1OREA 2YFKA 3BXXA 1Z62A 4FYMA 2VJDA 1RXIA 3V4ZA 4FLMA 4AQYB 5H80A 4YUAA 3M6XA 1P9ZA 4ERNA 5IYZA 3OTGA 4B9EA 2JLUA 5EESA 3WKDA 1NF9A 1WGTA 1KMQA 4NOKA 4A3SA 2H63A 2VC2B 2C0CA 4D42A 3I04M 3I9JA 2OESA 3VDMA 1KHTA 3ETEA 4RFSA 4DEXA 3D6MA 3IT3A 3IS3A 4WCFA 3IE1A 4CF3A 5BWLA 1WEHA 1D0SA 4HLUA 1VLMA 4RVUA 1A69A 4KYTA 2G1AA 2HLDD 5H59A 3GLHA 1T4MA 2IELA 4UEKA 1WVMA 2V7QD 4CL8A 1PX0A 3L7IA 3RDPA 1FP1D 4OI1A 1HFKA 1TI7A 1X1DA 3CRW1 4A8HA 1NW4A 2KMPA 1W6RA 1SGNI 1P1HA 2WFZA 1F4PA 2DRIA 2HBYA 1V35A 1DWOA 4G9GA 4X3PA 3JR7A 3HNPA 1HEYA 3ZWQA 2VF4X 1F0NA 3FFWA 2AZTA 3PC8A 4B46A 3BTVA 2VBGA 2RGDA 3RS5A 3D4IA 1NUTA 1MJAA 1P2SA 3ZD8A 1I1OA 3NDJA 1QH1A 2BD0A 3UMSA 1RWQA 4C7BA 5HWSA 2C78A 4MPPA 4W9MC 1D2NA 3REQB 4EI2A 3Q9NA 3H5NA 5HRUA 2M6KA 2FDXA 8GPBA 4CF6A 5JHHB 4IKEA 4FMDF 3T35A 2OAGA 3HJUA 2VPZA 2G08A 5CEEA 4OBBA 1O4WA 2CNDA 2H31A 2P8JA 2VJQA 4AAYA 3C3XA 3W34A 2B0CA 2E89A 2WJIA 4IIDA 1O0BA 1A5TA 1GNTA 1U90A 3DO8A 3M2PA 4FWBA 4HG2A 4TL7A 5TARA 4YGYA 4PICA 4MP6A 4ADSG 4A0QA 2HCRA 2KLBA 3COJA 1QYCA 1XKXA 3FH0A 4K6MA 1V1JA 4FXOA 3FI0A 3UAZA 3TW6A 5C8ZA 2XQKA 1NF3A 3PLNA 4MCIA 4KBGA 4X93A 3GA5A 1NJ5A 4YI5A 3IUBA 2IYLD 4JQYA 4LBZA 4UASA 2L2QA 2OP0A 5ARDA 3GNLA 1ODFA 1RI3A 4M53A 4PX5A 3OPNA 1GZ7A 2VZ0A 1DKPA 3DLTA 3UYKA 2GD6A 4IIFA 1XA6A 3VUFA 2RGNC 1PR5A 3M3DA 3M6VA 3Q8XB 3VNRA 4BATA 3MS2A 1PF7E 4N5IX 1NLFA 2ODWA 2VZEA 4TWBA 2C7RA 1QP7A 1M1YE 4M1QA 3FSXA 2HIGA 3CX8A 1Z7GA 3N2GB 2BMWA 5ALOA 4ZT7A 3GJ3A 3LVRE 1USUA 2X2FA 2IYWA 3NIFB 2QTCA 1A5AB 4YT8A 1NASA 3OFND 3S1LA 3DHYA 5AIBA 1OTXA 3GXBA 2KHZA 1ZRSA 2B5OA 3FYDA 4ZWNA 3U6KA 1JEYB 4QBFA 2ODDA 2QM0A 3MWDB 6NULA 2EZUA 5JALA 3QEMB 2GKTI 2AMFA 1A96A 2XQVA 5DNAA 5ESWA 3S7ZA 4BCBA 2C2MA 3WP1B 3NIGB 2IE0A 3MSCA 1FFXB 4JNKA 1M74A 4ZI7B 6YASA 3E70C 5FOQA 4W4TA 1P5FA 3EXHA 2QDXA 3EIEA 4C07A 2X9LA 2A0FA 3PUKA 1U0SY 5FEUA 4A5OA 5IS2A 1YZUA 3IQFA 4RPCA 3GGDA 3QKTA 4GXRA 4BB9A 2O8EA 2P4QA 2B8WA 4G63A 3FOBA 2B1QA 3VSAA 3QLUC 3A9WA 2K7ZA 2WD7A 1NBME 2NSHA 3WGQA 2P6MA 4K1LA 3VVLA 4ZYYA 1R4NA 1L7VC 3WLFA 3W9UA 2KWIA 4C08A 4CM6A 2C9OA 1T3GA 2XYRA 1FQOA 4BJ1A 2V74B 5CVTA 2NVWA 1CDZA 1H1DA 2ROWA 3DUWA 1IJEA 2HJWA 3IUMA 3MT7A 3PLRA 2XVXA 5CTJA 1SD1A 2GD0A 3P9KA 3RW9A 4M1OA 1PR0A 1JP7A 2WAYA 1XRNA 1NN1A 4U6NA 2D00A 4MUFA 3AZPA 2G80A 1RXUA 2DUJA 2QY9A 2VNIA 1CQXA 1RZRA 3QVUA 5JI3E 1DJOA 1KU0A 4JWTA 4P86A 1SBIA 3UMGA 3ESRA 5EE3A 1LDBA 4PWZA 4D8WA 2WJ6A 1WCYA 1Z0UA 4N7BA 4R9UC 4EHAA 5LIRA 4N5LA 1G8SA 1FP2A 1TJ4A 1LWNA 1Y1LA 2WE8A 3AEUA 1ENPA 5JZBA 1ZUD1 4Q1VA 4AQDA 2B30A 4TXJA 4CEIA 3VR6H 5EKXA 2Z8ZA 4PPFA 1SURA 1GPLA 2FB9A 2P5YA 3IEUA 2VP3A 4WIAA 4AMZA 4QU8A 2XF8A 3OZDA 3PNQA 1R10A 2WKWA 4Y2XA 1YZLA 4C22A 4WBNA 1N8KA 2O7NA 3P2IA 4ZHQA 3LHKA 4WXHA 1ZOLA 4DA7A 2XT6A 4RIIA 4ODIA 4F91B 4JLJA 5JFTA 4A0HA 2LXNA 3OU2A 5HF9A 1IJFA 3UXMA 1YS9A 3V6MA 5LDHA 3CJQA 3Q4GA 3I30X 1AZWA 4OK3A 4NIMA 3ZIUA 4IV8A 2IYSA 3C6ZA 1AGPA 3Q10A 4YREA 2OZLA 3GVHA 4OHOA 3X1XA 2WCYA 1D6JA 1XTQA 1O03A 1XTJA 1ZOIA 2RGAA 3N86A 4OGFA 2Q2NA 1G19A 4OV6B 4C03A 4AZSA 4O4JA 2GZHA 4KR7A 3ENWA 3H7IA 4Q18A 3KPUA 1CZKA 1XZIA 4OAQA 1TZCA 5LQKA 2PH7A 5CAEA 1L4LA 2AYZA 1B6SA 4OGWA 5KTKA 1RBYA 3JXEA 3IIJA 2N1MA 2FN9A 2ADOA 4O0MA 1RWXA 3EFEA 1U80A 4R2KA 1TBOA 2Q6OA 4RQTA 1NOJA 4HNUA 1HQYE 1FYVA 3FI9A 3D3WA 3HB9A 5EJAA 2C2HA 5E7IA 2J3EA 3TAXA 3VHXB 1Z0DA 4EYGA 2FOLA 3AXTA 3DEYX 4Q24A 4CR6A 3PJRA 3GRVA 4MB0A 3W7VA 1GA4A 2D2IA 1EVZA 2EFDB 3AR2A 3WISA 1GYRA 2IDJA 1YRBA 2WIFA 3LP5A 3ELUA 1CF4A 1CUXA 3DPSA 4ZOLB 3ADKA 3ETDA 4YALA 3RYTC 3TNJA 1WU7A 3NVDA 2CXTA 4W1PA 5ENZA 1XCMA 4QUAA 4MI9A 4AJ4A 4F71A 4G1EB 3VA7A 3D1JA 4WK6A 3UGJA 1V8DA 1FFEA 1YOVB 1FP7A 2H9IA 2ZI3A 1ZG3A 3KKNA 1A7JA 4RJKA 1VKRA 3GRRA 4U2KA 4BL5A 3CZMA 3BK2A 4RK4A 5L4NA 4DCCA 3I9V6 4L8GA 1QPGA 1U4OA 5DNEA 1HQCA 5CH8A 2CL6X 2BHLA 1HNXB 4BNXA 3KSBC 1USIA 5CLLA 4L07A 1P18A 1CQPA 2I8AA 2DUUA 3WDLA 1LBEA 1Y6JA 2ATEA 3WLEA 2OQVA 1NSFA 1K7UA 2PS9A 5I6DA 4XX0B 2PLWA 2WT8A 4D0NA 2AYYA 3TKLA 1NYLA 1GNQA 2YNMA 3JYHA 1RWBA 2ZB4A 3NU1A 4BO8A 1UL1X 3TKYA 4OVKA 5DHQA 5ED0A 2BTQA 3RS8A 1TYAE 4P58A 2NU7A 1Q1AA 2P65A 4DNCA 4IL5A 4Q03A 5JWOA 2XSZA 3QK7A 3PX3A 1ULBA 1ZC3A 4LDAA 3FLEA 3GDWA 4NE2A 4OSEA 2G63A 3FPKA 1JZQA 1N3LA 3JQAD 5BSHA 1PCXA 1UPTA 3KZKA 3NHYA 1KDOA 4TT3A 1XHLA 1T8TA 1G64A 5BSFA 2D7DA 3OF2A 3SQNA 3A7EA 3CR8A 1JKIA 4RTRA 2Y1KA 1X1RA 2DX7A 2OXEA 3L77A 4KFCA 3IVGA 3U4HA 5K7SA 2GEKA 1QSGA 2ZSFA 1C7FA 4TM7A 3DBIA 2VRWA 1Y8RA