1TOTA

Zz domain of cbp- a novel fold for a protein interaction module
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
52
structure length
52
Chain Sequence
GQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHTHKMVKWGLGLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CREB-binding protein
publication title ZZ domain of CBP: an unusual zinc finger fold in a protein interaction module
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 13
structure length 52
sequence length 52
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2004-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00569 ZZ Zinc finger, ZZ type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.90 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1totA00
2E5RA 2DIPA 2N1AB 1TOTA
chains in the Genus database with same CATH superfamily
1TURA 4AMLA 3OXLA 5E3RA 1WGCA 4HGUA 2W0TA 2GKTI 3BJIA 1MT1A 2WGCA 3UEJA 5FUWA 2DIPA 4UXHA 1CE3A 2OD1A 2LUYA 2JXDA 1HDLA 1H0ZA 2V1CC 4GI3C 1KBEA 1NUBA 3R5DA 1ULMA 2LEOA 3QAHA 4A24A 5JHWC 1FY7A 1PTQA 2NU1I 2N1AB 2PQ8A 1R0RI 2KMOA 4B6DA 2KMQA 5FUXA 3TO7A 1PCEA 1X74A 1ULNA 2A20A 1SGQI 2DKVA 1MJBA 2Y0MA 2XRCA 3CXLA 3OXGA 2GIVA 2F3CI 3FSXA 1CSOI 1NXUA 2ARPF 2ROWA 1YU6C 1K7TA 2ERWA 3RU0A 5CCLA 2B8TA 2GVIA 1OVOA 1OYVI 2NU3I 3UGDA 1Z2IA 3TJQA 2FNFX 2NU4I 4SGBI 1Y1CA 2CWFA 2ORVA 1CGII 1CHOI 1XX6A 1MJAA 3UFFA 2JYYA 2ORWA 1SGNI 4L9MA 3TO6A 1IW4A 2X52A 4E1PA 2OVOA 2WCYA 2JW6A 2VRWB 3HH2C 1UHAA 2JA1A 2ELIA 1CT2I 1AN1I 1TBOA 1W4RA 2V1CA 3R5CA 2KMPA 3D00A 1P9ZA 3GOXA 1Q9BA 1Y1BA 1VDDA 1U5KA 1TBRR 2N52A 2OU2A 3OL0A 5CCMA 5HQ8A 2QQDA 1WGTA 3E59A 1CGJI 2M5XA 3VE5A 1KBFA 1S20A 4WP4A 1WTJA 3VDPA 2QQ0A 1MJ9A 1TUSA 1ULKA 1V1IA 3VDUA 2YUUA 1HJAI 1M8BA 3OXFA 3MEKA 1BMOA 2CJSC 3FSYA 1OMUA 2SGEI 4OVOA 2OZUA 1TGSI 2E5RA 2UZ3A 3TO9A 5J8CA 3R5BA 3UGIA 5FUYA 1SGRI 5E3QA 2L8EA 2RIJA 5FUVA 2CWGA 1HEVA 3UEYA 2ODDA 1V1HA 5EX3A 2JZMA 2QQCA 1XBTA 3UOEA 1TOTA 2SGFI 2SGPI 2KMRA 1LR9A 1UUCA 2NU2I 3R5AA 4JCVE 3TOBA 1LR7A 3UGLA 3SGBI 1PJUA 1FAQA 2RC4A 1Y8FA 1CT0I 1TIHA 2ENNA 3QTLD 3PDNA 2LB7A 2ENZA 1WKXA 1TBQR 1CT4I 9WGAA 1DS2I 1IY6A 5E3PA 2UVOA 2GKRI 1DS3I 1PTRA 2DB6A 2J9RA 1UVFA 3QWPA 4UXJA 2GKVA 3KY9A 4MPIA 7WGAA 1FYBA 5J8FA 1K7UA 1K7VA 1SGYI 4FKDA 1TBNA 2NU0I 2QQEA 3SEKC 3FC3A 3SGQI 2K9HA 2J87A 1BUSA 1PPFI 1W3SA 3E2IA 1IY5A 1LR8A 1FARA 1SGPI 1Z7KB 2CWHA 3OVOA 2E73A 1SGEI 3B4VC 2YQPA 2P6AC 1RFHA 3TOAA 2KCXA 1UVGA 2SGDI 5EX0A 2N71A 5HI7A 4DNCA 1M8CA 1KMAA 4E1RA 5DAEA 4UXIA 2QPOA 2N17A 1N13A 1R79A 1YTPA 2B0UC 2WVJA 2BUSA 1X4SA 1XA6A 1P9GA 2L7XA 2SGQI 2V53A 2X3TA 1OMTA 1SGDI 1HPTA
chains in the Genus database with same CATH topology
1TURA 3OXLA 4HGUA 2W0TA 2GKTI 3BJIA 1MT1A 3UEJA 5FUWA 2DIPA 4UXHA 1CE3A 2OD1A 2LUYA 2JXDA 1HDLA 1H0ZA 2V1CC 4GI3C 1KBEA 1NUBA 2LEOA 4A24A 5JHWC 1PTQA 2NU1I 2N1AB 1R0RI 2KMOA 4B6DA 2KMQA 5FUXA 3UFFA 1PCEA 1X74A 2A20A 3CXLA 1SGQI 3OXGA 2XRCA 2F3CI 1CSOI 2ARPF 2ROWA 1YU6C 2ERWA 3RU0A 5CCLA 2B8TA 2GVIA 1OVOA 1OYVI 2NU3I 3UGDA 3TJQA 2FNFX 2NU4I 4SGBI 1Y1CA 2ORVA 1CGII 1CHOI 1XX6A 2JYYA 2ORWA 1SGNI 4L9MA 1IW4A 4E1PA 2OVOA 2WCYA 2JW6A 2VRWB 3HH2C 2JA1A 2ELIA 1CT2I 1AN1I 1TBOA 1W4RA 2V1CA 2KMPA 3D00A 3GOXA 1Y1BA 1VDDA 1U5KA 1TBRR 2N52A 3OL0A 5CCMA 5HQ8A 2QQDA 3E59A 1CGJI 2M5XA 3VE5A 1KBFA 3VDPA 2QQ0A 1V1IA 1TUSA 3VDUA 2YUUA 1HJAI 1M8BA 3OXFA 3MEKA 1BMOA 2CJSC 1OMUA 2SGEI 4OVOA 1TGSI 2E5RA 2UZ3A 3UGIA 5FUYA 1SGRI 2L8EA 5FUVA 3UEYA 2ODDA 1V1HA 5EX3A 2JZMA 2QQCA 1XBTA 1TOTA 2SGFI 2SGPI 2KMRA 1LR9A 1UUCA 2NU2I 4JCVE 1LR7A 3UGLA 3SGBI 1PJUA 1FAQA 1Y8FA 1CT0I 1TIHA 2ENNA 3QTLD 3PDNA 2ENZA 1TBQR 1CT4I 1DS2I 1IY6A 2GKRI 1DS3I 1PTRA 2DB6A 2J9RA 1UVFA 3QWPA 4UXJA 2GKVA 3KY9A 1FYBA 1SGYI 3SEKC 4FKDA 1TBNA 2NU0I 2QQEA 1BUSA 3FC3A 3SGQI 2K9HA 2J87A 1PPFI 1W3SA 3E2IA 1IY5A 1LR8A 1FARA 1SGPI 1Z7KB 3OVOA 2E73A 1SGEI 3B4VC 2YQPA 2P6AC 1RFHA 2KCXA 1UVGA 2SGDI 5EX0A 2N71A 5HI7A 1M8CA 1KMAA 4E1RA 5DAEA 4UXIA 2QPOA 2N17A 1N13A 1R79A 1YTPA 2B0UC 2WVJA 2BUSA 1X4SA 1XA6A 2L7XA 2SGQI 2V53A 1OMTA 1SGDI 1HPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5R A;  2DIP A;  2N1A B;  1TOT A; 
#chains in the Genus database with same CATH topology
 1TUR A;  4AML A;  3OXL A;  5E3R A;  1WGC A;  4HGU A;  2W0T A;  2GKT I;  3BJI A;  1MT1 A;  2WGC A;  3UEJ A;  5FUW A;  2DIP A;  4UXH A;  1CE3 A;  2OD1 A;  2LUY A;  2JXD A;  1HDL A;  1H0Z A;  2V1C C;  4GI3 C;  1KBE A;  1NUB A;  3R5D A;  1ULM A;  2LEO A;  3QAH A;  4A24 A;  5JHW C;  1FY7 A;  1PTQ A;  2NU1 I;  2N1A B;  2PQ8 A;  1R0R I;  2KMO A;  4B6D A;  2KMQ A;  5FUX A;  3TO7 A;  1PCE A;  1X74 A;  1ULN A;  2A20 A;  1SGQ I;  2DKV A;  1MJB A;  2Y0M A;  2XRC A;  3CXL A;  3OXG A;  2GIV A;  2F3C I;  3FSX A;  1CSO I;  1NXU A;  2ARP F;  2ROW A;  1YU6 C;  1K7T A;  2ERW A;  3RU0 A;  5CCL A;  2B8T A;  2GVI A;  1OVO A;  1OYV I;  2NU3 I;  3UGD A;  1Z2I A;  3TJQ A;  2FNF X;  2NU4 I;  4SGB I;  1Y1C A;  2CWF A;  2ORV A;  1CGI I;  1CHO I;  1XX6 A;  1MJA A;  3UFF A;  2JYY A;  2ORW A;  1SGN I;  4L9M A;  3TO6 A;  1IW4 A;  2X52 A;  4E1P A;  2OVO A;  2WCY A;  2JW6 A;  2VRW B;  3HH2 C;  1UHA A;  2JA1 A;  2ELI A;  1CT2 I;  1AN1 I;  1TBO A;  1W4R A;  2V1C A;  3R5C A;  2KMP A;  3D00 A;  1P9Z A;  3GOX A;  1Q9B A;  1Y1B A;  1VDD A;  1U5K A;  1TBR R;  2N52 A;  2OU2 A;  3OL0 A;  5CCM A;  5HQ8 A;  2QQD A;  1WGT A;  3E59 A;  1CGJ I;  2M5X A;  3VE5 A;  1KBF A;  1S20 A;  4WP4 A;  1WTJ A;  3VDP A;  2QQ0 A;  1MJ9 A;  1TUS A;  1ULK A;  1V1I A;  3VDU A;  2YUU A;  1HJA I;  1M8B A;  3OXF A;  3MEK A;  1BMO A;  2CJS C;  3FSY A;  1OMU A;  2SGE I;  4OVO A;  2OZU A;  1TGS I;  2E5R A;  2UZ3 A;  3TO9 A;  5J8C A;  3R5B A;  3UGI A;  5FUY A;  1SGR I;  5E3Q A;  2L8E A;  2RIJ A;  5FUV A;  2CWG A;  1HEV A;  3UEY A;  2ODD A;  1V1H A;  5EX3 A;  2JZM A;  2QQC A;  1XBT A;  3UOE A;  1TOT A;  2SGF I;  2SGP I;  2KMR A;  1LR9 A;  1UUC A;  2NU2 I;  3R5A A;  4JCV E;  3TOB A;  1LR7 A;  3UGL A;  3SGB I;  1PJU A;  1FAQ A;  2RC4 A;  1Y8F A;  1CT0 I;  1TIH A;  2ENN A;  3QTL D;  3PDN A;  2LB7 A;  2ENZ A;  1WKX A;  1TBQ R;  1CT4 I;  9WGA A;  1DS2 I;  1IY6 A;  5E3P A;  2UVO A;  2GKR I;  1DS3 I;  1PTR A;  2DB6 A;  2J9R A;  1UVF A;  3QWP A;  4UXJ A;  2GKV A;  3KY9 A;  4MPI A;  7WGA A;  1FYB A;  5J8F A;  1K7U A;  1K7V A;  1SGY I;  4FKD A;  1TBN A;  2NU0 I;  2QQE A;  3SEK C;  3FC3 A;  3SGQ I;  2K9H A;  2J87 A;  1BUS A;  1PPF I;  1W3S A;  3E2I A;  1IY5 A;  1LR8 A;  1FAR A;  1SGP I;  1Z7K B;  2CWH A;  3OVO A;  2E73 A;  1SGE I;  3B4V C;  2YQP A;  2P6A C;  1RFH A;  3TOA A;  2KCX A;  1UVG A;  2SGD I;  5EX0 A;  2N71 A;  5HI7 A;  4DNC A;  1M8C A;  1KMA A;  4E1R A;  5DAE A;  4UXI A;  2QPO A;  2N17 A;  1N13 A;  1R79 A;  1YTP A;  2B0U C;  2WVJ A;  2BUS A;  1X4S A;  1XA6 A;  1P9G A;  2L7X A;  2SGQ I;  2V53 A;  2X3T A;  1OMT A;  1SGD I;  1HPT A; 
#chains in the Genus database with same CATH homology
 1TUR A;  3OXL A;  4HGU A;  2W0T A;  2GKT I;  3BJI A;  1MT1 A;  3UEJ A;  5FUW A;  2DIP A;  4UXH A;  1CE3 A;  2OD1 A;  2LUY A;  2JXD A;  1HDL A;  1H0Z A;  2V1C C;  4GI3 C;  1KBE A;  1NUB A;  2LEO A;  4A24 A;  5JHW C;  1PTQ A;  2NU1 I;  2N1A B;  1R0R I;  2KMO A;  4B6D A;  2KMQ A;  5FUX A;  3UFF A;  1PCE A;  1X74 A;  2A20 A;  3CXL A;  1SGQ I;  3OXG A;  2XRC A;  2F3C I;  1CSO I;  2ARP F;  2ROW A;  1YU6 C;  2ERW A;  3RU0 A;  5CCL A;  2B8T A;  2GVI A;  1OVO A;  1OYV I;  2NU3 I;  3UGD A;  3TJQ A;  2FNF X;  2NU4 I;  4SGB I;  1Y1C A;  2ORV A;  1CGI I;  1CHO I;  1XX6 A;  2JYY A;  2ORW A;  1SGN I;  4L9M A;  1IW4 A;  4E1P A;  2OVO A;  2WCY A;  2JW6 A;  2VRW B;  3HH2 C;  2JA1 A;  2ELI A;  1CT2 I;  1AN1 I;  1TBO A;  1W4R A;  2V1C A;  2KMP A;  3D00 A;  3GOX A;  1Y1B A;  1VDD A;  1U5K A;  1TBR R;  2N52 A;  3OL0 A;  5CCM A;  5HQ8 A;  2QQD A;  3E59 A;  1CGJ I;  2M5X A;  3VE5 A;  1KBF A;  3VDP A;  2QQ0 A;  1V1I A;  1TUS A;  3VDU A;  2YUU A;  1HJA I;  1M8B A;  3OXF A;  3MEK A;  1BMO A;  2CJS C;  1OMU A;  2SGE I;  4OVO A;  1TGS I;  2E5R A;  2UZ3 A;  3UGI A;  5FUY A;  1SGR I;  2L8E A;  5FUV A;  3UEY A;  2ODD A;  1V1H A;  5EX3 A;  2JZM A;  2QQC A;  1XBT A;  1TOT A;  2SGF I;  2SGP I;  2KMR A;  1LR9 A;  1UUC A;  2NU2 I;  4JCV E;  1LR7 A;  3UGL A;  3SGB I;  1PJU A;  1FAQ A;  1Y8F A;  1CT0 I;  1TIH A;  2ENN A;  3QTL D;  3PDN A;  2ENZ A;  1TBQ R;  1CT4 I;  1DS2 I;  1IY6 A;  2GKR I;  1DS3 I;  1PTR A;  2DB6 A;  2J9R A;  1UVF A;  3QWP A;  4UXJ A;  2GKV A;  3KY9 A;  1FYB A;  1SGY I;  3SEK C;  4FKD A;  1TBN A;  2NU0 I;  2QQE A;  1BUS A;  3FC3 A;  3SGQ I;  2K9H A;  2J87 A;  1PPF I;  1W3S A;  3E2I A;  1IY5 A;  1LR8 A;  1FAR A;  1SGP I;  1Z7K B;  3OVO A;  2E73 A;  1SGE I;  3B4V C;  2YQP A;  2P6A C;  1RFH A;  2KCX A;  1UVG A;  2SGD I;  5EX0 A;  2N71 A;  5HI7 A;  1M8C A;  1KMA A;  4E1R A;  5DAE A;  4UXI A;  2QPO A;  2N17 A;  1N13 A;  1R79 A;  1YTP A;  2B0U C;  2WVJ A;  2BUS A;  1X4S A;  1XA6 A;  2L7X A;  2SGQ I;  2V53 A;  1OMT A;  1SGD I;  1HPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...