1TOTA

Zz domain of cbp- a novel fold for a protein interaction module
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
52
structure length
52
Chain Sequence
GQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHTHKMVKWGLGLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CREB-binding protein
publication title ZZ domain of CBP: an unusual zinc finger fold in a protein interaction module
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 13
structure length 52
sequence length 52
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2004-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00569 ZZ Zinc finger, ZZ type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.90 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1totA00
2DIPA 2N1AB 2E5RA 1TOTA
chains in the Genus database with same CATH superfamily
1P9ZA 3RU0A 2JA1A 3OVOA 2KMQA 2GIVA 3SEKC 2ODDA 2RIJA 3TO9A 1FY7A 1MJ9A 1OYVI 2J87A 1TIHA 4AMLA 3GOXA 1TBQR 1TOTA 1CGJI 1Y1CA 4DNCA 1KBFA 3UGLA 1RFHA 2JXDA 3UFFA 3TJQA 2WCYA 3QAHA 9WGAA 1R79A 3E2IA 2M5XA 3UGIA 2B8TA 2X52A 3OXFA 2CJSC 5HI7A 3UEYA 1SGNI 2DKVA 2A20A 1Q9BA 1ULNA 1LR9A 2SGQI 5CCMA 2ENNA 1IW4A 2PQ8A 4UXJA 2QQDA 1CT2I 3FSYA 3OL0A 1MT1A 3QTLD 1OVOA 5HQ8A 1XA6A 1VDDA 2QQCA 1UHAA 4UXHA 3UEJA 1CSOI 2ARPF 1CT0I 2NU2I 1UVFA 2YUUA 2GKTI 1K7VA 1PJUA 2KMOA 2CWFA 1K7UA 1CHOI 1UVGA 2V1CA 1MJBA 1PTRA 2WGCA 3OXGA 2FNFX 2ENZA 2GKVA 2V1CC 2SGEI 1TUSA 3R5AA 1SGDI 2RC4A 2OZUA 1TGSI 1SGQI 1UUCA 2ELIA 2GKRI 2QQ0A 2YQPA 2CWHA 2JZMA 4SGBI 2LUYA 1ULKA 1ULMA 1IY6A 1NXUA 1XX6A 1W4RA 1SGEI 2F3CI 1Z7KB 1YU6C 2VRWB 1PTQA 2B0UC 2DIPA 1FARA 1PPFI 2LEOA 1SGYI 2N52A 5E3PA 4B6DA 2ORWA 2N71A 2X3TA 4FKDA 1CE3A 3OXLA 5EX3A 1Y8FA 2NU0I 3D00A 3SGBI 1X4SA 1BUSA 3PDNA 1M8CA 4A24A 1NUBA 1SGPI 1WKXA 2E5RA 4E1RA 2NU4I 4MPIA 3VE5A 1Z2IA 1P9GA 3B4VC 3FSXA 1KMAA 1PCEA 1TBOA 5E3QA 2CWGA 3SGQI 1HEVA 4WP4A 2Y0MA 4E1PA 1WGTA 1K7TA 1XBTA 3HH2C 1DS2I 2NU1I 4UXIA 5FUWA 2SGDI 4OVOA 3R5DA 5EX0A 3VDUA 5CCLA 2QQEA 2ROWA 2ORVA 5JHWC 2KCXA 5E3RA 1MJAA 2KMPA 1FYBA 3FC3A 5DAEA 1N13A 2DB6A 1CT4I 4GI3C 2K9HA 1R0RI 2JW6A 2XRCA 2KMRA 3UOEA 2J9RA 3QWPA 1TBNA 1YTPA 1OMUA 1HJAI 2BUSA 4HGUA 1X74A 3R5BA 1M8BA 2OVOA 1KBEA 2V53A 3TOAA 2E73A 5FUVA 1V1HA 1V1IA 1BMOA 7WGAA 5J8FA 1OMTA 2L8EA 2LB7A 2SGPI 2UZ3A 1U5KA 3R5CA 5J8CA 1H0ZA 4L9MA 2OU2A 3UGDA 1TURA 1WGCA 3CXLA 1HPTA 1SGRI 3VDPA 1CGII 2OD1A 3TO7A 3TO6A 5FUXA 2L7XA 2JYYA 2GVIA 2N17A 1LR8A 2ERWA 3TOBA 3KY9A 1Y1BA 2W0TA 1HDLA 2UVOA 3BJIA 2N1AB 4JCVE 2WVJA 3E59A 1FAQA 1AN1I 1S20A 3MEKA 2NU3I 1LR7A 1TBRR 1WTJA 2QPOA 2P6AC 2SGFI 1IY5A 1DS3I 5FUYA 1W3SA
chains in the Genus database with same CATH topology
3RU0A 2JA1A 3OVOA 2KMQA 3SEKC 2ODDA 1OYVI 2J87A 1TIHA 3GOXA 1TBQR 1TOTA 1CGJI 1Y1CA 1KBFA 3UGLA 1RFHA 2JXDA 3UFFA 3TJQA 2WCYA 1R79A 3E2IA 2M5XA 3UGIA 2B8TA 3OXFA 5HI7A 2CJSC 3UEYA 1SGNI 2A20A 1LR9A 2SGQI 5CCMA 2ENNA 1IW4A 4UXJA 2QQDA 1CT2I 3OL0A 1MT1A 3QTLD 1OVOA 5HQ8A 1XA6A 1VDDA 2QQCA 4UXHA 3UEJA 1CSOI 2ARPF 1CT0I 2NU2I 1UVFA 2YUUA 2GKTI 1PJUA 2KMOA 1UVGA 1CHOI 2V1CA 1PTRA 3OXGA 2FNFX 2ENZA 2GKVA 2V1CC 2SGEI 1TUSA 1SGDI 1TGSI 1SGQI 1UUCA 2ELIA 2GKRI 2QQ0A 2YQPA 4SGBI 2JZMA 2LUYA 1IY6A 1XX6A 1W4RA 1SGEI 2F3CI 1Z7KB 1YU6C 2VRWB 1PTQA 2B0UC 2DIPA 1FARA 1PPFI 2LEOA 1SGYI 2N52A 4B6DA 2ORWA 2N71A 4FKDA 1CE3A 3OXLA 5EX3A 1Y8FA 2NU0I 3D00A 3SGBI 1X4SA 1BUSA 3PDNA 1M8CA 4A24A 1NUBA 1SGPI 2E5RA 4E1RA 2NU4I 3VE5A 3B4VC 1KMAA 1PCEA 1TBOA 3SGQI 4E1PA 1XBTA 3HH2C 1DS2I 2NU1I 4UXIA 5FUWA 2SGDI 4OVOA 5EX0A 3VDUA 5CCLA 2QQEA 2ROWA 2ORVA 5JHWC 2KCXA 2KMPA 1FYBA 3FC3A 5DAEA 1N13A 2DB6A 1CT4I 4GI3C 2K9HA 1R0RI 2JW6A 2XRCA 2KMRA 2J9RA 3QWPA 1YTPA 1TBNA 1OMUA 2BUSA 1HJAI 4HGUA 1X74A 1M8BA 2OVOA 1KBEA 2V53A 2E73A 5FUVA 1V1HA 1V1IA 1BMOA 1OMTA 2L8EA 2SGPI 2UZ3A 1U5KA 1H0ZA 4L9MA 3UGDA 1TURA 3VDPA 3CXLA 1HPTA 1SGRI 1CGII 2OD1A 5FUXA 2L7XA 2JYYA 2GVIA 2N17A 1LR8A 2ERWA 3KY9A 1Y1BA 2W0TA 1HDLA 3BJIA 2N1AB 4JCVE 2WVJA 3E59A 1FAQA 1AN1I 3MEKA 2NU3I 1LR7A 1TBRR 2QPOA 2SGFI 2P6AC 1IY5A 1DS3I 5FUYA 1W3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DIP A;  2N1A B;  2E5R A;  1TOT A; 
#chains in the Genus database with same CATH topology
 1P9Z A;  3RU0 A;  2JA1 A;  3OVO A;  2KMQ A;  2GIV A;  3SEK C;  2ODD A;  2RIJ A;  3TO9 A;  1FY7 A;  1MJ9 A;  1OYV I;  2J87 A;  1TIH A;  4AML A;  3GOX A;  1TBQ R;  1TOT A;  1CGJ I;  1Y1C A;  4DNC A;  1KBF A;  3UGL A;  1RFH A;  2JXD A;  3UFF A;  3TJQ A;  2WCY A;  3QAH A;  9WGA A;  1R79 A;  3E2I A;  2M5X A;  3UGI A;  2B8T A;  2X52 A;  3OXF A;  2CJS C;  5HI7 A;  3UEY A;  1SGN I;  2DKV A;  2A20 A;  1Q9B A;  1ULN A;  1LR9 A;  2SGQ I;  5CCM A;  2ENN A;  1IW4 A;  2PQ8 A;  4UXJ A;  2QQD A;  1CT2 I;  3FSY A;  3OL0 A;  1MT1 A;  3QTL D;  1OVO A;  5HQ8 A;  1XA6 A;  1VDD A;  2QQC A;  1UHA A;  4UXH A;  3UEJ A;  1CSO I;  2ARP F;  1CT0 I;  2NU2 I;  1UVF A;  2YUU A;  2GKT I;  1K7V A;  1PJU A;  2KMO A;  2CWF A;  1K7U A;  1CHO I;  1UVG A;  2V1C A;  1MJB A;  1PTR A;  2WGC A;  3OXG A;  2FNF X;  2ENZ A;  2GKV A;  2V1C C;  2SGE I;  1TUS A;  3R5A A;  1SGD I;  2RC4 A;  2OZU A;  1TGS I;  1SGQ I;  1UUC A;  2ELI A;  2GKR I;  2QQ0 A;  2YQP A;  2CWH A;  2JZM A;  4SGB I;  2LUY A;  1ULK A;  1ULM A;  1IY6 A;  1NXU A;  1XX6 A;  1W4R A;  1SGE I;  2F3C I;  1Z7K B;  1YU6 C;  2VRW B;  1PTQ A;  2B0U C;  2DIP A;  1FAR A;  1PPF I;  2LEO A;  1SGY I;  2N52 A;  5E3P A;  4B6D A;  2ORW A;  2N71 A;  2X3T A;  4FKD A;  1CE3 A;  3OXL A;  5EX3 A;  1Y8F A;  2NU0 I;  3D00 A;  3SGB I;  1X4S A;  1BUS A;  3PDN A;  1M8C A;  4A24 A;  1NUB A;  1SGP I;  1WKX A;  2E5R A;  4E1R A;  2NU4 I;  4MPI A;  3VE5 A;  1Z2I A;  1P9G A;  3B4V C;  3FSX A;  1KMA A;  1PCE A;  1TBO A;  5E3Q A;  2CWG A;  3SGQ I;  1HEV A;  4WP4 A;  2Y0M A;  4E1P A;  1WGT A;  1K7T A;  1XBT A;  3HH2 C;  1DS2 I;  2NU1 I;  4UXI A;  5FUW A;  2SGD I;  4OVO A;  3R5D A;  5EX0 A;  3VDU A;  5CCL A;  2QQE A;  2ROW A;  2ORV A;  5JHW C;  2KCX A;  5E3R A;  1MJA A;  2KMP A;  1FYB A;  3FC3 A;  5DAE A;  1N13 A;  2DB6 A;  1CT4 I;  4GI3 C;  2K9H A;  1R0R I;  2JW6 A;  2XRC A;  2KMR A;  3UOE A;  2J9R A;  3QWP A;  1TBN A;  1YTP A;  1OMU A;  1HJA I;  2BUS A;  4HGU A;  1X74 A;  3R5B A;  1M8B A;  2OVO A;  1KBE A;  2V53 A;  3TOA A;  2E73 A;  5FUV A;  1V1H A;  1V1I A;  1BMO A;  7WGA A;  5J8F A;  1OMT A;  2L8E A;  2LB7 A;  2SGP I;  2UZ3 A;  1U5K A;  3R5C A;  5J8C A;  1H0Z A;  4L9M A;  2OU2 A;  3UGD A;  1TUR A;  1WGC A;  3CXL A;  1HPT A;  1SGR I;  3VDP A;  1CGI I;  2OD1 A;  3TO7 A;  3TO6 A;  5FUX A;  2L7X A;  2JYY A;  2GVI A;  2N17 A;  1LR8 A;  2ERW A;  3TOB A;  3KY9 A;  1Y1B A;  2W0T A;  1HDL A;  2UVO A;  3BJI A;  2N1A B;  4JCV E;  2WVJ A;  3E59 A;  1FAQ A;  1AN1 I;  1S20 A;  3MEK A;  2NU3 I;  1LR7 A;  1TBR R;  1WTJ A;  2QPO A;  2P6A C;  2SGF I;  1IY5 A;  1DS3 I;  5FUY A;  1W3S A; 
#chains in the Genus database with same CATH homology
 3RU0 A;  2JA1 A;  3OVO A;  2KMQ A;  3SEK C;  2ODD A;  1OYV I;  2J87 A;  1TIH A;  3GOX A;  1TBQ R;  1TOT A;  1CGJ I;  1Y1C A;  1KBF A;  3UGL A;  1RFH A;  2JXD A;  3UFF A;  3TJQ A;  2WCY A;  1R79 A;  3E2I A;  2M5X A;  3UGI A;  2B8T A;  3OXF A;  5HI7 A;  2CJS C;  3UEY A;  1SGN I;  2A20 A;  1LR9 A;  2SGQ I;  5CCM A;  2ENN A;  1IW4 A;  4UXJ A;  2QQD A;  1CT2 I;  3OL0 A;  1MT1 A;  3QTL D;  1OVO A;  5HQ8 A;  1XA6 A;  1VDD A;  2QQC A;  4UXH A;  3UEJ A;  1CSO I;  2ARP F;  1CT0 I;  2NU2 I;  1UVF A;  2YUU A;  2GKT I;  1PJU A;  2KMO A;  1UVG A;  1CHO I;  2V1C A;  1PTR A;  3OXG A;  2FNF X;  2ENZ A;  2GKV A;  2V1C C;  2SGE I;  1TUS A;  1SGD I;  1TGS I;  1SGQ I;  1UUC A;  2ELI A;  2GKR I;  2QQ0 A;  2YQP A;  4SGB I;  2JZM A;  2LUY A;  1IY6 A;  1XX6 A;  1W4R A;  1SGE I;  2F3C I;  1Z7K B;  1YU6 C;  2VRW B;  1PTQ A;  2B0U C;  2DIP A;  1FAR A;  1PPF I;  2LEO A;  1SGY I;  2N52 A;  4B6D A;  2ORW A;  2N71 A;  4FKD A;  1CE3 A;  3OXL A;  5EX3 A;  1Y8F A;  2NU0 I;  3D00 A;  3SGB I;  1X4S A;  1BUS A;  3PDN A;  1M8C A;  4A24 A;  1NUB A;  1SGP I;  2E5R A;  4E1R A;  2NU4 I;  3VE5 A;  3B4V C;  1KMA A;  1PCE A;  1TBO A;  3SGQ I;  4E1P A;  1XBT A;  3HH2 C;  1DS2 I;  2NU1 I;  4UXI A;  5FUW A;  2SGD I;  4OVO A;  5EX0 A;  3VDU A;  5CCL A;  2QQE A;  2ROW A;  2ORV A;  5JHW C;  2KCX A;  2KMP A;  1FYB A;  3FC3 A;  5DAE A;  1N13 A;  2DB6 A;  1CT4 I;  4GI3 C;  2K9H A;  1R0R I;  2JW6 A;  2XRC A;  2KMR A;  2J9R A;  3QWP A;  1YTP A;  1TBN A;  1OMU A;  2BUS A;  1HJA I;  4HGU A;  1X74 A;  1M8B A;  2OVO A;  1KBE A;  2V53 A;  2E73 A;  5FUV A;  1V1H A;  1V1I A;  1BMO A;  1OMT A;  2L8E A;  2SGP I;  2UZ3 A;  1U5K A;  1H0Z A;  4L9M A;  3UGD A;  1TUR A;  3VDP A;  3CXL A;  1HPT A;  1SGR I;  1CGI I;  2OD1 A;  5FUX A;  2L7X A;  2JYY A;  2GVI A;  2N17 A;  1LR8 A;  2ERW A;  3KY9 A;  1Y1B A;  2W0T A;  1HDL A;  3BJI A;  2N1A B;  4JCV E;  2WVJ A;  3E59 A;  1FAQ A;  1AN1 I;  3MEK A;  2NU3 I;  1LR7 A;  1TBR R;  2QPO A;  2SGF I;  2P6A C;  1IY5 A;  1DS3 I;  5FUY A;  1W3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...