1TOTA

Zz domain of cbp- a novel fold for a protein interaction module
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
52
structure length
52
Chain Sequence
GQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHTHKMVKWGLGLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CREB-binding protein
publication title ZZ domain of CBP: an unusual zinc finger fold in a protein interaction module
pubmed doi rcsb
source organism Mus musculus
total genus 13
structure length 52
sequence length 52
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2004-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00569 ZZ Zinc finger, ZZ type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.90 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1totA00
1TOTA 2DIPA 2E5RA 2N1AB
chains in the Genus database with same CATH superfamily
1SGYI 3FC3A 1HEVA 5CCLA 2NU1I 2FNFX 1SGQI 2UVOA 1P9GA 4UXHA 1IW4A 1Q9BA 1KBFA 2E73A 3UGLA 1MJ9A 2QQCA 2JW6A 4DNCA 1UUCA 1TUSA 2N17A 1MJAA 1M8BA 1TBNA 2SGPI 1MT1A 1CHOI 1WGCA 1V1IA 2LUYA 3VDUA 5HI7A 5HQ8A 1CGJI 1TBRR 1TIHA 1X4SA 2J9RA 1PPFI 3PDNA 3FSXA 3SEKC 4A24A 3UGIA 5E3PA 2V1CA 2P6AC 4L9MA 1Y1CA 2QQDA 4E1RA 1MJBA 1PTRA 1W4RA 1WKXA 2PQ8A 5FUXA 2NU3I 1Y1BA 3OXGA 2QQ0A 4WP4A 4AMLA 1FARA 1PCEA 2B8TA 1TURA 2ODDA 2Y0MA 1K7VA 1R0RI 2YQPA 3OL0A 3UEYA 2UZ3A 1K7UA 1OVOA 2B0UC 1IY5A 3R5AA 2LEOA 5CCMA 5EX0A 3OVOA 2L8EA 1UVFA 2CWGA 2DB6A 2X52A 3SGBI 2RIJA 1HPTA 3R5CA 1FAQA 2OU2A 3RU0A 1WTJA 2ENNA 4E1PA 1SGPI 2ROWA 1LR9A 3GOXA 1ULMA 3E59A 5FUWA 1PTQA 1TBOA 2JYYA 2NU4I 1X74A 2SGQI 2OVOA 2WCYA 3TO6A 4SGBI 1DS2I 3QWPA 2CWHA 2L7XA 3R5BA 1S20A 5E3QA 2N1AB 1BUSA 5DAEA 1TBQR 1Z7KB 2CJSC 2WVJA 3UOEA 3TO7A 5FUYA 2XRCA 4MPIA 3KY9A 1LR7A 2GVIA 2RC4A 2SGEI 3FSYA 3B4VC 2BUSA 4FKDA 2F3CI 3VE5A 5EX3A 2GKVA 2KMOA 2X3TA 2NU0I 1SGEI 2DIPA 1SGDI 2OZUA 7WGAA 1CGII 2ORWA 3D00A 2K9HA 1IY6A 4HGUA 3QAHA 1CT4I 2SGFI 3TO9A 1CT0I 1LR8A 4UXIA 2ORVA 1FYBA 2J87A 2GKTI 1ULNA 1VDDA 1XX6A 2OD1A 1DS3I 1ULKA 1Z2IA 2ARPF 3E2IA 2GIVA 1SGRI 2ERWA 2GKRI 2V1CC 5E3RA 1XBTA 1U5KA 1M8CA 2CWFA 1OYVI 2A20A 1W3SA 2SGDI 3BJIA 1OMTA 2NU2I 3SGQI 2LB7A 3TOAA 2ENZA 3TOBA 2JXDA 1BMOA 3UEJA 2KMQA 1HDLA 1RFHA 3VDPA 2JA1A 3CXLA 1V1HA 2DKVA 5JHWC 3R5DA 1FY7A 4OVOA 5J8FA 1PJUA 1YU6C 2QQEA 1K7TA 1TOTA 1CE3A 1R79A 4B6DA 2KCXA 3UGDA 2JZMA 1AN1I 2N71A 2WGCA 1KMAA 3TJQA 2N52A 2VRWB 3OXLA 3UFFA 2QPOA 3HH2C 2V53A 4GI3C 1KBEA 1WGTA 5FUVA 4JCVE 1N13A 1YTPA 1H0ZA 1Y8FA 1P9ZA 4UXJA 1CT2I 3QTLD 5J8CA 1SGNI 2YUUA 1HJAI 1NXUA 1TGSI 2ELIA 2KMPA 3OXFA 1NUBA 2M5XA 3MEKA 1OMUA 1CSOI 1UVGA 2E5RA 2KMRA 1UHAA 2W0TA 1XA6A 9WGAA
chains in the Genus database with same CATH topology
1SGYI 3FC3A 5CCLA 2NU1I 2FNFX 1SGQI 4UXHA 1IW4A 1KBFA 2E73A 3UGLA 2QQCA 2JW6A 1UUCA 1TUSA 2N17A 1M8BA 1TBNA 2SGPI 1MT1A 1CHOI 1V1IA 2LUYA 3VDUA 5HI7A 5HQ8A 1CGJI 1TBRR 1TIHA 1X4SA 2J9RA 1PPFI 3PDNA 3SEKC 4A24A 3UGIA 2V1CA 2P6AC 4L9MA 1Y1CA 2QQDA 4E1RA 1PTRA 1W4RA 5FUXA 2NU3I 1Y1BA 3OXGA 2QQ0A 1FARA 1PCEA 2B8TA 1TURA 2ODDA 2YQPA 3OL0A 1R0RI 3UEYA 2UZ3A 1OVOA 2B0UC 1IY5A 2LEOA 5CCMA 5EX0A 3OVOA 2L8EA 1UVFA 2DB6A 3SGBI 1HPTA 1FAQA 3RU0A 2ENNA 4E1PA 1SGPI 2ROWA 1LR9A 3GOXA 3E59A 5FUWA 1PTQA 1TBOA 2JYYA 2NU4I 1X74A 2SGQI 2OVOA 2WCYA 4SGBI 1DS2I 3QWPA 2L7XA 2N1AB 1BUSA 5DAEA 1TBQR 1Z7KB 2CJSC 2WVJA 5FUYA 2XRCA 3KY9A 1LR7A 2GVIA 2SGEI 3B4VC 2BUSA 4FKDA 2F3CI 3VE5A 5EX3A 2GKVA 2KMOA 2NU0I 1SGEI 2DIPA 1SGDI 1CGII 2ORWA 3D00A 2K9HA 1IY6A 4HGUA 1CT4I 2SGFI 1CT0I 1LR8A 4UXIA 2ORVA 1FYBA 2J87A 2GKTI 1VDDA 1XX6A 2OD1A 1DS3I 2ARPF 3E2IA 1SGRI 2ERWA 2GKRI 2V1CC 1XBTA 1U5KA 1M8CA 3BJIA 1OYVI 2A20A 1W3SA 2SGDI 3SGQI 1OMTA 2NU2I 2ENZA 2JXDA 1BMOA 3UEJA 2KMQA 1HDLA 1RFHA 3VDPA 2JA1A 3CXLA 1V1HA 5JHWC 4OVOA 1PJUA 1YU6C 2QQEA 1TOTA 1CE3A 1R79A 4B6DA 2KCXA 3UGDA 2JZMA 1AN1I 2N71A 1KMAA 3TJQA 2N52A 2VRWB 3OXLA 3UFFA 2QPOA 3HH2C 2V53A 4GI3C 1KBEA 5FUVA 1H0ZA 4JCVE 1N13A 1YTPA 1Y8FA 4UXJA 1CT2I 3QTLD 1SGNI 2YUUA 1HJAI 1TGSI 2ELIA 2KMPA 3OXFA 1NUBA 2M5XA 3MEKA 1OMUA 1CSOI 1UVGA 2E5RA 2KMRA 2W0TA 1XA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TOT A;  2DIP A;  2E5R A;  2N1A B; 
#chains in the Genus database with same CATH topology
 1SGY I;  3FC3 A;  1HEV A;  5CCL A;  2NU1 I;  2FNF X;  1SGQ I;  2UVO A;  1P9G A;  4UXH A;  1IW4 A;  1Q9B A;  1KBF A;  2E73 A;  3UGL A;  1MJ9 A;  2QQC A;  2JW6 A;  4DNC A;  1UUC A;  1TUS A;  2N17 A;  1MJA A;  1M8B A;  1TBN A;  2SGP I;  1MT1 A;  1CHO I;  1WGC A;  1V1I A;  2LUY A;  3VDU A;  5HI7 A;  5HQ8 A;  1CGJ I;  1TBR R;  1TIH A;  1X4S A;  2J9R A;  1PPF I;  3PDN A;  3FSX A;  3SEK C;  4A24 A;  3UGI A;  5E3P A;  2V1C A;  2P6A C;  4L9M A;  1Y1C A;  2QQD A;  4E1R A;  1MJB A;  1PTR A;  1W4R A;  1WKX A;  2PQ8 A;  5FUX A;  2NU3 I;  1Y1B A;  3OXG A;  2QQ0 A;  4WP4 A;  4AML A;  1FAR A;  1PCE A;  2B8T A;  1TUR A;  2ODD A;  2Y0M A;  1K7V A;  1R0R I;  2YQP A;  3OL0 A;  3UEY A;  2UZ3 A;  1K7U A;  1OVO A;  2B0U C;  1IY5 A;  3R5A A;  2LEO A;  5CCM A;  5EX0 A;  3OVO A;  2L8E A;  1UVF A;  2CWG A;  2DB6 A;  2X52 A;  3SGB I;  2RIJ A;  1HPT A;  3R5C A;  1FAQ A;  2OU2 A;  3RU0 A;  1WTJ A;  2ENN A;  4E1P A;  1SGP I;  2ROW A;  1LR9 A;  3GOX A;  1ULM A;  3E59 A;  5FUW A;  1PTQ A;  1TBO A;  2JYY A;  2NU4 I;  1X74 A;  2SGQ I;  2OVO A;  2WCY A;  3TO6 A;  4SGB I;  1DS2 I;  3QWP A;  2CWH A;  2L7X A;  3R5B A;  1S20 A;  5E3Q A;  2N1A B;  1BUS A;  5DAE A;  1TBQ R;  1Z7K B;  2CJS C;  2WVJ A;  3UOE A;  3TO7 A;  5FUY A;  2XRC A;  4MPI A;  3KY9 A;  1LR7 A;  2GVI A;  2RC4 A;  2SGE I;  3FSY A;  3B4V C;  2BUS A;  4FKD A;  2F3C I;  3VE5 A;  5EX3 A;  2GKV A;  2KMO A;  2X3T A;  2NU0 I;  1SGE I;  2DIP A;  1SGD I;  2OZU A;  7WGA A;  1CGI I;  2ORW A;  3D00 A;  2K9H A;  1IY6 A;  4HGU A;  3QAH A;  1CT4 I;  2SGF I;  3TO9 A;  1CT0 I;  1LR8 A;  4UXI A;  2ORV A;  1FYB A;  2J87 A;  2GKT I;  1ULN A;  1VDD A;  1XX6 A;  2OD1 A;  1DS3 I;  1ULK A;  1Z2I A;  2ARP F;  3E2I A;  2GIV A;  1SGR I;  2ERW A;  2GKR I;  2V1C C;  5E3R A;  1XBT A;  1U5K A;  1M8C A;  2CWF A;  1OYV I;  2A20 A;  1W3S A;  2SGD I;  3BJI A;  1OMT A;  2NU2 I;  3SGQ I;  2LB7 A;  3TOA A;  2ENZ A;  3TOB A;  2JXD A;  1BMO A;  3UEJ A;  2KMQ A;  1HDL A;  1RFH A;  3VDP A;  2JA1 A;  3CXL A;  1V1H A;  2DKV A;  5JHW C;  3R5D A;  1FY7 A;  4OVO A;  5J8F A;  1PJU A;  1YU6 C;  2QQE A;  1K7T A;  1TOT A;  1CE3 A;  1R79 A;  4B6D A;  2KCX A;  3UGD A;  2JZM A;  1AN1 I;  2N71 A;  2WGC A;  1KMA A;  3TJQ A;  2N52 A;  2VRW B;  3OXL A;  3UFF A;  2QPO A;  3HH2 C;  2V53 A;  4GI3 C;  1KBE A;  1WGT A;  5FUV A;  4JCV E;  1N13 A;  1YTP A;  1H0Z A;  1Y8F A;  1P9Z A;  4UXJ A;  1CT2 I;  3QTL D;  5J8C A;  1SGN I;  2YUU A;  1HJA I;  1NXU A;  1TGS I;  2ELI A;  2KMP A;  3OXF A;  1NUB A;  2M5X A;  3MEK A;  1OMU A;  1CSO I;  1UVG A;  2E5R A;  2KMR A;  1UHA A;  2W0T A;  1XA6 A;  9WGA A; 
#chains in the Genus database with same CATH homology
 1SGY I;  3FC3 A;  5CCL A;  2NU1 I;  2FNF X;  1SGQ I;  4UXH A;  1IW4 A;  1KBF A;  2E73 A;  3UGL A;  2QQC A;  2JW6 A;  1UUC A;  1TUS A;  2N17 A;  1M8B A;  1TBN A;  2SGP I;  1MT1 A;  1CHO I;  1V1I A;  2LUY A;  3VDU A;  5HI7 A;  5HQ8 A;  1CGJ I;  1TBR R;  1TIH A;  1X4S A;  2J9R A;  1PPF I;  3PDN A;  3SEK C;  4A24 A;  3UGI A;  2V1C A;  2P6A C;  4L9M A;  1Y1C A;  2QQD A;  4E1R A;  1PTR A;  1W4R A;  5FUX A;  2NU3 I;  1Y1B A;  3OXG A;  2QQ0 A;  1FAR A;  1PCE A;  2B8T A;  1TUR A;  2ODD A;  2YQP A;  3OL0 A;  1R0R I;  3UEY A;  2UZ3 A;  1OVO A;  2B0U C;  1IY5 A;  2LEO A;  5CCM A;  5EX0 A;  3OVO A;  2L8E A;  1UVF A;  2DB6 A;  3SGB I;  1HPT A;  1FAQ A;  3RU0 A;  2ENN A;  4E1P A;  1SGP I;  2ROW A;  1LR9 A;  3GOX A;  3E59 A;  5FUW A;  1PTQ A;  1TBO A;  2JYY A;  2NU4 I;  1X74 A;  2SGQ I;  2OVO A;  2WCY A;  4SGB I;  1DS2 I;  3QWP A;  2L7X A;  2N1A B;  1BUS A;  5DAE A;  1TBQ R;  1Z7K B;  2CJS C;  2WVJ A;  5FUY A;  2XRC A;  3KY9 A;  1LR7 A;  2GVI A;  2SGE I;  3B4V C;  2BUS A;  4FKD A;  2F3C I;  3VE5 A;  5EX3 A;  2GKV A;  2KMO A;  2NU0 I;  1SGE I;  2DIP A;  1SGD I;  1CGI I;  2ORW A;  3D00 A;  2K9H A;  1IY6 A;  4HGU A;  1CT4 I;  2SGF I;  1CT0 I;  1LR8 A;  4UXI A;  2ORV A;  1FYB A;  2J87 A;  2GKT I;  1VDD A;  1XX6 A;  2OD1 A;  1DS3 I;  2ARP F;  3E2I A;  1SGR I;  2ERW A;  2GKR I;  2V1C C;  1XBT A;  1U5K A;  1M8C A;  3BJI A;  1OYV I;  2A20 A;  1W3S A;  2SGD I;  3SGQ I;  1OMT A;  2NU2 I;  2ENZ A;  2JXD A;  1BMO A;  3UEJ A;  2KMQ A;  1HDL A;  1RFH A;  3VDP A;  2JA1 A;  3CXL A;  1V1H A;  5JHW C;  4OVO A;  1PJU A;  1YU6 C;  2QQE A;  1TOT A;  1CE3 A;  1R79 A;  4B6D A;  2KCX A;  3UGD A;  2JZM A;  1AN1 I;  2N71 A;  1KMA A;  3TJQ A;  2N52 A;  2VRW B;  3OXL A;  3UFF A;  2QPO A;  3HH2 C;  2V53 A;  4GI3 C;  1KBE A;  5FUV A;  1H0Z A;  4JCV E;  1N13 A;  1YTP A;  1Y8F A;  4UXJ A;  1CT2 I;  3QTL D;  1SGN I;  2YUU A;  1HJA I;  1TGS I;  2ELI A;  2KMP A;  3OXF A;  1NUB A;  2M5X A;  3MEK A;  1OMU A;  1CSO I;  1UVG A;  2E5R A;  2KMR A;  2W0T A;  1XA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...