1TGSI

Three-dimensional structure of the complex between pancreatic secretory inhibitor (kazal type) and trypsinogen at 1.8 angstroms resolution. structure solution, crystallographic refinement and preliminary structural interpretation
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
56
structure length
56
Chain Sequence
b'TSPQREATCTSEVSGCPKIYNPVCGTDGITYSNECVLCSENKKRQTPVLIQKSGPC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSINOGEN
publication title Three-dimensional structure of the complex between pancreatic secretory trypsin inhibitor (Kazal type) and trypsinogen at 1.8 A resolution. Structure solution, crystallographic refinement and preliminary structural interpretation.
pubmed doi rcsb
source organism Bos taurus
molecule tags Complex (proteinase/inhibitor)
total genus 13
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1982-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1tgsI00
1R0RI 1IY6A 1MT1A 2KMQA 1PCEA 1OVOA 1LR8A 2SGEI 2NU2I 1Y1CA 1CGII 2F3CI 3HH2C 2NU1I 1PJUA 2OVOA 1PPFI 1LR7A 2SGQI 2JYYA 3TJQA 1YTPA 1CSOI 1OYVI 2SGPI 1CT0I 2GKRI 2KCXA 2BUSA 1CT4I 1TBRR 1HJAI 3SGBI 2M5XA 1IW4A 2ARPF 1TBQR 1AN1I 2JXDA 2LEOA 2QQDA 2N52A 1HDLA 1YU6C 1TGSI 1Z7KB 1M8CA 1N13A 5DAEA 2QQCA 2KMRA 2JZMA 2NU3I 2ERWA 5JHWC 2KMPA 4OVOA 2NU0I 1HPTA 1TUSA 4SGBI 3OVOA 2N71A 3SEKC 1OMUA 2XRCA 3QTLD 1BMOA 2P6AC 1CHOI 1SGDI 1SGYI 2GKVA 2GKTI 1CE3A 2NU4I 1BUSA 2SGDI 1DS2I 1IY5A 3SGQI 1TURA 1KMAA 1UVGA 2WCYA 1SGPI 1Y1BA 1SGEI 2N17A 1SGQI 3B4VC 1LR9A 1FYBA 1SGRI 1NUBA 1UUCA 1M8BA 1OMTA 1SGNI 1CGJI 2V53A 4GI3C 1H0ZA 2SGFI 1CT2I 1UVFA 4HGUA 1TIHA 2KMOA 2B0UC 1DS3I
chains in the Genus database with same CATH superfamily
1R0RI 3UGDA 4E1PA 1IY6A 1MT1A 1UHAA 3VDPA 1WTJA 3VDUA 2LUYA 2CWHA 3UGIA 2KMQA 3BJIA 1PCEA 1OVOA 2E73A 4L9MA 4AMLA 1R79A 1FARA 5FUYA 3UEJA 2X3TA 1LR8A 3E59A 2WGCA 3MEKA 3TO7A 1MJBA 2SGEI 2NU2I 1Y1CA 4MPIA 1CGII 2F3CI 3HH2C 2NU1I 2UVOA 1Q9BA 1V1HA 1PJUA 4A24A 2OVOA 1PPFI 1LR7A 2JA1A 2SGQI 2OU2A 4DNCA 2JYYA 3TJQA 3QAHA 3TO6A 3OXLA 1Y8FA 1YTPA 3E2IA 1CSOI 5E3QA 5FUXA 2RC4A 1OYVI 2SGPI 1K7TA 1CT0I 2GKRI 2KCXA 2W0TA 2L7XA 2UZ3A 2ROWA 1U5KA 2WVJA 2BUSA 3D00A 1CT4I 1HEVA 1PTQA 1TBRR 1ULKA 2ORWA 5E3RA 5CCMA 2YUUA 1X74A 2GVIA 2VRWB 1HJAI 3UOEA 3SGBI 2CWFA 1PTRA 1X4SA 2M5XA 3FC3A 1IW4A 2ARPF 2ELIA 1TBQR 1ULNA 1AN1I 2CJSC 2JXDA 2LEOA 2QQDA 2N52A 3OXGA 5HI7A 3UGLA 1HDLA 2J87A 1YU6C 1TGSI 2ENZA 5EX0A 1Z7KB 3FSYA 1M8CA 1N13A 5DAEA 3TOAA 3TO9A 2QQCA 2QQ0A 2E5RA 3R5DA 1KBEA 2KMRA 2YQPA 1RFHA 2ENNA 2JZMA 2NU3I 5HQ8A 2ERWA 5JHWC 4B6DA 2KMPA 1KBFA 4OVOA 1ULMA 2NU0I 3CXLA 3GOXA 1HPTA 3TOBA 2OZUA 1TUSA 1P9GA 3UEYA 4SGBI 1FAQA 3OVOA 1XA6A 3R5AA 1XBTA 1WKXA 2N71A 1OMUA 1V1IA 1W3SA 2RIJA 2XRCA 2V1CA 3RU0A 3SEKC 3QTLD 1BMOA 1S20A 2P6AC 1CHOI 1SGDI 3UFFA 2J9RA 1SGYI 1W4RA 3FSXA 2GKVA 7WGAA 3PDNA 4FKDA 2GKTI 5FUVA 1CE3A 2NU4I 2FNFX 2X52A 5EX3A 3QWPA 1BUSA 2SGDI 1VDDA 2Y0MA 3R5CA 1DS2I 4UXIA 4UXHA 2CWGA 1IY5A 3SGQI 1TURA 2QQEA 2ODDA 1KMAA 1TBOA 1TBNA 3OL0A 1UVGA 1P9ZA 2DB6A 2DKVA 5J8CA 1WGCA 2WCYA 1SGPI 2DIPA 2JW6A 4WP4A 4JCVE 1Y1BA 1SGEI 2GIVA 2N17A 1FY7A 1Z2IA 9WGAA 1SGQI 3B4VC 5FUWA 1LR9A 2ORVA 1TOTA 1FYBA 1SGRI 2OD1A 4UXJA 5E3PA 3R5BA 1NXUA 1NUBA 4E1RA 1UUCA 2V1CC 1MJ9A 1M8BA 1K7UA 1OMTA 1XX6A 1SGNI 1CGJI 2V53A 2QPOA 1WGTA 2A20A 2N1AB 4GI3C 2K9HA 3VE5A 5J8FA 3OXFA 1H0ZA 2SGFI 1CT2I 1UVFA 3KY9A 4HGUA 2L8EA 1TIHA 2KMOA 2LB7A 2B0UC 1K7VA 2PQ8A 5CCLA 1DS3I 1MJAA 2B8TA
chains in the Genus database with same CATH topology
1R0RI 3UGDA 4E1PA 1IY6A 1MT1A 3VDPA 3VDUA 2LUYA 3UGIA 2KMQA 3BJIA 1PCEA 1OVOA 2E73A 4L9MA 1R79A 1FARA 5FUYA 3UEJA 1LR8A 3E59A 3MEKA 2SGEI 2NU2I 1Y1CA 1CGII 2F3CI 3HH2C 2NU1I 1V1HA 1PJUA 4A24A 2OVOA 1PPFI 1LR7A 2JA1A 2SGQI 2JYYA 3TJQA 3OXLA 1Y8FA 1YTPA 3E2IA 1CSOI 5FUXA 1OYVI 2SGPI 1CT0I 2GKRI 2KCXA 2W0TA 2L7XA 2UZ3A 2ROWA 1U5KA 2WVJA 2BUSA 3D00A 1CT4I 1PTQA 1TBRR 2ORWA 5CCMA 2YUUA 1X74A 2GVIA 2VRWB 1HJAI 3SGBI 1PTRA 1X4SA 2M5XA 3FC3A 1IW4A 2ARPF 2ELIA 1TBQR 1AN1I 2CJSC 2JXDA 2LEOA 2QQDA 2N52A 3OXGA 5HI7A 3UGLA 1HDLA 2J87A 1YU6C 1TGSI 2ENZA 5EX0A 1Z7KB 1M8CA 1N13A 5DAEA 2QQCA 2QQ0A 2E5RA 1KBEA 2KMRA 2YQPA 1RFHA 2ENNA 2JZMA 2NU3I 5HQ8A 2ERWA 5JHWC 4B6DA 2KMPA 4OVOA 2NU0I 3CXLA 3GOXA 1HPTA 1TUSA 3UEYA 4SGBI 1FAQA 3OVOA 1XA6A 1XBTA 2N71A 3RU0A 1OMUA 1V1IA 1W3SA 2XRCA 3SEKC 2V1CA 1KBFA 3QTLD 1BMOA 2P6AC 1CHOI 1SGDI 3UFFA 2J9RA 1SGYI 1W4RA 2GKVA 3PDNA 4FKDA 2GKTI 5FUVA 1CE3A 2NU4I 2FNFX 5EX3A 3QWPA 1BUSA 2SGDI 1VDDA 1DS2I 4UXIA 4UXHA 1IY5A 3SGQI 1TURA 2QQEA 2ODDA 1KMAA 1TBOA 1TBNA 3OL0A 1UVGA 2DB6A 2WCYA 1SGPI 2DIPA 2JW6A 4JCVE 1Y1BA 1SGEI 2N17A 1SGQI 3B4VC 5FUWA 1LR9A 2ORVA 1TOTA 1FYBA 1SGRI 2OD1A 4UXJA 1NUBA 4E1RA 1UUCA 2V1CC 1M8BA 1OMTA 1XX6A 1SGNI 1CGJI 2V53A 2QPOA 2A20A 2N1AB 4GI3C 2K9HA 3VE5A 3OXFA 1H0ZA 2SGFI 1CT2I 1UVFA 3KY9A 4HGUA 2L8EA 1TIHA 2KMOA 2B0UC 5CCLA 1DS3I 2B8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R0R I;  1IY6 A;  1MT1 A;  2KMQ A;  1PCE A;  1OVO A;  1LR8 A;  2SGE I;  2NU2 I;  1Y1C A;  1CGI I;  2F3C I;  3HH2 C;  2NU1 I;  1PJU A;  2OVO A;  1PPF I;  1LR7 A;  2SGQ I;  2JYY A;  3TJQ A;  1YTP A;  1CSO I;  1OYV I;  2SGP I;  1CT0 I;  2GKR I;  2KCX A;  2BUS A;  1CT4 I;  1TBR R;  1HJA I;  3SGB I;  2M5X A;  1IW4 A;  2ARP F;  1TBQ R;  1AN1 I;  2JXD A;  2LEO A;  2QQD A;  2N52 A;  1HDL A;  1YU6 C;  1TGS I;  1Z7K B;  1M8C A;  1N13 A;  5DAE A;  2QQC A;  2KMR A;  2JZM A;  2NU3 I;  2ERW A;  5JHW C;  2KMP A;  4OVO A;  2NU0 I;  1HPT A;  1TUS A;  4SGB I;  3OVO A;  2N71 A;  3SEK C;  1OMU A;  2XRC A;  3QTL D;  1BMO A;  2P6A C;  1CHO I;  1SGD I;  1SGY I;  2GKV A;  2GKT I;  1CE3 A;  2NU4 I;  1BUS A;  2SGD I;  1DS2 I;  1IY5 A;  3SGQ I;  1TUR A;  1KMA A;  1UVG A;  2WCY A;  1SGP I;  1Y1B A;  1SGE I;  2N17 A;  1SGQ I;  3B4V C;  1LR9 A;  1FYB A;  1SGR I;  1NUB A;  1UUC A;  1M8B A;  1OMT A;  1SGN I;  1CGJ I;  2V53 A;  4GI3 C;  1H0Z A;  2SGF I;  1CT2 I;  1UVF A;  4HGU A;  1TIH A;  2KMO A;  2B0U C;  1DS3 I; 
#chains in the Genus database with same CATH topology
 1R0R I;  3UGD A;  4E1P A;  1IY6 A;  1MT1 A;  1UHA A;  3VDP A;  1WTJ A;  3VDU A;  2LUY A;  2CWH A;  3UGI A;  2KMQ A;  3BJI A;  1PCE A;  1OVO A;  2E73 A;  4L9M A;  4AML A;  1R79 A;  1FAR A;  5FUY A;  3UEJ A;  2X3T A;  1LR8 A;  3E59 A;  2WGC A;  3MEK A;  3TO7 A;  1MJB A;  2SGE I;  2NU2 I;  1Y1C A;  4MPI A;  1CGI I;  2F3C I;  3HH2 C;  2NU1 I;  2UVO A;  1Q9B A;  1V1H A;  1PJU A;  4A24 A;  2OVO A;  1PPF I;  1LR7 A;  2JA1 A;  2SGQ I;  2OU2 A;  4DNC A;  2JYY A;  3TJQ A;  3QAH A;  3TO6 A;  3OXL A;  1Y8F A;  1YTP A;  3E2I A;  1CSO I;  5E3Q A;  5FUX A;  2RC4 A;  1OYV I;  2SGP I;  1K7T A;  1CT0 I;  2GKR I;  2KCX A;  2W0T A;  2L7X A;  2UZ3 A;  2ROW A;  1U5K A;  2WVJ A;  2BUS A;  3D00 A;  1CT4 I;  1HEV A;  1PTQ A;  1TBR R;  1ULK A;  2ORW A;  5E3R A;  5CCM A;  2YUU A;  1X74 A;  2GVI A;  2VRW B;  1HJA I;  3UOE A;  3SGB I;  2CWF A;  1PTR A;  1X4S A;  2M5X A;  3FC3 A;  1IW4 A;  2ARP F;  2ELI A;  1TBQ R;  1ULN A;  1AN1 I;  2CJS C;  2JXD A;  2LEO A;  2QQD A;  2N52 A;  3OXG A;  5HI7 A;  3UGL A;  1HDL A;  2J87 A;  1YU6 C;  1TGS I;  2ENZ A;  5EX0 A;  1Z7K B;  3FSY A;  1M8C A;  1N13 A;  5DAE A;  3TOA A;  3TO9 A;  2QQC A;  2QQ0 A;  2E5R A;  3R5D A;  1KBE A;  2KMR A;  2YQP A;  1RFH A;  2ENN A;  2JZM A;  2NU3 I;  5HQ8 A;  2ERW A;  5JHW C;  4B6D A;  2KMP A;  1KBF A;  4OVO A;  1ULM A;  2NU0 I;  3CXL A;  3GOX A;  1HPT A;  3TOB A;  2OZU A;  1TUS A;  1P9G A;  3UEY A;  4SGB I;  1FAQ A;  3OVO A;  1XA6 A;  3R5A A;  1XBT A;  1WKX A;  2N71 A;  1OMU A;  1V1I A;  1W3S A;  2RIJ A;  2XRC A;  2V1C A;  3RU0 A;  3SEK C;  3QTL D;  1BMO A;  1S20 A;  2P6A C;  1CHO I;  1SGD I;  3UFF A;  2J9R A;  1SGY I;  1W4R A;  3FSX A;  2GKV A;  7WGA A;  3PDN A;  4FKD A;  2GKT I;  5FUV A;  1CE3 A;  2NU4 I;  2FNF X;  2X52 A;  5EX3 A;  3QWP A;  1BUS A;  2SGD I;  1VDD A;  2Y0M A;  3R5C A;  1DS2 I;  4UXI A;  4UXH A;  2CWG A;  1IY5 A;  3SGQ I;  1TUR A;  2QQE A;  2ODD A;  1KMA A;  1TBO A;  1TBN A;  3OL0 A;  1UVG A;  1P9Z A;  2DB6 A;  2DKV A;  5J8C A;  1WGC A;  2WCY A;  1SGP I;  2DIP A;  2JW6 A;  4WP4 A;  4JCV E;  1Y1B A;  1SGE I;  2GIV A;  2N17 A;  1FY7 A;  1Z2I A;  9WGA A;  1SGQ I;  3B4V C;  5FUW A;  1LR9 A;  2ORV A;  1TOT A;  1FYB A;  1SGR I;  2OD1 A;  4UXJ A;  5E3P A;  3R5B A;  1NXU A;  1NUB A;  4E1R A;  1UUC A;  2V1C C;  1MJ9 A;  1M8B A;  1K7U A;  1OMT A;  1XX6 A;  1SGN I;  1CGJ I;  2V53 A;  2QPO A;  1WGT A;  2A20 A;  2N1A B;  4GI3 C;  2K9H A;  3VE5 A;  5J8F A;  3OXF A;  1H0Z A;  2SGF I;  1CT2 I;  1UVF A;  3KY9 A;  4HGU A;  2L8E A;  1TIH A;  2KMO A;  2LB7 A;  2B0U C;  1K7V A;  2PQ8 A;  5CCL A;  1DS3 I;  1MJA A;  2B8T A; 
#chains in the Genus database with same CATH homology
 1R0R I;  3UGD A;  4E1P A;  1IY6 A;  1MT1 A;  3VDP A;  3VDU A;  2LUY A;  3UGI A;  2KMQ A;  3BJI A;  1PCE A;  1OVO A;  2E73 A;  4L9M A;  1R79 A;  1FAR A;  5FUY A;  3UEJ A;  1LR8 A;  3E59 A;  3MEK A;  2SGE I;  2NU2 I;  1Y1C A;  1CGI I;  2F3C I;  3HH2 C;  2NU1 I;  1V1H A;  1PJU A;  4A24 A;  2OVO A;  1PPF I;  1LR7 A;  2JA1 A;  2SGQ I;  2JYY A;  3TJQ A;  3OXL A;  1Y8F A;  1YTP A;  3E2I A;  1CSO I;  5FUX A;  1OYV I;  2SGP I;  1CT0 I;  2GKR I;  2KCX A;  2W0T A;  2L7X A;  2UZ3 A;  2ROW A;  1U5K A;  2WVJ A;  2BUS A;  3D00 A;  1CT4 I;  1PTQ A;  1TBR R;  2ORW A;  5CCM A;  2YUU A;  1X74 A;  2GVI A;  2VRW B;  1HJA I;  3SGB I;  1PTR A;  1X4S A;  2M5X A;  3FC3 A;  1IW4 A;  2ARP F;  2ELI A;  1TBQ R;  1AN1 I;  2CJS C;  2JXD A;  2LEO A;  2QQD A;  2N52 A;  3OXG A;  5HI7 A;  3UGL A;  1HDL A;  2J87 A;  1YU6 C;  1TGS I;  2ENZ A;  5EX0 A;  1Z7K B;  1M8C A;  1N13 A;  5DAE A;  2QQC A;  2QQ0 A;  2E5R A;  1KBE A;  2KMR A;  2YQP A;  1RFH A;  2ENN A;  2JZM A;  2NU3 I;  5HQ8 A;  2ERW A;  5JHW C;  4B6D A;  2KMP A;  4OVO A;  2NU0 I;  3CXL A;  3GOX A;  1HPT A;  1TUS A;  3UEY A;  4SGB I;  1FAQ A;  3OVO A;  1XA6 A;  1XBT A;  2N71 A;  3RU0 A;  1OMU A;  1V1I A;  1W3S A;  2XRC A;  3SEK C;  2V1C A;  1KBF A;  3QTL D;  1BMO A;  2P6A C;  1CHO I;  1SGD I;  3UFF A;  2J9R A;  1SGY I;  1W4R A;  2GKV A;  3PDN A;  4FKD A;  2GKT I;  5FUV A;  1CE3 A;  2NU4 I;  2FNF X;  5EX3 A;  3QWP A;  1BUS A;  2SGD I;  1VDD A;  1DS2 I;  4UXI A;  4UXH A;  1IY5 A;  3SGQ I;  1TUR A;  2QQE A;  2ODD A;  1KMA A;  1TBO A;  1TBN A;  3OL0 A;  1UVG A;  2DB6 A;  2WCY A;  1SGP I;  2DIP A;  2JW6 A;  4JCV E;  1Y1B A;  1SGE I;  2N17 A;  1SGQ I;  3B4V C;  5FUW A;  1LR9 A;  2ORV A;  1TOT A;  1FYB A;  1SGR I;  2OD1 A;  4UXJ A;  1NUB A;  4E1R A;  1UUC A;  2V1C C;  1M8B A;  1OMT A;  1XX6 A;  1SGN I;  1CGJ I;  2V53 A;  2QPO A;  2A20 A;  2N1A B;  4GI3 C;  2K9H A;  3VE5 A;  3OXF A;  1H0Z A;  2SGF I;  1CT2 I;  1UVF A;  3KY9 A;  4HGU A;  2L8E A;  1TIH A;  2KMO A;  2B0U C;  5CCL A;  1DS3 I;  2B8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...