1TGSI

Three-dimensional structure of the complex between pancreatic secretory inhibitor (kazal type) and trypsinogen at 1.8 angstroms resolution. structure solution, crystallographic refinement and preliminary structural interpretation
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
56
structure length
56
Chain Sequence
TSPQREATCTSEVSGCPKIYNPVCGTDGITYSNECVLCSENKKRQTPVLIQKSGPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSINOGEN
publication title Three-dimensional structure of the complex between pancreatic secretory trypsin inhibitor (Kazal type) and trypsinogen at 1.8 A resolution. Structure solution, crystallographic refinement and preliminary structural interpretation.
pubmed doi rcsb
source organism Bos taurus
molecule tags Complex (proteinase/inhibitor)
total genus 13
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1982-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1tgsI00
2JXDA 1PJUA 1TURA 1NUBA 1SGDI 1N13A 1SGQI 2P6AC 2WCYA 2KCXA 1LR8A 1H0ZA 1OVOA 1LR9A 1BMOA 2ERWA 3SEKC 1Y1CA 2NU1I 1R0RI 1CGJI 1TBRR 2SGEI 1PPFI 2N71A 1KMAA 2XRCA 2ARPF 2V53A 4GI3C 1OYVI 2SGDI 3SGQI 2N52A 1SGPI 1IY6A 2GKRI 1Z7KB 1TUSA 1HJAI 2NU2I 1CT4I 1Y1BA 1FYBA 2NU3I 1AN1I 1BUSA 1OMTA 2KMPA 3SGBI 2KMQA 2M5XA 1UVGA 1HDLA 1TIHA 4SGBI 5JHWC 1IY5A 2QQDA 2NU4I 2SGPI 2SGQI 1CHOI 1DS2I 1M8BA 1UUCA 2GKTI 1TGSI 5DAEA 1TBQR 2KMOA 1SGNI 1CSOI 4HGUA 3B4VC 3TJQA 2JZMA 1CT2I 1LR7A 2JYYA 2F3CI 1HPTA 3QTLD 1YTPA 1YU6C 2OVOA 1UVFA 1MT1A 2BUSA 3OVOA 2N17A 2B0UC 1CGII 2SGFI 3HH2C 1SGEI 1M8CA 1PCEA 2LEOA 1CE3A 2QQCA 1SGYI 2NU0I 1CT0I 1SGRI 1IW4A 2GKVA 4OVOA 1DS3I 1OMUA 2KMRA
chains in the Genus database with same CATH superfamily
2JXDA 1PJUA 1TURA 3FSXA 3TOAA 3UGIA 3VDUA 2X52A 1NUBA 1X74A 1SGDI 1N13A 4FKDA 1SGQI 2P6AC 5FUVA 2WCYA 5CCMA 2KCXA 1LR8A 2LB7A 1WGCA 1V1HA 3BJIA 1H0ZA 1P9GA 3R5BA 1OVOA 5FUWA 3UOEA 2FNFX 1LR9A 1BMOA 2ERWA 3VE5A 3SEKC 1Y1CA 2ENZA 2NU1I 1R0RI 1XBTA 2DKVA 1WGTA 1Q9BA 1Z2IA 1KBEA 3R5AA 1CGJI 1TBNA 1TBRR 2SGEI 1PPFI 2N71A 5FUYA 2XRCA 2ARPF 2V53A 4E1PA 1KMAA 4GI3C 1OYVI 1XA6A 2LUYA 2SGDI 4AMLA 1MJBA 1Y8FA 2N52A 2J87A 3SGQI 3UFFA 2DIPA 3UGDA 2E5RA 2J9RA 1SGPI 4A24A 4DNCA 2QQEA 3CXLA 1IY6A 2PQ8A 2GKRI 1NXUA 1Z7KB 1TUSA 1HJAI 1PTRA 1CT4I 1Y1BA 1U5KA 2NU2I 1FYBA 1FARA 4MPIA 2NU3I 2ORWA 1AN1I 2CWFA 1BUSA 2CWHA 5E3RA 1K7UA 1TBOA 3UGLA 1V1IA 2VRWB 1OMTA 1R79A 2KMPA 3SGBI 2RIJA 3TO9A 2KMQA 4B6DA 4E1RA 2M5XA 3UEYA 1UVGA 2N1AB 1HDLA 5CCLA 2QQ0A 1TOTA 1K7TA 1TIHA 4SGBI 5E3PA 5JHWC 3FC3A 1IY5A 2QQDA 5J8FA 3E59A 3R5CA 1HEVA 2NU4I 2WGCA 2SGPI 1WKXA 2SGQI 1CHOI 2RC4A 1W4RA 3MEKA 5J8CA 3TO6A 1DS2I 1M8BA 1UUCA 2GKTI 1TGSI 2W0TA 5DAEA 1TBQR 2KMOA 9WGAA 1SGNI 3UEJA 1CSOI 5E3QA 3GOXA 2L7XA 2ODDA 4HGUA 3B4VC 3TJQA 3FSYA 2X3TA 4UXJA 1X4SA 2UZ3A 1S20A 4JCVE 2B8TA 2JZMA 1RFHA 2OD1A 2CWGA 5FUXA 1CT2I 1LR7A 2JYYA 2K9HA 2F3CI 3OXLA 1KBFA 2ELIA 2YUUA 3OXFA 1HPTA 2GIVA 3QTLD 1YTPA 1P9ZA 1ULMA 5EX0A 1PTQA 1VDDA 1YU6C 3OXGA 2Y0MA 3E2IA 2V1CA 1UHAA 2OVOA 3D00A 3TOBA 1UVFA 1MT1A 7WGAA 2OZUA 3KY9A 1MJAA 2BUSA 5HI7A 1ULKA 3OVOA 2N17A 3QWPA 3R5DA 2JW6A 4UXHA 1FAQA 2E73A 1WTJA 2WVJA 2B0UC 3QAHA 2OU2A 1CGII 2DB6A 5EX3A 1ULNA 2GVIA 1SGEI 2SGFI 3HH2C 2UVOA 3RU0A 1M8CA 4L9MA 1PCEA 1W3SA 2LEOA 3TO7A 1CE3A 1MJ9A 2QQCA 3VDPA 1SGYI 3PDNA 5HQ8A 2NU0I 2ROWA 2ORVA 1CT0I 1XX6A 2A20A 1SGRI 2CJSC 2QPOA 1IW4A 4UXIA 2V1CC 4WP4A 1K7VA 1FY7A 2JA1A 2GKVA 2ENNA 2L8EA 3OL0A 4OVOA 1DS3I 1OMUA 2YQPA 2KMRA
chains in the Genus database with same CATH topology
2JXDA 1PJUA 1TURA 3UGIA 3VDUA 1NUBA 1X74A 1SGDI 1N13A 4FKDA 1SGQI 2P6AC 5FUVA 2WCYA 5CCMA 2KCXA 1LR8A 3BJIA 1H0ZA 1V1HA 5FUWA 1OVOA 2FNFX 1LR9A 1BMOA 2ERWA 3VE5A 3SEKC 1Y1CA 2ENZA 2NU1I 1R0RI 1XBTA 1KBEA 1CGJI 1TBNA 1TBRR 2SGEI 1PPFI 2N71A 5FUYA 2XRCA 2ARPF 2V53A 4E1PA 1KMAA 4GI3C 1OYVI 1XA6A 2LUYA 2SGDI 1Y8FA 2N52A 2J87A 3SGQI 3UFFA 2DIPA 3UGDA 2E5RA 2J9RA 1SGPI 4A24A 2QQEA 3CXLA 1IY6A 2GKRI 1Z7KB 1TUSA 1HJAI 1PTRA 1CT4I 1Y1BA 1U5KA 2NU2I 1FYBA 1FARA 2NU3I 2ORWA 1AN1I 1BUSA 1TBOA 3UGLA 1V1IA 2VRWB 1OMTA 1R79A 2KMPA 3SGBI 2KMQA 4B6DA 4E1RA 2M5XA 3UEYA 1UVGA 2N1AB 1HDLA 5CCLA 2QQ0A 1TOTA 1TIHA 4SGBI 3FC3A 5JHWC 1IY5A 2QQDA 3E59A 2NU4I 2SGPI 2SGQI 1CHOI 1W4RA 3MEKA 1DS2I 1M8BA 1UUCA 2GKTI 1TGSI 2W0TA 5DAEA 1TBQR 2KMOA 1SGNI 3UEJA 1CSOI 3GOXA 2L7XA 2ODDA 4HGUA 3B4VC 3TJQA 4UXJA 1X4SA 2UZ3A 4JCVE 2B8TA 2JZMA 1RFHA 2OD1A 5FUXA 1CT2I 1LR7A 2JYYA 2K9HA 2F3CI 3OXLA 1KBFA 2ELIA 2YUUA 3OXFA 1HPTA 3QTLD 1YTPA 5EX0A 1PTQA 1VDDA 1YU6C 3OXGA 3E2IA 2V1CA 2OVOA 3D00A 1UVFA 1MT1A 3KY9A 5HI7A 2BUSA 3OVOA 2N17A 3QWPA 2JW6A 4UXHA 1FAQA 2E73A 2WVJA 2B0UC 1CGII 2DB6A 5EX3A 2GVIA 2SGFI 1SGEI 3HH2C 3RU0A 1M8CA 4L9MA 1PCEA 1W3SA 2LEOA 1CE3A 2QQCA 3VDPA 1SGYI 3PDNA 5HQ8A 2NU0I 2ROWA 2ORVA 1CT0I 1XX6A 2A20A 1SGRI 2CJSC 2QPOA 1IW4A 4UXIA 2V1CC 2JA1A 2L8EA 2GKVA 2ENNA 3OL0A 4OVOA 1DS3I 1OMUA 2YQPA 2KMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JXD A;  1PJU A;  1TUR A;  1NUB A;  1SGD I;  1N13 A;  1SGQ I;  2P6A C;  2WCY A;  2KCX A;  1LR8 A;  1H0Z A;  1OVO A;  1LR9 A;  1BMO A;  2ERW A;  3SEK C;  1Y1C A;  2NU1 I;  1R0R I;  1CGJ I;  1TBR R;  2SGE I;  1PPF I;  2N71 A;  1KMA A;  2XRC A;  2ARP F;  2V53 A;  4GI3 C;  1OYV I;  2SGD I;  3SGQ I;  2N52 A;  1SGP I;  1IY6 A;  2GKR I;  1Z7K B;  1TUS A;  1HJA I;  2NU2 I;  1CT4 I;  1Y1B A;  1FYB A;  2NU3 I;  1AN1 I;  1BUS A;  1OMT A;  2KMP A;  3SGB I;  2KMQ A;  2M5X A;  1UVG A;  1HDL A;  1TIH A;  4SGB I;  5JHW C;  1IY5 A;  2QQD A;  2NU4 I;  2SGP I;  2SGQ I;  1CHO I;  1DS2 I;  1M8B A;  1UUC A;  2GKT I;  1TGS I;  5DAE A;  1TBQ R;  2KMO A;  1SGN I;  1CSO I;  4HGU A;  3B4V C;  3TJQ A;  2JZM A;  1CT2 I;  1LR7 A;  2JYY A;  2F3C I;  1HPT A;  3QTL D;  1YTP A;  1YU6 C;  2OVO A;  1UVF A;  1MT1 A;  2BUS A;  3OVO A;  2N17 A;  2B0U C;  1CGI I;  2SGF I;  3HH2 C;  1SGE I;  1M8C A;  1PCE A;  2LEO A;  1CE3 A;  2QQC A;  1SGY I;  2NU0 I;  1CT0 I;  1SGR I;  1IW4 A;  2GKV A;  4OVO A;  1DS3 I;  1OMU A;  2KMR A; 
#chains in the Genus database with same CATH topology
 2JXD A;  1PJU A;  1TUR A;  3FSX A;  3TOA A;  3UGI A;  3VDU A;  2X52 A;  1NUB A;  1X74 A;  1SGD I;  1N13 A;  4FKD A;  1SGQ I;  2P6A C;  5FUV A;  2WCY A;  5CCM A;  2KCX A;  1LR8 A;  2LB7 A;  1WGC A;  1V1H A;  3BJI A;  1H0Z A;  1P9G A;  3R5B A;  1OVO A;  5FUW A;  3UOE A;  2FNF X;  1LR9 A;  1BMO A;  2ERW A;  3VE5 A;  3SEK C;  1Y1C A;  2ENZ A;  2NU1 I;  1R0R I;  1XBT A;  2DKV A;  1WGT A;  1Q9B A;  1Z2I A;  1KBE A;  3R5A A;  1CGJ I;  1TBN A;  1TBR R;  2SGE I;  1PPF I;  2N71 A;  5FUY A;  2XRC A;  2ARP F;  2V53 A;  4E1P A;  1KMA A;  4GI3 C;  1OYV I;  1XA6 A;  2LUY A;  2SGD I;  4AML A;  1MJB A;  1Y8F A;  2N52 A;  2J87 A;  3SGQ I;  3UFF A;  2DIP A;  3UGD A;  2E5R A;  2J9R A;  1SGP I;  4A24 A;  4DNC A;  2QQE A;  3CXL A;  1IY6 A;  2PQ8 A;  2GKR I;  1NXU A;  1Z7K B;  1TUS A;  1HJA I;  1PTR A;  1CT4 I;  1Y1B A;  1U5K A;  2NU2 I;  1FYB A;  1FAR A;  4MPI A;  2NU3 I;  2ORW A;  1AN1 I;  2CWF A;  1BUS A;  2CWH A;  5E3R A;  1K7U A;  1TBO A;  3UGL A;  1V1I A;  2VRW B;  1OMT A;  1R79 A;  2KMP A;  3SGB I;  2RIJ A;  3TO9 A;  2KMQ A;  4B6D A;  4E1R A;  2M5X A;  3UEY A;  1UVG A;  2N1A B;  1HDL A;  5CCL A;  2QQ0 A;  1TOT A;  1K7T A;  1TIH A;  4SGB I;  5E3P A;  5JHW C;  3FC3 A;  1IY5 A;  2QQD A;  5J8F A;  3E59 A;  3R5C A;  1HEV A;  2NU4 I;  2WGC A;  2SGP I;  1WKX A;  2SGQ I;  1CHO I;  2RC4 A;  1W4R A;  3MEK A;  5J8C A;  3TO6 A;  1DS2 I;  1M8B A;  1UUC A;  2GKT I;  1TGS I;  2W0T A;  5DAE A;  1TBQ R;  2KMO A;  9WGA A;  1SGN I;  3UEJ A;  1CSO I;  5E3Q A;  3GOX A;  2L7X A;  2ODD A;  4HGU A;  3B4V C;  3TJQ A;  3FSY A;  2X3T A;  4UXJ A;  1X4S A;  2UZ3 A;  1S20 A;  4JCV E;  2B8T A;  2JZM A;  1RFH A;  2OD1 A;  2CWG A;  5FUX A;  1CT2 I;  1LR7 A;  2JYY A;  2K9H A;  2F3C I;  3OXL A;  1KBF A;  2ELI A;  2YUU A;  3OXF A;  1HPT A;  2GIV A;  3QTL D;  1YTP A;  1P9Z A;  1ULM A;  5EX0 A;  1PTQ A;  1VDD A;  1YU6 C;  3OXG A;  2Y0M A;  3E2I A;  2V1C A;  1UHA A;  2OVO A;  3D00 A;  3TOB A;  1UVF A;  1MT1 A;  7WGA A;  2OZU A;  3KY9 A;  1MJA A;  2BUS A;  5HI7 A;  1ULK A;  3OVO A;  2N17 A;  3QWP A;  3R5D A;  2JW6 A;  4UXH A;  1FAQ A;  2E73 A;  1WTJ A;  2WVJ A;  2B0U C;  3QAH A;  2OU2 A;  1CGI I;  2DB6 A;  5EX3 A;  1ULN A;  2GVI A;  1SGE I;  2SGF I;  3HH2 C;  2UVO A;  3RU0 A;  1M8C A;  4L9M A;  1PCE A;  1W3S A;  2LEO A;  3TO7 A;  1CE3 A;  1MJ9 A;  2QQC A;  3VDP A;  1SGY I;  3PDN A;  5HQ8 A;  2NU0 I;  2ROW A;  2ORV A;  1CT0 I;  1XX6 A;  2A20 A;  1SGR I;  2CJS C;  2QPO A;  1IW4 A;  4UXI A;  2V1C C;  4WP4 A;  1K7V A;  1FY7 A;  2JA1 A;  2GKV A;  2ENN A;  2L8E A;  3OL0 A;  4OVO A;  1DS3 I;  1OMU A;  2YQP A;  2KMR A; 
#chains in the Genus database with same CATH homology
 2JXD A;  1PJU A;  1TUR A;  3UGI A;  3VDU A;  1NUB A;  1X74 A;  1SGD I;  1N13 A;  4FKD A;  1SGQ I;  2P6A C;  5FUV A;  2WCY A;  5CCM A;  2KCX A;  1LR8 A;  3BJI A;  1H0Z A;  1V1H A;  5FUW A;  1OVO A;  2FNF X;  1LR9 A;  1BMO A;  2ERW A;  3VE5 A;  3SEK C;  1Y1C A;  2ENZ A;  2NU1 I;  1R0R I;  1XBT A;  1KBE A;  1CGJ I;  1TBN A;  1TBR R;  2SGE I;  1PPF I;  2N71 A;  5FUY A;  2XRC A;  2ARP F;  2V53 A;  4E1P A;  1KMA A;  4GI3 C;  1OYV I;  1XA6 A;  2LUY A;  2SGD I;  1Y8F A;  2N52 A;  2J87 A;  3SGQ I;  3UFF A;  2DIP A;  3UGD A;  2E5R A;  2J9R A;  1SGP I;  4A24 A;  2QQE A;  3CXL A;  1IY6 A;  2GKR I;  1Z7K B;  1TUS A;  1HJA I;  1PTR A;  1CT4 I;  1Y1B A;  1U5K A;  2NU2 I;  1FYB A;  1FAR A;  2NU3 I;  2ORW A;  1AN1 I;  1BUS A;  1TBO A;  3UGL A;  1V1I A;  2VRW B;  1OMT A;  1R79 A;  2KMP A;  3SGB I;  2KMQ A;  4B6D A;  4E1R A;  2M5X A;  3UEY A;  1UVG A;  2N1A B;  1HDL A;  5CCL A;  2QQ0 A;  1TOT A;  1TIH A;  4SGB I;  3FC3 A;  5JHW C;  1IY5 A;  2QQD A;  3E59 A;  2NU4 I;  2SGP I;  2SGQ I;  1CHO I;  1W4R A;  3MEK A;  1DS2 I;  1M8B A;  1UUC A;  2GKT I;  1TGS I;  2W0T A;  5DAE A;  1TBQ R;  2KMO A;  1SGN I;  3UEJ A;  1CSO I;  3GOX A;  2L7X A;  2ODD A;  4HGU A;  3B4V C;  3TJQ A;  4UXJ A;  1X4S A;  2UZ3 A;  4JCV E;  2B8T A;  2JZM A;  1RFH A;  2OD1 A;  5FUX A;  1CT2 I;  1LR7 A;  2JYY A;  2K9H A;  2F3C I;  3OXL A;  1KBF A;  2ELI A;  2YUU A;  3OXF A;  1HPT A;  3QTL D;  1YTP A;  5EX0 A;  1PTQ A;  1VDD A;  1YU6 C;  3OXG A;  3E2I A;  2V1C A;  2OVO A;  3D00 A;  1UVF A;  1MT1 A;  3KY9 A;  5HI7 A;  2BUS A;  3OVO A;  2N17 A;  3QWP A;  2JW6 A;  4UXH A;  1FAQ A;  2E73 A;  2WVJ A;  2B0U C;  1CGI I;  2DB6 A;  5EX3 A;  2GVI A;  2SGF I;  1SGE I;  3HH2 C;  3RU0 A;  1M8C A;  4L9M A;  1PCE A;  1W3S A;  2LEO A;  1CE3 A;  2QQC A;  3VDP A;  1SGY I;  3PDN A;  5HQ8 A;  2NU0 I;  2ROW A;  2ORV A;  1CT0 I;  1XX6 A;  2A20 A;  1SGR I;  2CJS C;  2QPO A;  1IW4 A;  4UXI A;  2V1C C;  2JA1 A;  2L8E A;  2GKV A;  2ENN A;  3OL0 A;  4OVO A;  1DS3 I;  1OMU A;  2YQP A;  2KMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...