1DS3I

Crystal structure of omtky3-ch2-asp19i
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
51
structure length
50
Chain Sequence
VDCSEYPKPACTDYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords OVOMUCOID
publication title Contribution of peptide bonds to inhibitor-protease binding: crystal structures of the turkey ovomucoid third domain backbone variants OMTKY3-Pro18I and OMTKY3-psi[COO]-Leu18I in complex with Streptomyces griseus proteinase B (SGPB) and the structure of the free inhibitor, OMTKY-3-psi[CH2NH2+]-Asp19I
pubmed doi rcsb
source organism Meleagris gallopavo
total genus 12
structure length 50
sequence length 51
ec nomenclature
pdb deposition date 2000-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1ds3I00
4HGUA 4GI3C 2KMQA 2KMRA 2JYYA 2GKVA 1LR7A 1N13A 2P6AC 2SGDI 2N71A 1SGRI 1YTPA 5DAEA 1H0ZA 1FYBA 1UUCA 1CHOI 2GKTI 1OVOA 2M5XA 2WCYA 1TBRR 2SGPI 1HDLA 2KCXA 1PJUA 1HPTA 2SGQI 3HH2C 2KMOA 1BUSA 1CT0I 1DS3I 3B4VC 1TGSI 1CT2I 1SGQI 2BUSA 2ARPF 1PPFI 1TURA 1NUBA 2SGEI 3OVOA 2F3CI 3SGQI 1M8BA 2XRCA 2N17A 1OMTA 1CE3A 2NU0I 1OYVI 3QTLD 1AN1I 1HJAI 1CGJI 1PCEA 1KMAA 1Y1CA 3SEKC 1R0RI 1BMOA 1LR8A 1DS2I 2V53A 1IW4A 1SGEI 2KMPA 1SGDI 2ERWA 2NU4I 1M8CA 1Y1BA 2SGFI 1TUSA 1IY5A 2OVOA 1TBQR 3TJQA 3SGBI 1MT1A 1LR9A 1CSOI 2JXDA 5JHWC 1YU6C 2NU2I 1Z7KB 1TIHA 1SGPI 2GKRI 1CGII 2JZMA 2N52A 1OMUA 1SGNI 2LEOA 1UVFA 2B0UC 2NU3I 2NU1I 4SGBI 2QQCA 1CT4I 1IY6A 4OVOA 2QQDA 1UVGA 1SGYI
chains in the Genus database with same CATH superfamily
2X52A 4HGUA 3QWPA 5E3PA 1W3SA 2CWHA 2LB7A 2ROWA 2GIVA 3QAHA 2QQ0A 1V1HA 2J9RA 2YUUA 4GI3C 5HQ8A 4FKDA 3TO7A 5FUVA 1WGTA 2KMQA 3FC3A 1WKXA 2OU2A 2KMRA 2QPOA 3R5CA 2JYYA 2GKVA 1LR7A 1N13A 1R79A 2P6AC 1TBNA 2J87A 2SGDI 2N71A 1K7TA 1SGRI 1ULNA 1YTPA 3TO9A 5DAEA 1KBEA 2ODDA 1XX6A 3D00A 1H0ZA 2E73A 2CWGA 1UUCA 1FYBA 1PTQA 3TOBA 1P9ZA 1CHOI 2DB6A 1OVOA 2GKTI 2M5XA 5J8FA 5J8CA 2WCYA 1TBRR 2FNFX 2X3TA 2SGPI 4WP4A 1FARA 1MJ9A 1HDLA 1Q9BA 3E59A 2KCXA 2W0TA 1W4RA 1PJUA 1HPTA 2LUYA 3BJIA 2SGQI 1X4SA 2RC4A 3HH2C 7WGAA 3VE5A 2KMOA 3GOXA 1BUSA 1K7VA 1CT0I 1DS3I 2L8EA 2RIJA 3B4VC 3MEKA 4E1PA 1TGSI 3VDPA 1CT2I 2WVJA 4UXJA 1SGQI 2BUSA 2ARPF 3RU0A 3UGIA 1PPFI 2B8TA 1TURA 4JCVE 5FUWA 3TO6A 1NUBA 1FY7A 4B6DA 2SGEI 3OVOA 3OXLA 2F3CI 3SGQI 1Z2IA 1M8BA 2E5RA 2XRCA 3TOAA 3FSXA 3OXGA 3R5AA 2ENZA 1OMTA 2N17A 1WGCA 9WGAA 2NU0I 1VDDA 1CE3A 1OYVI 3QTLD 2L7XA 1AN1I 1HJAI 3VDUA 4E1RA 1CGJI 1WTJA 1FAQA 1PCEA 1U5KA 1KMAA 2DKVA 2V1CA 1Y1CA 2CJSC 5EX3A 1XBTA 3SEKC 2PQ8A 1R0RI 1BMOA 1LR8A 1DS2I 2V53A 2WGCA 1IW4A 1SGEI 1TBOA 2KMPA 1SGDI 1HEVA 2ERWA 2NU4I 5CCMA 1M8CA 1Y1BA 2VRWB 2SGFI 1TUSA 1IY5A 3R5DA 2OVOA 5FUXA 4L9MA 2QQEA 3UOEA 2CWFA 2ELIA 4MPIA 3KY9A 1RFHA 1TBQR 2GVIA 3UEJA 1K7UA 2DIPA 5FUYA 3UFFA 2A20A 4DNCA 2ORVA 3TJQA 3SGBI 3UGDA 1MT1A 2V1CC 4AMLA 1LR9A 3OXFA 2UVOA 1CSOI 2JXDA 2YQPA 4A24A 2K9HA 5JHWC 1MJBA 2JA1A 3E2IA 1YU6C 2NU2I 1Z7KB 1TIHA 2ORWA 1SGPI 2GKRI 3R5BA 1KBFA 1ULMA 1CGII 1TOTA 2OZUA 1XA6A 2JZMA 1X74A 2N52A 1NXUA 1OMUA 1SGNI 3CXLA 5E3QA 2LEOA 4UXIA 5HI7A 1V1IA 3UEYA 3UGLA 1UVFA 2N1AB 3OL0A 2B0UC 5CCLA 2NU3I 2NU1I 4SGBI 1S20A 1P9GA 2QQCA 2Y0MA 1CT4I 5E3RA 2UZ3A 1IY6A 1MJAA 1UHAA 2ENNA 1Y8FA 3PDNA 2JW6A 2OD1A 4OVOA 5EX0A 4UXHA 1PTRA 3FSYA 2QQDA 1ULKA 1UVGA 1SGYI
chains in the Genus database with same CATH topology
4HGUA 3QWPA 1W3SA 2ROWA 2QQ0A 1V1HA 2J9RA 2YUUA 4GI3C 5HQ8A 4FKDA 5FUVA 2KMQA 3FC3A 2QPOA 2KMRA 2JYYA 2GKVA 1LR7A 1N13A 1R79A 2P6AC 1TBNA 2J87A 2SGDI 2N71A 1SGRI 1YTPA 5DAEA 1KBEA 2ODDA 1XX6A 3D00A 1H0ZA 2E73A 1FYBA 1UUCA 1PTQA 1CHOI 2DB6A 1OVOA 2GKTI 2M5XA 2WCYA 1TBRR 2FNFX 2SGPI 1FARA 1HDLA 3E59A 2KCXA 2W0TA 1W4RA 1PJUA 1HPTA 2LUYA 3BJIA 2SGQI 1X4SA 3HH2C 3GOXA 3VE5A 2KMOA 1BUSA 1CT0I 1DS3I 2L8EA 3B4VC 3MEKA 4E1PA 1TGSI 1CT2I 2WVJA 4UXJA 1SGQI 2BUSA 2ARPF 3RU0A 3UGIA 2B8TA 1PPFI 1TURA 4JCVE 5FUWA 1NUBA 4B6DA 2SGEI 3OVOA 3OXLA 2F3CI 3SGQI 1M8BA 2E5RA 2XRCA 3OXGA 2ENZA 1OMTA 2N17A 1CE3A 2NU0I 1VDDA 1OYVI 3QTLD 2L7XA 1AN1I 1HJAI 3VDUA 4E1RA 1CGJI 1FAQA 1PCEA 1U5KA 1KMAA 2V1CA 1Y1CA 2CJSC 5EX3A 1XBTA 3SEKC 1R0RI 1BMOA 1LR8A 1DS2I 2V53A 1IW4A 1SGEI 1TBOA 2KMPA 1SGDI 2ERWA 2NU4I 5CCMA 1M8CA 1Y1BA 2VRWB 2SGFI 1TUSA 1IY5A 2OVOA 5FUXA 4L9MA 2QQEA 2ELIA 3KY9A 1RFHA 1TBQR 2GVIA 3UEJA 3UFFA 2DIPA 5FUYA 2A20A 2ORVA 3TJQA 3SGBI 3UGDA 1MT1A 2V1CC 1LR9A 3OXFA 1CSOI 2JXDA 2YQPA 4A24A 2K9HA 5JHWC 2JA1A 3E2IA 1YU6C 2NU2I 1Z7KB 1TIHA 2ORWA 1SGPI 2GKRI 1KBFA 1CGII 1TOTA 1XA6A 2JZMA 1X74A 2N52A 1OMUA 1SGNI 3CXLA 3VDPA 2LEOA 4UXIA 5HI7A 1V1IA 3UEYA 3UGLA 1UVFA 2N1AB 3OL0A 2B0UC 5CCLA 2NU3I 2NU1I 4SGBI 2QQCA 1CT4I 1IY6A 2UZ3A 2ENNA 1Y8FA 3PDNA 2JW6A 2OD1A 4OVOA 5EX0A 4UXHA 1PTRA 2QQDA 1UVGA 1SGYI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HGU A;  4GI3 C;  2KMQ A;  2KMR A;  2JYY A;  2GKV A;  1LR7 A;  1N13 A;  2P6A C;  2SGD I;  2N71 A;  1SGR I;  1YTP A;  5DAE A;  1H0Z A;  1FYB A;  1UUC A;  1CHO I;  2GKT I;  1OVO A;  2M5X A;  2WCY A;  1TBR R;  2SGP I;  1HDL A;  2KCX A;  1PJU A;  1HPT A;  2SGQ I;  3HH2 C;  2KMO A;  1BUS A;  1CT0 I;  1DS3 I;  3B4V C;  1TGS I;  1CT2 I;  1SGQ I;  2BUS A;  2ARP F;  1PPF I;  1TUR A;  1NUB A;  2SGE I;  3OVO A;  2F3C I;  3SGQ I;  1M8B A;  2XRC A;  2N17 A;  1OMT A;  1CE3 A;  2NU0 I;  1OYV I;  3QTL D;  1AN1 I;  1HJA I;  1CGJ I;  1PCE A;  1KMA A;  1Y1C A;  3SEK C;  1R0R I;  1BMO A;  1LR8 A;  1DS2 I;  2V53 A;  1IW4 A;  1SGE I;  2KMP A;  1SGD I;  2ERW A;  2NU4 I;  1M8C A;  1Y1B A;  2SGF I;  1TUS A;  1IY5 A;  2OVO A;  1TBQ R;  3TJQ A;  3SGB I;  1MT1 A;  1LR9 A;  1CSO I;  2JXD A;  5JHW C;  1YU6 C;  2NU2 I;  1Z7K B;  1TIH A;  1SGP I;  2GKR I;  1CGI I;  2JZM A;  2N52 A;  1OMU A;  1SGN I;  2LEO A;  1UVF A;  2B0U C;  2NU3 I;  2NU1 I;  4SGB I;  2QQC A;  1CT4 I;  1IY6 A;  4OVO A;  2QQD A;  1UVG A;  1SGY I; 
#chains in the Genus database with same CATH topology
 2X52 A;  4HGU A;  3QWP A;  5E3P A;  1W3S A;  2CWH A;  2LB7 A;  2ROW A;  2GIV A;  3QAH A;  2QQ0 A;  1V1H A;  2J9R A;  2YUU A;  4GI3 C;  5HQ8 A;  4FKD A;  3TO7 A;  5FUV A;  1WGT A;  2KMQ A;  3FC3 A;  1WKX A;  2OU2 A;  2KMR A;  2QPO A;  3R5C A;  2JYY A;  2GKV A;  1LR7 A;  1N13 A;  1R79 A;  2P6A C;  1TBN A;  2J87 A;  2SGD I;  2N71 A;  1K7T A;  1SGR I;  1ULN A;  1YTP A;  3TO9 A;  5DAE A;  1KBE A;  2ODD A;  1XX6 A;  3D00 A;  1H0Z A;  2E73 A;  2CWG A;  1UUC A;  1FYB A;  1PTQ A;  3TOB A;  1P9Z A;  1CHO I;  2DB6 A;  1OVO A;  2GKT I;  2M5X A;  5J8F A;  5J8C A;  2WCY A;  1TBR R;  2FNF X;  2X3T A;  2SGP I;  4WP4 A;  1FAR A;  1MJ9 A;  1HDL A;  1Q9B A;  3E59 A;  2KCX A;  2W0T A;  1W4R A;  1PJU A;  1HPT A;  2LUY A;  3BJI A;  2SGQ I;  1X4S A;  2RC4 A;  3HH2 C;  7WGA A;  3VE5 A;  2KMO A;  3GOX A;  1BUS A;  1K7V A;  1CT0 I;  1DS3 I;  2L8E A;  2RIJ A;  3B4V C;  3MEK A;  4E1P A;  1TGS I;  3VDP A;  1CT2 I;  2WVJ A;  4UXJ A;  1SGQ I;  2BUS A;  2ARP F;  3RU0 A;  3UGI A;  1PPF I;  2B8T A;  1TUR A;  4JCV E;  5FUW A;  3TO6 A;  1NUB A;  1FY7 A;  4B6D A;  2SGE I;  3OVO A;  3OXL A;  2F3C I;  3SGQ I;  1Z2I A;  1M8B A;  2E5R A;  2XRC A;  3TOA A;  3FSX A;  3OXG A;  3R5A A;  2ENZ A;  1OMT A;  2N17 A;  1WGC A;  9WGA A;  2NU0 I;  1VDD A;  1CE3 A;  1OYV I;  3QTL D;  2L7X A;  1AN1 I;  1HJA I;  3VDU A;  4E1R A;  1CGJ I;  1WTJ A;  1FAQ A;  1PCE A;  1U5K A;  1KMA A;  2DKV A;  2V1C A;  1Y1C A;  2CJS C;  5EX3 A;  1XBT A;  3SEK C;  2PQ8 A;  1R0R I;  1BMO A;  1LR8 A;  1DS2 I;  2V53 A;  2WGC A;  1IW4 A;  1SGE I;  1TBO A;  2KMP A;  1SGD I;  1HEV A;  2ERW A;  2NU4 I;  5CCM A;  1M8C A;  1Y1B A;  2VRW B;  2SGF I;  1TUS A;  1IY5 A;  3R5D A;  2OVO A;  5FUX A;  4L9M A;  2QQE A;  3UOE A;  2CWF A;  2ELI A;  4MPI A;  3KY9 A;  1RFH A;  1TBQ R;  2GVI A;  3UEJ A;  1K7U A;  2DIP A;  5FUY A;  3UFF A;  2A20 A;  4DNC A;  2ORV A;  3TJQ A;  3SGB I;  3UGD A;  1MT1 A;  2V1C C;  4AML A;  1LR9 A;  3OXF A;  2UVO A;  1CSO I;  2JXD A;  2YQP A;  4A24 A;  2K9H A;  5JHW C;  1MJB A;  2JA1 A;  3E2I A;  1YU6 C;  2NU2 I;  1Z7K B;  1TIH A;  2ORW A;  1SGP I;  2GKR I;  3R5B A;  1KBF A;  1ULM A;  1CGI I;  1TOT A;  2OZU A;  1XA6 A;  2JZM A;  1X74 A;  2N52 A;  1NXU A;  1OMU A;  1SGN I;  3CXL A;  5E3Q A;  2LEO A;  4UXI A;  5HI7 A;  1V1I A;  3UEY A;  3UGL A;  1UVF A;  2N1A B;  3OL0 A;  2B0U C;  5CCL A;  2NU3 I;  2NU1 I;  4SGB I;  1S20 A;  1P9G A;  2QQC A;  2Y0M A;  1CT4 I;  5E3R A;  2UZ3 A;  1IY6 A;  1MJA A;  1UHA A;  2ENN A;  1Y8F A;  3PDN A;  2JW6 A;  2OD1 A;  4OVO A;  5EX0 A;  4UXH A;  1PTR A;  3FSY A;  2QQD A;  1ULK A;  1UVG A;  1SGY I; 
#chains in the Genus database with same CATH homology
 4HGU A;  3QWP A;  1W3S A;  2ROW A;  2QQ0 A;  1V1H A;  2J9R A;  2YUU A;  4GI3 C;  5HQ8 A;  4FKD A;  5FUV A;  2KMQ A;  3FC3 A;  2QPO A;  2KMR A;  2JYY A;  2GKV A;  1LR7 A;  1N13 A;  1R79 A;  2P6A C;  1TBN A;  2J87 A;  2SGD I;  2N71 A;  1SGR I;  1YTP A;  5DAE A;  1KBE A;  2ODD A;  1XX6 A;  3D00 A;  1H0Z A;  2E73 A;  1FYB A;  1UUC A;  1PTQ A;  1CHO I;  2DB6 A;  1OVO A;  2GKT I;  2M5X A;  2WCY A;  1TBR R;  2FNF X;  2SGP I;  1FAR A;  1HDL A;  3E59 A;  2KCX A;  2W0T A;  1W4R A;  1PJU A;  1HPT A;  2LUY A;  3BJI A;  2SGQ I;  1X4S A;  3HH2 C;  3GOX A;  3VE5 A;  2KMO A;  1BUS A;  1CT0 I;  1DS3 I;  2L8E A;  3B4V C;  3MEK A;  4E1P A;  1TGS I;  1CT2 I;  2WVJ A;  4UXJ A;  1SGQ I;  2BUS A;  2ARP F;  3RU0 A;  3UGI A;  2B8T A;  1PPF I;  1TUR A;  4JCV E;  5FUW A;  1NUB A;  4B6D A;  2SGE I;  3OVO A;  3OXL A;  2F3C I;  3SGQ I;  1M8B A;  2E5R A;  2XRC A;  3OXG A;  2ENZ A;  1OMT A;  2N17 A;  1CE3 A;  2NU0 I;  1VDD A;  1OYV I;  3QTL D;  2L7X A;  1AN1 I;  1HJA I;  3VDU A;  4E1R A;  1CGJ I;  1FAQ A;  1PCE A;  1U5K A;  1KMA A;  2V1C A;  1Y1C A;  2CJS C;  5EX3 A;  1XBT A;  3SEK C;  1R0R I;  1BMO A;  1LR8 A;  1DS2 I;  2V53 A;  1IW4 A;  1SGE I;  1TBO A;  2KMP A;  1SGD I;  2ERW A;  2NU4 I;  5CCM A;  1M8C A;  1Y1B A;  2VRW B;  2SGF I;  1TUS A;  1IY5 A;  2OVO A;  5FUX A;  4L9M A;  2QQE A;  2ELI A;  3KY9 A;  1RFH A;  1TBQ R;  2GVI A;  3UEJ A;  3UFF A;  2DIP A;  5FUY A;  2A20 A;  2ORV A;  3TJQ A;  3SGB I;  3UGD A;  1MT1 A;  2V1C C;  1LR9 A;  3OXF A;  1CSO I;  2JXD A;  2YQP A;  4A24 A;  2K9H A;  5JHW C;  2JA1 A;  3E2I A;  1YU6 C;  2NU2 I;  1Z7K B;  1TIH A;  2ORW A;  1SGP I;  2GKR I;  1KBF A;  1CGI I;  1TOT A;  1XA6 A;  2JZM A;  1X74 A;  2N52 A;  1OMU A;  1SGN I;  3CXL A;  3VDP A;  2LEO A;  4UXI A;  5HI7 A;  1V1I A;  3UEY A;  3UGL A;  1UVF A;  2N1A B;  3OL0 A;  2B0U C;  5CCL A;  2NU3 I;  2NU1 I;  4SGB I;  2QQC A;  1CT4 I;  1IY6 A;  2UZ3 A;  2ENN A;  1Y8F A;  3PDN A;  2JW6 A;  2OD1 A;  4OVO A;  5EX0 A;  4UXH A;  1PTR A;  2QQD A;  1UVG A;  1SGY I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...