1DS3I

Crystal structure of omtky3-ch2-asp19i
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
51
structure length
50
Chain Sequence
VDCSEYPKPACTDYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OVOMUCOID
publication title Contribution of peptide bonds to inhibitor-protease binding: crystal structures of the turkey ovomucoid third domain backbone variants OMTKY3-Pro18I and OMTKY3-psi[COO]-Leu18I in complex with Streptomyces griseus proteinase B (SGPB) and the structure of the free inhibitor, OMTKY-3-psi[CH2NH2+]-Asp19I
pubmed doi rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase inhibitor
total genus 12
structure length 50
sequence length 51
ec nomenclature
pdb deposition date 2000-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1ds3I00
1CT2I 5JHWC 5DAEA 1DS3I 1IW4A 2SGDI 1TUSA 1TBQR 1SGEI 2OVOA 1BMOA 2NU3I 2F3CI 2N52A 1TURA 1SGQI 1NUBA 2KMOA 2P6AC 2QQCA 1H0ZA 1IY6A 1LR9A 2GKRI 1HDLA 4SGBI 2SGPI 2V53A 2NU2I 1TGSI 1IY5A 2ARPF 2JXDA 1BUSA 1FYBA 1TBRR 1SGNI 3SGQI 1CGII 2SGEI 1M8BA 1CT0I 2KMPA 2KCXA 1LR7A 2SGQI 1HPTA 1CE3A 1MT1A 2XRCA 3SEKC 2N17A 1OMTA 1YU6C 3B4VC 4HGUA 1OVOA 1CGJI 1YTPA 1CSOI 2N71A 2LEOA 1Y1BA 1KMAA 2GKTI 1UVFA 1TIHA 2SGFI 1Y1CA 1UUCA 4GI3C 1PJUA 3TJQA 1CT4I 1SGPI 2JZMA 1PPFI 2KMQA 2QQDA 3OVOA 2BUSA 2M5XA 1M8CA 1OMUA 1UVGA 2NU1I 3SGBI 4OVOA 1Z7KB 1HJAI 2ERWA 3HH2C 1R0RI 2B0UC 2WCYA 1SGYI 1LR8A 2NU0I 1N13A 1DS2I 1PCEA 1SGDI 1SGRI 1CHOI 2GKVA 2NU4I 1AN1I 3QTLD 2KMRA 2JYYA 1OYVI
chains in the Genus database with same CATH superfamily
2ODDA 1CT2I 3BJIA 1W3SA 5JHWC 2X3TA 2QQ0A 2GVIA 1ULNA 1R79A 1DS3I 2DKVA 5DAEA 5E3PA 1S20A 2VRWB 2WGCA 3TOAA 1K7UA 1X74A 3R5CA 5HI7A 3UGLA 2OZUA 4UXIA 5J8FA 2FNFX 1IW4A 2SGDI 1TUSA 1FY7A 1TBQR 1SGEI 2E5RA 2OVOA 5CCMA 1BMOA 1V1HA 5EX0A 2NU3I 3UFFA 1MJAA 2F3CI 2ORVA 3UGIA 4DNCA 1RFHA 2ROWA 3VDPA 2N52A 2A20A 1TURA 1SGQI 5J8CA 2ORWA 4UXJA 2E73A 1NUBA 2WVJA 3GOXA 1KBEA 2KMOA 3TO9A 3UGDA 2P6AC 2QQCA 1H0ZA 2RIJA 1IY6A 3VE5A 4AMLA 9WGAA 1LR9A 2ENNA 2GKRI 1HDLA 4SGBI 2SGPI 1XA6A 2ENZA 2NU2I 2OD1A 2V53A 1MJBA 1TGSI 1PTRA 3R5DA 2CWFA 1W4RA 2ARPF 2JXDA 1BUSA 2YUUA 1IY5A 1TBRR 1TBOA 1FYBA 1SGNI 5E3RA 1CGII 2SGEI 4FKDA 3SGQI 1M8BA 3UOEA 4JCVE 1CT0I 3RU0A 2KMPA 2KCXA 3VDUA 4L9MA 1LR7A 5FUYA 2CJSC 2SGQI 4B6DA 1HPTA 3UEJA 1CE3A 1MT1A 2XRCA 2ELIA 3E2IA 3SEKC 5EX3A 2N17A 2UVOA 2V1CA 1OMTA 2K9HA 3QAHA 3R5BA 5CCLA 1YU6C 3B4VC 2CWHA 3FSYA 3OXLA 3E59A 4HGUA 2LUYA 1OVOA 3FSXA 2JW6A 2J9RA 2RC4A 2Y0MA 1CGJI 4MPIA 2LB7A 1KBFA 3D00A 1U5KA 1XBTA 1CSOI 1YTPA 2N71A 2LEOA 1Y1BA 1KMAA 7WGAA 1TOTA 1V1IA 2GKTI 5FUXA 1ULMA 2V1CC 5HQ8A 1UVFA 3OXFA 1UHAA 4E1PA 1TIHA 1XX6A 1WGTA 1Y1CA 2SGFI 2UZ3A 1UUCA 1HEVA 1Y8FA 4GI3C 2L8EA 1PJUA 2B8TA 2QPOA 1X4SA 1K7VA 3OXGA 3TJQA 3TO7A 1CT4I 1SGPI 3TOBA 2CWGA 2JZMA 1PPFI 4A24A 2L7XA 2N1AB 2KMQA 1PTQA 1VDDA 2QQDA 1NXUA 3KY9A 5FUWA 1P9ZA 1WGCA 3OVOA 2BUSA 2M5XA 3PDNA 2OU2A 2PQ8A 1M8CA 1OMUA 1UVGA 2NU1I 3UEYA 2X52A 1Z2IA 3SGBI 1FAQA 4OVOA 1WTJA 2JA1A 1Z7KB 1HJAI 2ERWA 3HH2C 2DIPA 1WKXA 1R0RI 3TO6A 2B0UC 2WCYA 5FUVA 1Q9BA 1SGYI 1LR8A 1K7TA 2NU0I 1N13A 1DS2I 2YQPA 1PCEA 4E1RA 1P9GA 1TBNA 2W0TA 1SGDI 3CXLA 1FARA 3R5AA 1SGRI 2J87A 3OL0A 1ULKA 1CHOI 2DB6A 2QQEA 2GKVA 3MEKA 3FC3A 3QWPA 2GIVA 2NU4I 4UXHA 1AN1I 5E3QA 3QTLD 2KMRA 2JYYA 1OYVI 4WP4A 1MJ9A
chains in the Genus database with same CATH topology
2ODDA 1CT2I 3BJIA 1W3SA 5JHWC 2QQ0A 2GVIA 1R79A 1DS3I 5DAEA 2VRWB 1X74A 5HI7A 3UGLA 4UXIA 2FNFX 1IW4A 2SGDI 1TUSA 1TBQR 2E5RA 1SGEI 2OVOA 5CCMA 1BMOA 1V1HA 5EX0A 2NU3I 3UFFA 3UGIA 2F3CI 2ORVA 1RFHA 2ROWA 3VDPA 2N52A 2A20A 1TURA 1SGQI 2ORWA 4UXJA 2E73A 1NUBA 2WVJA 3GOXA 1KBEA 2KMOA 3UGDA 2P6AC 2QQCA 1H0ZA 1IY6A 3VE5A 1LR9A 2ENNA 2GKRI 1HDLA 4SGBI 2SGPI 1XA6A 2ENZA 2NU2I 2OD1A 2V53A 1TGSI 1PTRA 1IY5A 1W4RA 2ARPF 2JXDA 1BUSA 2YUUA 1FYBA 1TBRR 1TBOA 1SGNI 3SGQI 1CGII 2SGEI 4FKDA 1M8BA 4JCVE 1CT0I 3RU0A 2KMPA 2KCXA 3VDUA 4L9MA 1LR7A 5FUYA 2CJSC 2SGQI 4B6DA 1HPTA 3UEJA 1CE3A 1MT1A 2XRCA 2ELIA 3E2IA 3SEKC 2N17A 2V1CA 1OMTA 2K9HA 5CCLA 1YU6C 3B4VC 3OXLA 3E59A 4HGUA 2LUYA 1OVOA 1KBFA 2JW6A 2J9RA 1CGJI 3D00A 1U5KA 1XBTA 1CSOI 1YTPA 2N71A 2LEOA 1Y1BA 1KMAA 1TOTA 1V1IA 2GKTI 5FUXA 2V1CC 5HQ8A 1UVFA 3OXFA 4E1PA 1TIHA 1XX6A 1Y1CA 2SGFI 2UZ3A 1UUCA 1Y8FA 4GI3C 2L8EA 1PJUA 2B8TA 2QPOA 1X4SA 3OXGA 3TJQA 1CT4I 1SGPI 2JZMA 1PPFI 4A24A 2L7XA 2N1AB 2KMQA 1PTQA 1VDDA 2QQDA 3KY9A 5FUWA 3OVOA 2BUSA 2M5XA 3PDNA 1M8CA 1OMUA 1UVGA 2NU1I 3UEYA 3SGBI 1FAQA 4OVOA 2JA1A 1Z7KB 1HJAI 2ERWA 3HH2C 2DIPA 1R0RI 2B0UC 2WCYA 5FUVA 1SGYI 1LR8A 2NU0I 1N13A 1DS2I 2YQPA 1PCEA 4E1RA 1TBNA 2W0TA 1SGDI 3CXLA 1FARA 1SGRI 2J87A 3OL0A 1CHOI 2DB6A 2QQEA 2GKVA 3MEKA 3FC3A 3QWPA 4UXHA 2NU4I 1AN1I 3QTLD 2KMRA 2JYYA 1OYVI 5EX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CT2 I;  5JHW C;  5DAE A;  1DS3 I;  1IW4 A;  2SGD I;  1TUS A;  1TBQ R;  1SGE I;  2OVO A;  1BMO A;  2NU3 I;  2F3C I;  2N52 A;  1TUR A;  1SGQ I;  1NUB A;  2KMO A;  2P6A C;  2QQC A;  1H0Z A;  1IY6 A;  1LR9 A;  2GKR I;  1HDL A;  4SGB I;  2SGP I;  2V53 A;  2NU2 I;  1TGS I;  1IY5 A;  2ARP F;  2JXD A;  1BUS A;  1FYB A;  1TBR R;  1SGN I;  3SGQ I;  1CGI I;  2SGE I;  1M8B A;  1CT0 I;  2KMP A;  2KCX A;  1LR7 A;  2SGQ I;  1HPT A;  1CE3 A;  1MT1 A;  2XRC A;  3SEK C;  2N17 A;  1OMT A;  1YU6 C;  3B4V C;  4HGU A;  1OVO A;  1CGJ I;  1YTP A;  1CSO I;  2N71 A;  2LEO A;  1Y1B A;  1KMA A;  2GKT I;  1UVF A;  1TIH A;  2SGF I;  1Y1C A;  1UUC A;  4GI3 C;  1PJU A;  3TJQ A;  1CT4 I;  1SGP I;  2JZM A;  1PPF I;  2KMQ A;  2QQD A;  3OVO A;  2BUS A;  2M5X A;  1M8C A;  1OMU A;  1UVG A;  2NU1 I;  3SGB I;  4OVO A;  1Z7K B;  1HJA I;  2ERW A;  3HH2 C;  1R0R I;  2B0U C;  2WCY A;  1SGY I;  1LR8 A;  2NU0 I;  1N13 A;  1DS2 I;  1PCE A;  1SGD I;  1SGR I;  1CHO I;  2GKV A;  2NU4 I;  1AN1 I;  3QTL D;  2KMR A;  2JYY A;  1OYV I; 
#chains in the Genus database with same CATH topology
 2ODD A;  1CT2 I;  3BJI A;  1W3S A;  5JHW C;  2X3T A;  2QQ0 A;  2GVI A;  1ULN A;  1R79 A;  1DS3 I;  2DKV A;  5DAE A;  5E3P A;  1S20 A;  2VRW B;  2WGC A;  3TOA A;  1K7U A;  1X74 A;  3R5C A;  5HI7 A;  3UGL A;  2OZU A;  4UXI A;  5J8F A;  2FNF X;  1IW4 A;  2SGD I;  1TUS A;  1FY7 A;  1TBQ R;  1SGE I;  2E5R A;  2OVO A;  5CCM A;  1BMO A;  1V1H A;  5EX0 A;  2NU3 I;  3UFF A;  1MJA A;  2F3C I;  2ORV A;  3UGI A;  4DNC A;  1RFH A;  2ROW A;  3VDP A;  2N52 A;  2A20 A;  1TUR A;  1SGQ I;  5J8C A;  2ORW A;  4UXJ A;  2E73 A;  1NUB A;  2WVJ A;  3GOX A;  1KBE A;  2KMO A;  3TO9 A;  3UGD A;  2P6A C;  2QQC A;  1H0Z A;  2RIJ A;  1IY6 A;  3VE5 A;  4AML A;  9WGA A;  1LR9 A;  2ENN A;  2GKR I;  1HDL A;  4SGB I;  2SGP I;  1XA6 A;  2ENZ A;  2NU2 I;  2OD1 A;  2V53 A;  1MJB A;  1TGS I;  1PTR A;  3R5D A;  2CWF A;  1W4R A;  2ARP F;  2JXD A;  1BUS A;  2YUU A;  1IY5 A;  1TBR R;  1TBO A;  1FYB A;  1SGN I;  5E3R A;  1CGI I;  2SGE I;  4FKD A;  3SGQ I;  1M8B A;  3UOE A;  4JCV E;  1CT0 I;  3RU0 A;  2KMP A;  2KCX A;  3VDU A;  4L9M A;  1LR7 A;  5FUY A;  2CJS C;  2SGQ I;  4B6D A;  1HPT A;  3UEJ A;  1CE3 A;  1MT1 A;  2XRC A;  2ELI A;  3E2I A;  3SEK C;  5EX3 A;  2N17 A;  2UVO A;  2V1C A;  1OMT A;  2K9H A;  3QAH A;  3R5B A;  5CCL A;  1YU6 C;  3B4V C;  2CWH A;  3FSY A;  3OXL A;  3E59 A;  4HGU A;  2LUY A;  1OVO A;  3FSX A;  2JW6 A;  2J9R A;  2RC4 A;  2Y0M A;  1CGJ I;  4MPI A;  2LB7 A;  1KBF A;  3D00 A;  1U5K A;  1XBT A;  1CSO I;  1YTP A;  2N71 A;  2LEO A;  1Y1B A;  1KMA A;  7WGA A;  1TOT A;  1V1I A;  2GKT I;  5FUX A;  1ULM A;  2V1C C;  5HQ8 A;  1UVF A;  3OXF A;  1UHA A;  4E1P A;  1TIH A;  1XX6 A;  1WGT A;  1Y1C A;  2SGF I;  2UZ3 A;  1UUC A;  1HEV A;  1Y8F A;  4GI3 C;  2L8E A;  1PJU A;  2B8T A;  2QPO A;  1X4S A;  1K7V A;  3OXG A;  3TJQ A;  3TO7 A;  1CT4 I;  1SGP I;  3TOB A;  2CWG A;  2JZM A;  1PPF I;  4A24 A;  2L7X A;  2N1A B;  2KMQ A;  1PTQ A;  1VDD A;  2QQD A;  1NXU A;  3KY9 A;  5FUW A;  1P9Z A;  1WGC A;  3OVO A;  2BUS A;  2M5X A;  3PDN A;  2OU2 A;  2PQ8 A;  1M8C A;  1OMU A;  1UVG A;  2NU1 I;  3UEY A;  2X52 A;  1Z2I A;  3SGB I;  1FAQ A;  4OVO A;  1WTJ A;  2JA1 A;  1Z7K B;  1HJA I;  2ERW A;  3HH2 C;  2DIP A;  1WKX A;  1R0R I;  3TO6 A;  2B0U C;  2WCY A;  5FUV A;  1Q9B A;  1SGY I;  1LR8 A;  1K7T A;  2NU0 I;  1N13 A;  1DS2 I;  2YQP A;  1PCE A;  4E1R A;  1P9G A;  1TBN A;  2W0T A;  1SGD I;  3CXL A;  1FAR A;  3R5A A;  1SGR I;  2J87 A;  3OL0 A;  1ULK A;  1CHO I;  2DB6 A;  2QQE A;  2GKV A;  3MEK A;  3FC3 A;  3QWP A;  2GIV A;  2NU4 I;  4UXH A;  1AN1 I;  5E3Q A;  3QTL D;  2KMR A;  2JYY A;  1OYV I;  4WP4 A;  1MJ9 A; 
#chains in the Genus database with same CATH homology
 2ODD A;  1CT2 I;  3BJI A;  1W3S A;  5JHW C;  2QQ0 A;  2GVI A;  1R79 A;  1DS3 I;  5DAE A;  2VRW B;  1X74 A;  5HI7 A;  3UGL A;  4UXI A;  2FNF X;  1IW4 A;  2SGD I;  1TUS A;  1TBQ R;  2E5R A;  1SGE I;  2OVO A;  5CCM A;  1BMO A;  1V1H A;  5EX0 A;  2NU3 I;  3UFF A;  3UGI A;  2F3C I;  2ORV A;  1RFH A;  2ROW A;  3VDP A;  2N52 A;  2A20 A;  1TUR A;  1SGQ I;  2ORW A;  4UXJ A;  2E73 A;  1NUB A;  2WVJ A;  3GOX A;  1KBE A;  2KMO A;  3UGD A;  2P6A C;  2QQC A;  1H0Z A;  1IY6 A;  3VE5 A;  1LR9 A;  2ENN A;  2GKR I;  1HDL A;  4SGB I;  2SGP I;  1XA6 A;  2ENZ A;  2NU2 I;  2OD1 A;  2V53 A;  1TGS I;  1PTR A;  1IY5 A;  1W4R A;  2ARP F;  2JXD A;  1BUS A;  2YUU A;  1FYB A;  1TBR R;  1TBO A;  1SGN I;  3SGQ I;  1CGI I;  2SGE I;  4FKD A;  1M8B A;  4JCV E;  1CT0 I;  3RU0 A;  2KMP A;  2KCX A;  3VDU A;  4L9M A;  1LR7 A;  5FUY A;  2CJS C;  2SGQ I;  4B6D A;  1HPT A;  3UEJ A;  1CE3 A;  1MT1 A;  2XRC A;  2ELI A;  3E2I A;  3SEK C;  2N17 A;  2V1C A;  1OMT A;  2K9H A;  5CCL A;  1YU6 C;  3B4V C;  3OXL A;  3E59 A;  4HGU A;  2LUY A;  1OVO A;  1KBF A;  2JW6 A;  2J9R A;  1CGJ I;  3D00 A;  1U5K A;  1XBT A;  1CSO I;  1YTP A;  2N71 A;  2LEO A;  1Y1B A;  1KMA A;  1TOT A;  1V1I A;  2GKT I;  5FUX A;  2V1C C;  5HQ8 A;  1UVF A;  3OXF A;  4E1P A;  1TIH A;  1XX6 A;  1Y1C A;  2SGF I;  2UZ3 A;  1UUC A;  1Y8F A;  4GI3 C;  2L8E A;  1PJU A;  2B8T A;  2QPO A;  1X4S A;  3OXG A;  3TJQ A;  1CT4 I;  1SGP I;  2JZM A;  1PPF I;  4A24 A;  2L7X A;  2N1A B;  2KMQ A;  1PTQ A;  1VDD A;  2QQD A;  3KY9 A;  5FUW A;  3OVO A;  2BUS A;  2M5X A;  3PDN A;  1M8C A;  1OMU A;  1UVG A;  2NU1 I;  3UEY A;  3SGB I;  1FAQ A;  4OVO A;  2JA1 A;  1Z7K B;  1HJA I;  2ERW A;  3HH2 C;  2DIP A;  1R0R I;  2B0U C;  2WCY A;  5FUV A;  1SGY I;  1LR8 A;  2NU0 I;  1N13 A;  1DS2 I;  2YQP A;  1PCE A;  4E1R A;  1TBN A;  2W0T A;  1SGD I;  3CXL A;  1FAR A;  1SGR I;  2J87 A;  3OL0 A;  1CHO I;  2DB6 A;  2QQE A;  2GKV A;  3MEK A;  3FC3 A;  3QWP A;  4UXH A;  2NU4 I;  1AN1 I;  3QTL D;  2KMR A;  2JYY A;  1OYV I;  5EX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...