1DS3I

Crystal structure of omtky3-ch2-asp19i
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
51
structure length
50
Chain Sequence
VDCSEYPKPACTDYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OVOMUCOID
publication title Contribution of peptide bonds to inhibitor-protease binding: crystal structures of the turkey ovomucoid third domain backbone variants OMTKY3-Pro18I and OMTKY3-psi[COO]-Leu18I in complex with Streptomyces griseus proteinase B (SGPB) and the structure of the free inhibitor, OMTKY-3-psi[CH2NH2+]-Asp19I
pubmed doi rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase inhibitor
total genus 12
structure length 50
sequence length 51
ec nomenclature
pdb deposition date 2000-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1ds3I00
2LEOA 2N71A 2GKVA 1DS2I 2NU1I 1TURA 3HH2C 2N52A 1BMOA 2ARPF 1R0RI 5DAEA 4HGUA 1Y1CA 2SGPI 1CSOI 1PCEA 1SGYI 2SGDI 3QTLD 1IY5A 2KMPA 1OMTA 1OVOA 1OYVI 1N13A 1CT0I 2GKTI 1SGQI 1TBRR 3OVOA 2KMOA 1H0ZA 2KMRA 1UVGA 1BUSA 1TIHA 2JYYA 1M8CA 2SGQI 1UUCA 1AN1I 1CT2I 2KCXA 1Y1BA 2QQCA 1TGSI 2NU4I 1FYBA 1TUSA 1HJAI 1CT4I 2N17A 2F3CI 1HDLA 2V53A 2GKRI 1PJUA 4GI3C 1HPTA 1LR8A 1DS3I 2JXDA 1YU6C 1UVFA 3SGBI 2QQDA 1Z7KB 2NU0I 1CGII 4SGBI 2M5XA 1CGJI 1SGEI 2JZMA 1CHOI 2B0UC 1SGPI 1TBQR 1MT1A 3B4VC 2NU3I 1KMAA 1YTPA 1OMUA 2WCYA 1NUBA 1M8BA 1LR9A 1SGNI 1SGDI 2SGFI 2NU2I 1CE3A 5JHWC 4OVOA 1PPFI 3TJQA 1IW4A 1SGRI 2SGEI 2XRCA 2BUSA 3SEKC 1IY6A 2ERWA 3SGQI 2P6AC 2KMQA 1LR7A 2OVOA
chains in the Genus database with same CATH superfamily
2LEOA 3GOXA 3VDPA 1FAQA 2DIPA 2N71A 5J8CA 1KBEA 2LUYA 3D00A 2GKVA 4DNCA 1DS2I 2X52A 4UXIA 1Q9BA 3OXLA 3TOBA 5CCMA 3TO7A 2NU1I 1TURA 2ELIA 3HH2C 3R5BA 2N52A 1HEVA 1BMOA 2ARPF 7WGAA 3UOEA 4UXJA 1R0RI 5DAEA 2ORVA 4AMLA 4HGUA 2ROWA 1MJBA 1X4SA 3R5AA 3FSYA 1Y8FA 1XA6A 1Y1CA 2WGCA 2GIVA 2SGPI 3QAHA 2ENNA 1KBFA 3UGLA 1CSOI 1PCEA 1R79A 1SGYI 2SGDI 2V1CC 2OZUA 3QTLD 2RC4A 5E3PA 1IY5A 2QQ0A 5FUWA 2KMPA 1OMTA 1OVOA 1OYVI 1N13A 3MEKA 2E73A 3VE5A 1CT0I 1PTQA 2GKTI 2J87A 1WKXA 3BJIA 1SGQI 1TBRR 2YQPA 1X74A 2L8EA 2WVJA 3CXLA 3OVOA 5E3RA 3FC3A 1Z2IA 2KMOA 3E2IA 1V1HA 4UXHA 1H0ZA 2RIJA 2KMRA 1UVGA 2UZ3A 1BUSA 1TIHA 1XBTA 2CJSC 2JYYA 1M8CA 2SGQI 2VRWB 2ENZA 1UUCA 2FNFX 1AN1I 1CT2I 2KCXA 2JA1A 1K7UA 3QWPA 3E59A 5FUVA 4B6DA 4A24A 1Y1BA 5CCLA 1V1IA 3TO9A 2QQCA 3VDUA 5FUYA 1TGSI 2NU4I 2J9RA 2X3TA 3UEJA 5HQ8A 1FYBA 1TUSA 1HJAI 1CT4I 2K9HA 2A20A 5E3QA 2F3CI 2N17A 1HDLA 2L7XA 5FUXA 9WGAA 2V53A 2Y0MA 2W0TA 2GKRI 1PJUA 4GI3C 3OXFA 3TOAA 1HPTA 3R5CA 3RU0A 1LR8A 3R5DA 1DS3I 2ODDA 1WTJA 2V1CA 3PDNA 4FKDA 2JXDA 1YU6C 2PQ8A 2QPOA 1MJ9A 1UVFA 2LB7A 3SGBI 2QQDA 5EX0A 2N1AB 1UHAA 1Z7KB 2NU0I 1CGII 1K7VA 5EX3A 4SGBI 4MPIA 3UGDA 1P9GA 2M5XA 1CGJI 1S20A 1SGEI 1CHOI 2CWHA 1ULMA 2JZMA 1FY7A 1SGPI 2B0UC 2YUUA 1TBQR 3OXGA 1MT1A 3B4VC 2NU3I 3OL0A 1KMAA 1K7TA 1YTPA 1OMUA 1VDDA 2QQEA 2WCYA 1NUBA 1U5KA 1PTRA 1FARA 1ULNA 3UFFA 1M8BA 1LR9A 1SGNI 1XX6A 1SGDI 1TBNA 4JCVE 2SGFI 1MJAA 1NXUA 1WGCA 2JW6A 3UGIA 3KY9A 2NU2I 4WP4A 1CE3A 1TOTA 5JHWC 3FSXA 2ORWA 4OVOA 2OD1A 1WGTA 1W4RA 1PPFI 1RFHA 2OU2A 2DB6A 3TJQA 4L9MA 2B8TA 3TO6A 1IW4A 5J8FA 1SGRI 1ULKA 2SGEI 2XRCA 3UEYA 4E1RA 1W3SA 2CWGA 2BUSA 3SEKC 2DKVA 2ERWA 5HI7A 3SGQI 1IY6A 2P6AC 2GVIA 2E5RA 1P9ZA 1TBOA 4E1PA 2UVOA 2KMQA 1LR7A 2OVOA 2CWFA
chains in the Genus database with same CATH topology
2LEOA 3GOXA 3VDPA 1FAQA 2DIPA 2N71A 1KBEA 2LUYA 3D00A 2GKVA 1DS2I 4UXIA 3OXLA 5CCMA 2NU1I 1TURA 2ELIA 3HH2C 2N52A 1BMOA 2ARPF 4UXJA 1R0RI 5DAEA 2ORVA 4HGUA 2ROWA 1X4SA 1Y8FA 1XA6A 1Y1CA 2SGPI 2ENNA 1KBFA 3UGLA 1CSOI 1PCEA 1R79A 1SGYI 2SGDI 2V1CC 3QTLD 1IY5A 2QQ0A 5FUWA 2KMPA 1OMTA 1OVOA 1OYVI 1N13A 3MEKA 2E73A 3VE5A 1CT0I 1PTQA 2GKTI 2J87A 3BJIA 3CXLA 1SGQI 1TBRR 2YQPA 1X74A 2L8EA 2WVJA 3FC3A 3OVOA 3E2IA 2KMOA 1V1HA 4UXHA 1H0ZA 2KMRA 1UVGA 2UZ3A 1BUSA 1TIHA 1XBTA 2CJSC 2JYYA 1M8CA 2SGQI 2VRWB 2ENZA 1UUCA 2FNFX 1AN1I 1CT2I 2KCXA 2JA1A 3QWPA 3E59A 5FUVA 4B6DA 4A24A 1Y1BA 5CCLA 1V1IA 3VDUA 2QQCA 5FUYA 1TGSI 2NU4I 2J9RA 3UEJA 5HQ8A 1FYBA 1TUSA 1HJAI 1CT4I 2K9HA 2A20A 2F3CI 2N17A 1HDLA 2L7XA 5FUXA 2V53A 2W0TA 2GKRI 1PJUA 4GI3C 3OXFA 1HPTA 3RU0A 1LR8A 1DS3I 2ODDA 2V1CA 3PDNA 4FKDA 2JXDA 1YU6C 2QPOA 1UVFA 3SGBI 2QQDA 5EX0A 2N1AB 1Z7KB 2NU0I 5EX3A 1CGII 4SGBI 3UGDA 2M5XA 1CGJI 1SGEI 2JZMA 1CHOI 2YUUA 2B0UC 1SGPI 1TBQR 3OXGA 1MT1A 3B4VC 2NU3I 3OL0A 1KMAA 1YTPA 1OMUA 1VDDA 2QQEA 2WCYA 1NUBA 1U5KA 1PTRA 1FARA 3UFFA 1M8BA 1LR9A 1SGNI 1XX6A 1SGDI 1TBNA 4JCVE 2SGFI 2JW6A 3UGIA 3KY9A 2NU2I 1CE3A 1TOTA 5JHWC 4OVOA 2OD1A 1W4RA 1PPFI 1RFHA 2DB6A 3TJQA 4L9MA 2B8TA 1IW4A 1SGRI 2SGEI 2XRCA 3UEYA 4E1RA 1W3SA 2BUSA 3SEKC 1IY6A 2ERWA 5HI7A 3SGQI 2P6AC 2GVIA 2E5RA 1TBOA 4E1PA 2KMQA 1LR7A 2OVOA 2ORWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LEO A;  2N71 A;  2GKV A;  1DS2 I;  2NU1 I;  1TUR A;  3HH2 C;  2N52 A;  1BMO A;  2ARP F;  1R0R I;  5DAE A;  4HGU A;  1Y1C A;  2SGP I;  1CSO I;  1PCE A;  1SGY I;  2SGD I;  3QTL D;  1IY5 A;  2KMP A;  1OMT A;  1OVO A;  1OYV I;  1N13 A;  1CT0 I;  2GKT I;  1SGQ I;  1TBR R;  3OVO A;  2KMO A;  1H0Z A;  2KMR A;  1UVG A;  1BUS A;  1TIH A;  2JYY A;  1M8C A;  2SGQ I;  1UUC A;  1AN1 I;  1CT2 I;  2KCX A;  1Y1B A;  2QQC A;  1TGS I;  2NU4 I;  1FYB A;  1TUS A;  1HJA I;  1CT4 I;  2N17 A;  2F3C I;  1HDL A;  2V53 A;  2GKR I;  1PJU A;  4GI3 C;  1HPT A;  1LR8 A;  1DS3 I;  2JXD A;  1YU6 C;  1UVF A;  3SGB I;  2QQD A;  1Z7K B;  2NU0 I;  1CGI I;  4SGB I;  2M5X A;  1CGJ I;  1SGE I;  2JZM A;  1CHO I;  2B0U C;  1SGP I;  1TBQ R;  1MT1 A;  3B4V C;  2NU3 I;  1KMA A;  1YTP A;  1OMU A;  2WCY A;  1NUB A;  1M8B A;  1LR9 A;  1SGN I;  1SGD I;  2SGF I;  2NU2 I;  1CE3 A;  5JHW C;  4OVO A;  1PPF I;  3TJQ A;  1IW4 A;  1SGR I;  2SGE I;  2XRC A;  2BUS A;  3SEK C;  1IY6 A;  2ERW A;  3SGQ I;  2P6A C;  2KMQ A;  1LR7 A;  2OVO A; 
#chains in the Genus database with same CATH topology
 2LEO A;  3GOX A;  3VDP A;  1FAQ A;  2DIP A;  2N71 A;  5J8C A;  1KBE A;  2LUY A;  3D00 A;  2GKV A;  4DNC A;  1DS2 I;  2X52 A;  4UXI A;  1Q9B A;  3OXL A;  3TOB A;  5CCM A;  3TO7 A;  2NU1 I;  1TUR A;  2ELI A;  3HH2 C;  3R5B A;  2N52 A;  1HEV A;  1BMO A;  2ARP F;  7WGA A;  3UOE A;  4UXJ A;  1R0R I;  5DAE A;  2ORV A;  4AML A;  4HGU A;  2ROW A;  1MJB A;  1X4S A;  3R5A A;  3FSY A;  1Y8F A;  1XA6 A;  1Y1C A;  2WGC A;  2GIV A;  2SGP I;  3QAH A;  2ENN A;  1KBF A;  3UGL A;  1CSO I;  1PCE A;  1R79 A;  1SGY I;  2SGD I;  2V1C C;  2OZU A;  3QTL D;  2RC4 A;  5E3P A;  1IY5 A;  2QQ0 A;  5FUW A;  2KMP A;  1OMT A;  1OVO A;  1OYV I;  1N13 A;  3MEK A;  2E73 A;  3VE5 A;  1CT0 I;  1PTQ A;  2GKT I;  2J87 A;  1WKX A;  3BJI A;  1SGQ I;  1TBR R;  2YQP A;  1X74 A;  2L8E A;  2WVJ A;  3CXL A;  3OVO A;  5E3R A;  3FC3 A;  1Z2I A;  2KMO A;  3E2I A;  1V1H A;  4UXH A;  1H0Z A;  2RIJ A;  2KMR A;  1UVG A;  2UZ3 A;  1BUS A;  1TIH A;  1XBT A;  2CJS C;  2JYY A;  1M8C A;  2SGQ I;  2VRW B;  2ENZ A;  1UUC A;  2FNF X;  1AN1 I;  1CT2 I;  2KCX A;  2JA1 A;  1K7U A;  3QWP A;  3E59 A;  5FUV A;  4B6D A;  4A24 A;  1Y1B A;  5CCL A;  1V1I A;  3TO9 A;  2QQC A;  3VDU A;  5FUY A;  1TGS I;  2NU4 I;  2J9R A;  2X3T A;  3UEJ A;  5HQ8 A;  1FYB A;  1TUS A;  1HJA I;  1CT4 I;  2K9H A;  2A20 A;  5E3Q A;  2F3C I;  2N17 A;  1HDL A;  2L7X A;  5FUX A;  9WGA A;  2V53 A;  2Y0M A;  2W0T A;  2GKR I;  1PJU A;  4GI3 C;  3OXF A;  3TOA A;  1HPT A;  3R5C A;  3RU0 A;  1LR8 A;  3R5D A;  1DS3 I;  2ODD A;  1WTJ A;  2V1C A;  3PDN A;  4FKD A;  2JXD A;  1YU6 C;  2PQ8 A;  2QPO A;  1MJ9 A;  1UVF A;  2LB7 A;  3SGB I;  2QQD A;  5EX0 A;  2N1A B;  1UHA A;  1Z7K B;  2NU0 I;  1CGI I;  1K7V A;  5EX3 A;  4SGB I;  4MPI A;  3UGD A;  1P9G A;  2M5X A;  1CGJ I;  1S20 A;  1SGE I;  1CHO I;  2CWH A;  1ULM A;  2JZM A;  1FY7 A;  1SGP I;  2B0U C;  2YUU A;  1TBQ R;  3OXG A;  1MT1 A;  3B4V C;  2NU3 I;  3OL0 A;  1KMA A;  1K7T A;  1YTP A;  1OMU A;  1VDD A;  2QQE A;  2WCY A;  1NUB A;  1U5K A;  1PTR A;  1FAR A;  1ULN A;  3UFF A;  1M8B A;  1LR9 A;  1SGN I;  1XX6 A;  1SGD I;  1TBN A;  4JCV E;  2SGF I;  1MJA A;  1NXU A;  1WGC A;  2JW6 A;  3UGI A;  3KY9 A;  2NU2 I;  4WP4 A;  1CE3 A;  1TOT A;  5JHW C;  3FSX A;  2ORW A;  4OVO A;  2OD1 A;  1WGT A;  1W4R A;  1PPF I;  1RFH A;  2OU2 A;  2DB6 A;  3TJQ A;  4L9M A;  2B8T A;  3TO6 A;  1IW4 A;  5J8F A;  1SGR I;  1ULK A;  2SGE I;  2XRC A;  3UEY A;  4E1R A;  1W3S A;  2CWG A;  2BUS A;  3SEK C;  2DKV A;  2ERW A;  5HI7 A;  3SGQ I;  1IY6 A;  2P6A C;  2GVI A;  2E5R A;  1P9Z A;  1TBO A;  4E1P A;  2UVO A;  2KMQ A;  1LR7 A;  2OVO A;  2CWF A; 
#chains in the Genus database with same CATH homology
 2LEO A;  3GOX A;  3VDP A;  1FAQ A;  2DIP A;  2N71 A;  1KBE A;  2LUY A;  3D00 A;  2GKV A;  1DS2 I;  4UXI A;  3OXL A;  5CCM A;  2NU1 I;  1TUR A;  2ELI A;  3HH2 C;  2N52 A;  1BMO A;  2ARP F;  4UXJ A;  1R0R I;  5DAE A;  2ORV A;  4HGU A;  2ROW A;  1X4S A;  1Y8F A;  1XA6 A;  1Y1C A;  2SGP I;  2ENN A;  1KBF A;  3UGL A;  1CSO I;  1PCE A;  1R79 A;  1SGY I;  2SGD I;  2V1C C;  3QTL D;  1IY5 A;  2QQ0 A;  5FUW A;  2KMP A;  1OMT A;  1OVO A;  1OYV I;  1N13 A;  3MEK A;  2E73 A;  3VE5 A;  1CT0 I;  1PTQ A;  2GKT I;  2J87 A;  3BJI A;  3CXL A;  1SGQ I;  1TBR R;  2YQP A;  1X74 A;  2L8E A;  2WVJ A;  3FC3 A;  3OVO A;  3E2I A;  2KMO A;  1V1H A;  4UXH A;  1H0Z A;  2KMR A;  1UVG A;  2UZ3 A;  1BUS A;  1TIH A;  1XBT A;  2CJS C;  2JYY A;  1M8C A;  2SGQ I;  2VRW B;  2ENZ A;  1UUC A;  2FNF X;  1AN1 I;  1CT2 I;  2KCX A;  2JA1 A;  3QWP A;  3E59 A;  5FUV A;  4B6D A;  4A24 A;  1Y1B A;  5CCL A;  1V1I A;  3VDU A;  2QQC A;  5FUY A;  1TGS I;  2NU4 I;  2J9R A;  3UEJ A;  5HQ8 A;  1FYB A;  1TUS A;  1HJA I;  1CT4 I;  2K9H A;  2A20 A;  2F3C I;  2N17 A;  1HDL A;  2L7X A;  5FUX A;  2V53 A;  2W0T A;  2GKR I;  1PJU A;  4GI3 C;  3OXF A;  1HPT A;  3RU0 A;  1LR8 A;  1DS3 I;  2ODD A;  2V1C A;  3PDN A;  4FKD A;  2JXD A;  1YU6 C;  2QPO A;  1UVF A;  3SGB I;  2QQD A;  5EX0 A;  2N1A B;  1Z7K B;  2NU0 I;  5EX3 A;  1CGI I;  4SGB I;  3UGD A;  2M5X A;  1CGJ I;  1SGE I;  2JZM A;  1CHO I;  2YUU A;  2B0U C;  1SGP I;  1TBQ R;  3OXG A;  1MT1 A;  3B4V C;  2NU3 I;  3OL0 A;  1KMA A;  1YTP A;  1OMU A;  1VDD A;  2QQE A;  2WCY A;  1NUB A;  1U5K A;  1PTR A;  1FAR A;  3UFF A;  1M8B A;  1LR9 A;  1SGN I;  1XX6 A;  1SGD I;  1TBN A;  4JCV E;  2SGF I;  2JW6 A;  3UGI A;  3KY9 A;  2NU2 I;  1CE3 A;  1TOT A;  5JHW C;  4OVO A;  2OD1 A;  1W4R A;  1PPF I;  1RFH A;  2DB6 A;  3TJQ A;  4L9M A;  2B8T A;  1IW4 A;  1SGR I;  2SGE I;  2XRC A;  3UEY A;  4E1R A;  1W3S A;  2BUS A;  3SEK C;  1IY6 A;  2ERW A;  5HI7 A;  3SGQ I;  2P6A C;  2GVI A;  2E5R A;  1TBO A;  4E1P A;  2KMQ A;  1LR7 A;  2OVO A;  2ORW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...