3UGIA

Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase c delta
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
b'GSRRASVGSHRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCEFIVTD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein kinase C delta type
publication title Structural and Functional Characterization of an Anesthetic Binding Site in the Second Cysteine-Rich Domain of Protein Kinase Cdelta
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal binding protein
total genus 11
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3ugiA01
1KBEA 1PTRA 4B6DA 4L9MA 2VRWB 2ROWA 5FUYA 2B8TA 1FAQA 1XX6A 3KY9A 1R79A 1RFHA 3BJIA 4UXIA 2ELIA 1FARA 3UFFA 1Y8FA 2QQ0A 3UGIA 1XBTA 1TBNA 2FNFX 3CXLA 3UEJA 3UGLA 2WVJA 2QQEA 2YUUA 2ENNA 2GVIA 5FUVA 1PTQA 1TBOA 1W4RA 2DB6A 2ENZA 2JA1A 2ORVA 2UZ3A 3E2IA 4FKDA 5FUWA 2E73A 2J87A 5FUXA 4UXJA 1KBFA 2J9RA 4UXHA 3UEYA 3UGDA 1XA6A 2QPOA 2ORWA
chains in the Genus database with same CATH superfamily
4B6DA 1PTRA 1TIHA 1LR9A 1MT1A 1YTPA 2B8TA 3SEKC 1S20A 2V1CC 1MJAA 2M5XA 2NU0I 1OVOA 1TGSI 1CT4I 1TUSA 1W3SA 1K7TA 1SGRI 2ODDA 3UFFA 9WGAA 1M8BA 1WKXA 3TOAA 1BUSA 1CHOI 1VDDA 3UEJA 2OD1A 1M8CA 2WVJA 1SGPI 3R5DA 2F3CI 5FUVA 1PTQA 2ENZA 2UZ3A 3QWPA 2JXDA 1NXUA 3OL0A 2V53A 2P6AC 3OVOA 2LUYA 5EX0A 5FUXA 2NU4I 1H0ZA 5E3QA 1ULKA 4UXHA 4E1RA 2SGPI 3TO9A 2OU2A 1P9ZA 5HI7A 2ORWA 1LR8A 1KBEA 5J8FA 1DS3I 3TOBA 1IY5A 2VRWB 2GKVA 2X3TA 1FAQA 1SGNI 3KY9A 4MPIA 1Z7KB 1CT2I 2E5RA 1UVFA 4E1PA 4UXIA 4A24A 1X4SA 3HH2C 1Y8FA 2GKRI 3TJQA 1HDLA 1KMAA 2SGFI 2DKVA 2A20A 3UGLA 2W0TA 1SGYI 2CJSC 2QQEA 2RC4A 1ULNA 1V1HA 2CWHA 2ENNA 2ERWA 2K9HA 3TO6A 5CCLA 1MJ9A 1W4RA 2ARPF 2ORVA 3E2IA 5FUWA 2QQCA 1MJBA 1OMTA 1SGEI 5CCMA 1NUBA 2SGDI 2UVOA 1CSOI 1TBQR 4DNCA 5E3PA 1XA6A 1CE3A 1PCEA 3SGQI 5E3RA 5J8CA 1IY6A 2L8EA 7WGAA 3R5BA 4JCVE 1LR7A 4L9MA 2GKTI 3R5CA 2N71A 2KMRA 2NU1I 3E59A 3MEKA 3SGBI 1K7VA 5FUYA 3VDUA 3OXFA 1HEVA 2N17A 2V1CA 1X74A 1RFHA 3BJIA 5EX3A 1UUCA 1ULMA 1FARA 1WGCA 3QTLD 2QQ0A 4WP4A 2X52A 3PDNA 1Y1BA 2JYYA 2KMOA 2WCYA 3FSXA 1U5KA 1OMUA 1XBTA 1TBNA 2FNFX 3R5AA 3CXLA 5HQ8A 1BMOA 2SGQI 3UOEA 1N13A 2BUSA 1TBOA 3TO7A 2JA1A 1K7UA 2NU3I 2SGEI 1FY7A 4OVOA 1KBFA 1IW4A 1HJAI 2JZMA 3UGDA 3VE5A 1CT0I 3B4VC 1WGTA 2L7XA 2WGCA 1R0RI 1HPTA 2XRCA 1AN1I 2KMPA 1UHAA 3QAHA 4SGBI 2CWFA 1TBRR 3FC3A 2LEOA 2ROWA 1SGDI 1XX6A 1R79A 1WTJA 2N52A 3FSYA 1FYBA 3OXGA 3GOXA 1Q9BA 2ELIA 1DS2I 2RIJA 4HGUA 2NU2I 3RU0A 2Y0MA 1PJUA 2LB7A 3VDPA 5JHWC 3UGIA 2KMQA 2OVOA 2KCXA 1OYVI 1TOTA 2YQPA 2CWGA 2YUUA 3D00A 1TURA 1Y1CA 1V1IA 1Z2IA 2GVIA 2OZUA 1UVGA 2DB6A 2PQ8A 1CGJI 4FKDA 4GI3C 2B0UC 5DAEA 2E73A 2J87A 4UXJA 2GIVA 4AMLA 2J9RA 1PPFI 2JW6A 3UEYA 2QQDA 1P9GA 1SGQI 2N1AB 1CGII 2QPOA 2DIPA 1YU6C 3OXLA
chains in the Genus database with same CATH topology
4B6DA 1PTRA 1TIHA 1LR9A 1MT1A 1YTPA 2B8TA 3SEKC 2V1CC 2M5XA 2NU0I 1OVOA 1TGSI 1CT4I 1TUSA 1W3SA 1SGRI 2ODDA 3UFFA 1M8BA 1BUSA 1CHOI 1VDDA 3UEJA 2OD1A 1M8CA 2WVJA 1SGPI 2F3CI 5FUVA 1PTQA 2ENZA 2UZ3A 3QWPA 2JXDA 3OL0A 2V53A 2P6AC 3OVOA 2LUYA 5EX0A 5FUXA 2NU4I 1H0ZA 4UXHA 4E1RA 2SGPI 5HI7A 2ORWA 1LR8A 1KBEA 1DS3I 1IY5A 2VRWB 2GKVA 1FAQA 1SGNI 3KY9A 1Z7KB 1CT2I 2E5RA 1UVFA 4E1PA 4UXIA 4A24A 1X4SA 3HH2C 1Y8FA 2GKRI 3TJQA 1HDLA 1KMAA 2SGFI 2A20A 3UGLA 2W0TA 1SGYI 2CJSC 2QQEA 2K9HA 1V1HA 2ENNA 5CCLA 2ERWA 1W4RA 2ARPF 2ORVA 3E2IA 5FUWA 2QQCA 1OMTA 1SGEI 5CCMA 1NUBA 2SGDI 1CSOI 1TBQR 1XA6A 1CE3A 1PCEA 3SGQI 1IY6A 2L8EA 4JCVE 1LR7A 4L9MA 2GKTI 2N71A 2KMRA 2NU1I 3E59A 3MEKA 3SGBI 5FUYA 3VDUA 3OXFA 2N17A 2V1CA 1X74A 1RFHA 3BJIA 5EX3A 1UUCA 1FARA 3QTLD 2QQ0A 3PDNA 1Y1BA 2JYYA 2KMOA 2WCYA 1U5KA 1OMUA 1XBTA 1TBNA 2FNFX 5HQ8A 3CXLA 1BMOA 2SGQI 1N13A 2BUSA 1TBOA 2JA1A 2SGEI 2NU3I 4OVOA 1KBFA 1IW4A 1HJAI 2JZMA 3UGDA 3VE5A 1CT0I 3B4VC 2L7XA 1R0RI 1HPTA 2XRCA 1AN1I 2KMPA 4SGBI 1TBRR 3FC3A 2LEOA 2ROWA 1SGDI 1XX6A 1R79A 1FYBA 2N52A 3OXGA 3GOXA 2ELIA 1DS2I 3RU0A 4HGUA 2NU2I 1PJUA 3VDPA 5JHWC 3UGIA 2KMQA 2OVOA 2KCXA 1OYVI 1TOTA 2YQPA 2YUUA 3D00A 1TURA 1Y1CA 1V1IA 2GVIA 4GI3C 1UVGA 2DB6A 4FKDA 1CGJI 2B0UC 5DAEA 2E73A 2J87A 4UXJA 2J9RA 1PPFI 2JW6A 3UEYA 2QQDA 1SGQI 2N1AB 1CGII 2QPOA 2DIPA 1YU6C 3OXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KBE A;  1PTR A;  4B6D A;  4L9M A;  2VRW B;  2ROW A;  5FUY A;  2B8T A;  1FAQ A;  1XX6 A;  3KY9 A;  1R79 A;  1RFH A;  3BJI A;  4UXI A;  2ELI A;  1FAR A;  3UFF A;  1Y8F A;  2QQ0 A;  3UGI A;  1XBT A;  1TBN A;  2FNF X;  3CXL A;  3UEJ A;  3UGL A;  2WVJ A;  2QQE A;  2YUU A;  2ENN A;  2GVI A;  5FUV A;  1PTQ A;  1TBO A;  1W4R A;  2DB6 A;  2ENZ A;  2JA1 A;  2ORV A;  2UZ3 A;  3E2I A;  4FKD A;  5FUW A;  2E73 A;  2J87 A;  5FUX A;  4UXJ A;  1KBF A;  2J9R A;  4UXH A;  3UEY A;  3UGD A;  1XA6 A;  2QPO A;  2ORW A; 
#chains in the Genus database with same CATH topology
 4B6D A;  1PTR A;  1TIH A;  1LR9 A;  1MT1 A;  1YTP A;  2B8T A;  3SEK C;  1S20 A;  2V1C C;  1MJA A;  2M5X A;  2NU0 I;  1OVO A;  1TGS I;  1CT4 I;  1TUS A;  1W3S A;  1K7T A;  1SGR I;  2ODD A;  3UFF A;  9WGA A;  1M8B A;  1WKX A;  3TOA A;  1BUS A;  1CHO I;  1VDD A;  3UEJ A;  2OD1 A;  1M8C A;  2WVJ A;  1SGP I;  3R5D A;  2F3C I;  5FUV A;  1PTQ A;  2ENZ A;  2UZ3 A;  3QWP A;  2JXD A;  1NXU A;  3OL0 A;  2V53 A;  2P6A C;  3OVO A;  2LUY A;  5EX0 A;  5FUX A;  2NU4 I;  1H0Z A;  5E3Q A;  1ULK A;  4UXH A;  4E1R A;  2SGP I;  3TO9 A;  2OU2 A;  1P9Z A;  5HI7 A;  2ORW A;  1LR8 A;  1KBE A;  5J8F A;  1DS3 I;  3TOB A;  1IY5 A;  2VRW B;  2GKV A;  2X3T A;  1FAQ A;  1SGN I;  3KY9 A;  4MPI A;  1Z7K B;  1CT2 I;  2E5R A;  1UVF A;  4E1P A;  4UXI A;  4A24 A;  1X4S A;  3HH2 C;  1Y8F A;  2GKR I;  3TJQ A;  1HDL A;  1KMA A;  2SGF I;  2DKV A;  2A20 A;  3UGL A;  2W0T A;  1SGY I;  2CJS C;  2QQE A;  2RC4 A;  1ULN A;  1V1H A;  2CWH A;  2ENN A;  2ERW A;  2K9H A;  3TO6 A;  5CCL A;  1MJ9 A;  1W4R A;  2ARP F;  2ORV A;  3E2I A;  5FUW A;  2QQC A;  1MJB A;  1OMT A;  1SGE I;  5CCM A;  1NUB A;  2SGD I;  2UVO A;  1CSO I;  1TBQ R;  4DNC A;  5E3P A;  1XA6 A;  1CE3 A;  1PCE A;  3SGQ I;  5E3R A;  5J8C A;  1IY6 A;  2L8E A;  7WGA A;  3R5B A;  4JCV E;  1LR7 A;  4L9M A;  2GKT I;  3R5C A;  2N71 A;  2KMR A;  2NU1 I;  3E59 A;  3MEK A;  3SGB I;  1K7V A;  5FUY A;  3VDU A;  3OXF A;  1HEV A;  2N17 A;  2V1C A;  1X74 A;  1RFH A;  3BJI A;  5EX3 A;  1UUC A;  1ULM A;  1FAR A;  1WGC A;  3QTL D;  2QQ0 A;  4WP4 A;  2X52 A;  3PDN A;  1Y1B A;  2JYY A;  2KMO A;  2WCY A;  3FSX A;  1U5K A;  1OMU A;  1XBT A;  1TBN A;  2FNF X;  3R5A A;  3CXL A;  5HQ8 A;  1BMO A;  2SGQ I;  3UOE A;  1N13 A;  2BUS A;  1TBO A;  3TO7 A;  2JA1 A;  1K7U A;  2NU3 I;  2SGE I;  1FY7 A;  4OVO A;  1KBF A;  1IW4 A;  1HJA I;  2JZM A;  3UGD A;  3VE5 A;  1CT0 I;  3B4V C;  1WGT A;  2L7X A;  2WGC A;  1R0R I;  1HPT A;  2XRC A;  1AN1 I;  2KMP A;  1UHA A;  3QAH A;  4SGB I;  2CWF A;  1TBR R;  3FC3 A;  2LEO A;  2ROW A;  1SGD I;  1XX6 A;  1R79 A;  1WTJ A;  2N52 A;  3FSY A;  1FYB A;  3OXG A;  3GOX A;  1Q9B A;  2ELI A;  1DS2 I;  2RIJ A;  4HGU A;  2NU2 I;  3RU0 A;  2Y0M A;  1PJU A;  2LB7 A;  3VDP A;  5JHW C;  3UGI A;  2KMQ A;  2OVO A;  2KCX A;  1OYV I;  1TOT A;  2YQP A;  2CWG A;  2YUU A;  3D00 A;  1TUR A;  1Y1C A;  1V1I A;  1Z2I A;  2GVI A;  2OZU A;  1UVG A;  2DB6 A;  2PQ8 A;  1CGJ I;  4FKD A;  4GI3 C;  2B0U C;  5DAE A;  2E73 A;  2J87 A;  4UXJ A;  2GIV A;  4AML A;  2J9R A;  1PPF I;  2JW6 A;  3UEY A;  2QQD A;  1P9G A;  1SGQ I;  2N1A B;  1CGI I;  2QPO A;  2DIP A;  1YU6 C;  3OXL A; 
#chains in the Genus database with same CATH homology
 4B6D A;  1PTR A;  1TIH A;  1LR9 A;  1MT1 A;  1YTP A;  2B8T A;  3SEK C;  2V1C C;  2M5X A;  2NU0 I;  1OVO A;  1TGS I;  1CT4 I;  1TUS A;  1W3S A;  1SGR I;  2ODD A;  3UFF A;  1M8B A;  1BUS A;  1CHO I;  1VDD A;  3UEJ A;  2OD1 A;  1M8C A;  2WVJ A;  1SGP I;  2F3C I;  5FUV A;  1PTQ A;  2ENZ A;  2UZ3 A;  3QWP A;  2JXD A;  3OL0 A;  2V53 A;  2P6A C;  3OVO A;  2LUY A;  5EX0 A;  5FUX A;  2NU4 I;  1H0Z A;  4UXH A;  4E1R A;  2SGP I;  5HI7 A;  2ORW A;  1LR8 A;  1KBE A;  1DS3 I;  1IY5 A;  2VRW B;  2GKV A;  1FAQ A;  1SGN I;  3KY9 A;  1Z7K B;  1CT2 I;  2E5R A;  1UVF A;  4E1P A;  4UXI A;  4A24 A;  1X4S A;  3HH2 C;  1Y8F A;  2GKR I;  3TJQ A;  1HDL A;  1KMA A;  2SGF I;  2A20 A;  3UGL A;  2W0T A;  1SGY I;  2CJS C;  2QQE A;  2K9H A;  1V1H A;  2ENN A;  5CCL A;  2ERW A;  1W4R A;  2ARP F;  2ORV A;  3E2I A;  5FUW A;  2QQC A;  1OMT A;  1SGE I;  5CCM A;  1NUB A;  2SGD I;  1CSO I;  1TBQ R;  1XA6 A;  1CE3 A;  1PCE A;  3SGQ I;  1IY6 A;  2L8E A;  4JCV E;  1LR7 A;  4L9M A;  2GKT I;  2N71 A;  2KMR A;  2NU1 I;  3E59 A;  3MEK A;  3SGB I;  5FUY A;  3VDU A;  3OXF A;  2N17 A;  2V1C A;  1X74 A;  1RFH A;  3BJI A;  5EX3 A;  1UUC A;  1FAR A;  3QTL D;  2QQ0 A;  3PDN A;  1Y1B A;  2JYY A;  2KMO A;  2WCY A;  1U5K A;  1OMU A;  1XBT A;  1TBN A;  2FNF X;  5HQ8 A;  3CXL A;  1BMO A;  2SGQ I;  1N13 A;  2BUS A;  1TBO A;  2JA1 A;  2SGE I;  2NU3 I;  4OVO A;  1KBF A;  1IW4 A;  1HJA I;  2JZM A;  3UGD A;  3VE5 A;  1CT0 I;  3B4V C;  2L7X A;  1R0R I;  1HPT A;  2XRC A;  1AN1 I;  2KMP A;  4SGB I;  1TBR R;  3FC3 A;  2LEO A;  2ROW A;  1SGD I;  1XX6 A;  1R79 A;  1FYB A;  2N52 A;  3OXG A;  3GOX A;  2ELI A;  1DS2 I;  3RU0 A;  4HGU A;  2NU2 I;  1PJU A;  3VDP A;  5JHW C;  3UGI A;  2KMQ A;  2OVO A;  2KCX A;  1OYV I;  1TOT A;  2YQP A;  2YUU A;  3D00 A;  1TUR A;  1Y1C A;  1V1I A;  2GVI A;  4GI3 C;  1UVG A;  2DB6 A;  4FKD A;  1CGJ I;  2B0U C;  5DAE A;  2E73 A;  2J87 A;  4UXJ A;  2J9R A;  1PPF I;  2JW6 A;  3UEY A;  2QQD A;  1SGQ I;  2N1A B;  1CGI I;  2QPO A;  2DIP A;  1YU6 C;  3OXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...