3UGIA

Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase c delta
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
GSRRASVGSHRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein kinase C delta type
publication title Structural and Functional Characterization of an Anesthetic Binding Site in the Second Cysteine-Rich Domain of Protein Kinase Cdelta
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal binding protein
total genus 11
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3ugiA01
2J9RA 5FUXA 1TBNA 1KBEA 2ORVA 2ROWA 1XX6A 1W4RA 4UXJA 2UZ3A 2QQEA 1XA6A 2WVJA 5FUYA 3UGLA 2B8TA 1FARA 3CXLA 2DB6A 2YUUA 5FUVA 5FUWA 3UEJA 4L9MA 4B6DA 4UXIA 2GVIA 3UFFA 1TBOA 2ENNA 2J87A 3E2IA 1PTQA 3UGIA 2ELIA 3BJIA 1Y8FA 2ENZA 1RFHA 4UXHA 3UEYA 1KBFA 3KY9A 1FAQA 2QPOA 2QQ0A 1PTRA 1XBTA 2FNFX 2VRWB 2E73A 3UGDA 1R79A 4FKDA 2JA1A 2ORWA
chains in the Genus database with same CATH superfamily
2GIVA 5E3QA 3E59A 1SGQI 4MPIA 2KCXA 4WP4A 1SGPI 1M8CA 1MJAA 2KMRA 3OVOA 1CT4I 1HPTA 1VDDA 2CWFA 1Y1CA 1S20A 2SGFI 2DKVA 1NXUA 1OMTA 3CXLA 5J8CA 1TIHA 2DB6A 4A24A 3FC3A 1MT1A 2N71A 1TBQR 1M8BA 5FUWA 1ULMA 4L9MA 2OD1A 3FSXA 5HQ8A 1CE3A 1R0RI 2K9HA 3UFFA 2LUYA 2X52A 1FYBA 2J87A 2NU3I 1KMAA 2ELIA 3BJIA 1Y8FA 2ENZA 2BUSA 1TOTA 2V1CA 1BUSA 1FAQA 1SGDI 3VDUA 2QQ0A 2NU2I 1CGII 2FNFX 3D00A 1PPFI 1X4SA 4JCVE 5DAEA 3TO9A 4FKDA 1LR9A 5CCLA 2ORWA 1HDLA 3R5CA 1OMUA 3R5AA 3QWPA 2GKVA 1PCEA 3SEKC 1KBFA 1KBEA 1X74A 2ROWA 1W3SA 1K7VA 4OVOA 3PDNA 1Y1BA 1UVFA 1K7TA 2UZ3A 2A20A 3SGQI 1WGCA 1XA6A 3B4VC 1Z2IA 2WVJA 3OXFA 5FUYA 5E3PA 1IW4A 1FARA 4HGUA 3QAHA 2CJSC 2NU1I 3MEKA 2B0UC 5EX0A 5FUVA 1K7UA 2DIPA 3TO6A 2ERWA 1TBRR 4B6DA 2JYYA 2L7XA 1TBOA 3GOXA 1TGSI 2ENNA 2NU0I 2RIJA 1H0ZA 2L8EA 1SGYI 1CT0I 1IY5A 3QTLD 2LEOA 2VRWB 2W0TA 2X3TA 2E73A 3UGDA 5JHWC 2N52A 4AMLA 2UVOA 1DS2I 1YU6C 2M5XA 2V53A 3UGIA 2Y0MA 2KMPA 5FUXA 1WTJA 1N13A 1TBNA 1TURA 4GI3C 2QQDA 7WGAA 1ULKA 2ORVA 3VDPA 1LR7A 1V1HA 1XX6A 1BMOA 4UXJA 3VE5A 2N17A 2SGDI 2QQEA 4SGBI 2N1AB 1V1IA 2WCYA 5EX3A 9WGAA 1OYVI 3SGBI 2KMOA 3OXGA 1NUBA 3TOBA 2JXDA 3UEJA 1CT2I 2CWGA 2SGEI 1CSOI 1Z7KB 4DNCA 1PTQA 2ODDA 3OL0A 4E1PA 1RFHA 3FSYA 5E3RA 2V1CC 3KY9A 3TJQA 3UEYA 1OVOA 2LB7A 2NU4I 2QPOA 1XBTA 2ARPF 2RC4A 3UOEA 1SGRI 2OZUA 1HEVA 2CWHA 2F3CI 1DS3I 2J9RA 3R5DA 2YQPA 1UUCA 1MJ9A 1IY6A 1ULNA 2KMQA 3R5BA 1U5KA 2GKTI 1P9GA 1W4RA 2WGCA 5CCMA 1WGTA 2JW6A 3HH2C 1WKXA 1LR8A 1CHOI 2SGPI 5J8FA 3UGLA 2B8TA 2PQ8A 2YUUA 2P6AC 1MJBA 5HI7A 1SGEI 2OVOA 1YTPA 1FY7A 2E5RA 2OU2A 4UXIA 2GVIA 3TO7A 3E2IA 1PJUA 3OXLA 2GKRI 4E1RA 4UXHA 3RU0A 2SGQI 1SGNI 1CGJI 1AN1I 2QQCA 1Q9BA 2JZMA 1TUSA 1PTRA 1UHAA 1UVGA 1HJAI 3TOAA 1P9ZA 1R79A 2JA1A 2XRCA
chains in the Genus database with same CATH topology
3E59A 1SGQI 2KCXA 1SGPI 1M8CA 2KMRA 3OVOA 1CT4I 1HPTA 1VDDA 1Y1CA 2SGFI 1OMTA 3CXLA 1TIHA 2DB6A 4A24A 3FC3A 1MT1A 2N71A 1TBQR 1M8BA 5FUWA 4L9MA 5HQ8A 2OD1A 1CE3A 1R0RI 2K9HA 3UFFA 2LUYA 1FYBA 2J87A 2NU3I 1KMAA 2ELIA 3BJIA 1Y8FA 2ENZA 2BUSA 1TOTA 2V1CA 1BUSA 1FAQA 1SGDI 3VDUA 2QQ0A 2NU2I 1CGII 2FNFX 3D00A 1PPFI 1X4SA 4JCVE 5DAEA 4FKDA 1LR9A 5CCLA 2ORWA 1OMUA 3QWPA 2GKVA 1PCEA 3SEKC 1KBEA 1X74A 2ROWA 1W3SA 4OVOA 3PDNA 1Y1BA 1UVFA 2UZ3A 2A20A 3SGQI 1XA6A 3B4VC 2WVJA 3OXFA 5FUYA 1IW4A 1FARA 4HGUA 2CJSC 2NU1I 3MEKA 2B0UC 5EX0A 5FUVA 2DIPA 2ERWA 1TBRR 4B6DA 2JYYA 2L7XA 1TBOA 3GOXA 1TGSI 2ENNA 2NU0I 1H0ZA 2L8EA 1SGYI 1CT0I 1IY5A 3QTLD 2LEOA 2VRWB 2W0TA 3UGDA 2E73A 5JHWC 2N52A 1YU6C 1DS2I 2M5XA 2V53A 3UGIA 2KMPA 5FUXA 1N13A 1TBNA 1TURA 4GI3C 2QQDA 2ORVA 3VDPA 1LR7A 1V1HA 1XX6A 1BMOA 4UXJA 3VE5A 2N17A 2SGDI 2QQEA 4SGBI 2N1AB 1V1IA 2WCYA 5EX3A 1OYVI 3SGBI 2KMOA 3OXGA 1NUBA 2JXDA 3UEJA 1CT2I 2SGEI 1CSOI 1Z7KB 1PTQA 2ODDA 3OL0A 4E1PA 1RFHA 3UEYA 1HDLA 2V1CC 3KY9A 3TJQA 1KBFA 1OVOA 2NU4I 2QPOA 1XBTA 2ARPF 1SGRI 2F3CI 1DS3I 2J9RA 2YQPA 1UUCA 1IY6A 2KMQA 1U5KA 2GKTI 1W4RA 5CCMA 2JW6A 3HH2C 1LR8A 1CHOI 2SGPI 3UGLA 2B8TA 2YUUA 2P6AC 5HI7A 1SGEI 2OVOA 1YTPA 2E5RA 4UXIA 2GVIA 3E2IA 1PJUA 3OXLA 2GKRI 4E1RA 4UXHA 3RU0A 2SGQI 1SGNI 1CGJI 1AN1I 2QQCA 2JZMA 1TUSA 1PTRA 1UVGA 1HJAI 1R79A 2JA1A 2XRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J9R A;  5FUX A;  1TBN A;  1KBE A;  2ORV A;  2ROW A;  1XX6 A;  1W4R A;  4UXJ A;  2UZ3 A;  2QQE A;  1XA6 A;  2WVJ A;  5FUY A;  3UGL A;  2B8T A;  1FAR A;  3CXL A;  2DB6 A;  2YUU A;  5FUV A;  5FUW A;  3UEJ A;  4L9M A;  4B6D A;  4UXI A;  2GVI A;  3UFF A;  1TBO A;  2ENN A;  2J87 A;  3E2I A;  1PTQ A;  3UGI A;  2ELI A;  3BJI A;  1Y8F A;  2ENZ A;  1RFH A;  4UXH A;  3UEY A;  1KBF A;  3KY9 A;  1FAQ A;  2QPO A;  2QQ0 A;  1PTR A;  1XBT A;  2FNF X;  2VRW B;  2E73 A;  3UGD A;  1R79 A;  4FKD A;  2JA1 A;  2ORW A; 
#chains in the Genus database with same CATH topology
 2GIV A;  5E3Q A;  3E59 A;  1SGQ I;  4MPI A;  2KCX A;  4WP4 A;  1SGP I;  1M8C A;  1MJA A;  2KMR A;  3OVO A;  1CT4 I;  1HPT A;  1VDD A;  2CWF A;  1Y1C A;  1S20 A;  2SGF I;  2DKV A;  1NXU A;  1OMT A;  3CXL A;  5J8C A;  1TIH A;  2DB6 A;  4A24 A;  3FC3 A;  1MT1 A;  2N71 A;  1TBQ R;  1M8B A;  5FUW A;  1ULM A;  4L9M A;  2OD1 A;  3FSX A;  5HQ8 A;  1CE3 A;  1R0R I;  2K9H A;  3UFF A;  2LUY A;  2X52 A;  1FYB A;  2J87 A;  2NU3 I;  1KMA A;  2ELI A;  3BJI A;  1Y8F A;  2ENZ A;  2BUS A;  1TOT A;  2V1C A;  1BUS A;  1FAQ A;  1SGD I;  3VDU A;  2QQ0 A;  2NU2 I;  1CGI I;  2FNF X;  3D00 A;  1PPF I;  1X4S A;  4JCV E;  5DAE A;  3TO9 A;  4FKD A;  1LR9 A;  5CCL A;  2ORW A;  1HDL A;  3R5C A;  1OMU A;  3R5A A;  3QWP A;  2GKV A;  1PCE A;  3SEK C;  1KBF A;  1KBE A;  1X74 A;  2ROW A;  1W3S A;  1K7V A;  4OVO A;  3PDN A;  1Y1B A;  1UVF A;  1K7T A;  2UZ3 A;  2A20 A;  3SGQ I;  1WGC A;  1XA6 A;  3B4V C;  1Z2I A;  2WVJ A;  3OXF A;  5FUY A;  5E3P A;  1IW4 A;  1FAR A;  4HGU A;  3QAH A;  2CJS C;  2NU1 I;  3MEK A;  2B0U C;  5EX0 A;  5FUV A;  1K7U A;  2DIP A;  3TO6 A;  2ERW A;  1TBR R;  4B6D A;  2JYY A;  2L7X A;  1TBO A;  3GOX A;  1TGS I;  2ENN A;  2NU0 I;  2RIJ A;  1H0Z A;  2L8E A;  1SGY I;  1CT0 I;  1IY5 A;  3QTL D;  2LEO A;  2VRW B;  2W0T A;  2X3T A;  2E73 A;  3UGD A;  5JHW C;  2N52 A;  4AML A;  2UVO A;  1DS2 I;  1YU6 C;  2M5X A;  2V53 A;  3UGI A;  2Y0M A;  2KMP A;  5FUX A;  1WTJ A;  1N13 A;  1TBN A;  1TUR A;  4GI3 C;  2QQD A;  7WGA A;  1ULK A;  2ORV A;  3VDP A;  1LR7 A;  1V1H A;  1XX6 A;  1BMO A;  4UXJ A;  3VE5 A;  2N17 A;  2SGD I;  2QQE A;  4SGB I;  2N1A B;  1V1I A;  2WCY A;  5EX3 A;  9WGA A;  1OYV I;  3SGB I;  2KMO A;  3OXG A;  1NUB A;  3TOB A;  2JXD A;  3UEJ A;  1CT2 I;  2CWG A;  2SGE I;  1CSO I;  1Z7K B;  4DNC A;  1PTQ A;  2ODD A;  3OL0 A;  4E1P A;  1RFH A;  3FSY A;  5E3R A;  2V1C C;  3KY9 A;  3TJQ A;  3UEY A;  1OVO A;  2LB7 A;  2NU4 I;  2QPO A;  1XBT A;  2ARP F;  2RC4 A;  3UOE A;  1SGR I;  2OZU A;  1HEV A;  2CWH A;  2F3C I;  1DS3 I;  2J9R A;  3R5D A;  2YQP A;  1UUC A;  1MJ9 A;  1IY6 A;  1ULN A;  2KMQ A;  3R5B A;  1U5K A;  2GKT I;  1P9G A;  1W4R A;  2WGC A;  5CCM A;  1WGT A;  2JW6 A;  3HH2 C;  1WKX A;  1LR8 A;  1CHO I;  2SGP I;  5J8F A;  3UGL A;  2B8T A;  2PQ8 A;  2YUU A;  2P6A C;  1MJB A;  5HI7 A;  1SGE I;  2OVO A;  1YTP A;  1FY7 A;  2E5R A;  2OU2 A;  4UXI A;  2GVI A;  3TO7 A;  3E2I A;  1PJU A;  3OXL A;  2GKR I;  4E1R A;  4UXH A;  3RU0 A;  2SGQ I;  1SGN I;  1CGJ I;  1AN1 I;  2QQC A;  1Q9B A;  2JZM A;  1TUS A;  1PTR A;  1UHA A;  1UVG A;  1HJA I;  3TOA A;  1P9Z A;  1R79 A;  2JA1 A;  2XRC A; 
#chains in the Genus database with same CATH homology
 3E59 A;  1SGQ I;  2KCX A;  1SGP I;  1M8C A;  2KMR A;  3OVO A;  1CT4 I;  1HPT A;  1VDD A;  1Y1C A;  2SGF I;  1OMT A;  3CXL A;  1TIH A;  2DB6 A;  4A24 A;  3FC3 A;  1MT1 A;  2N71 A;  1TBQ R;  1M8B A;  5FUW A;  4L9M A;  5HQ8 A;  2OD1 A;  1CE3 A;  1R0R I;  2K9H A;  3UFF A;  2LUY A;  1FYB A;  2J87 A;  2NU3 I;  1KMA A;  2ELI A;  3BJI A;  1Y8F A;  2ENZ A;  2BUS A;  1TOT A;  2V1C A;  1BUS A;  1FAQ A;  1SGD I;  3VDU A;  2QQ0 A;  2NU2 I;  1CGI I;  2FNF X;  3D00 A;  1PPF I;  1X4S A;  4JCV E;  5DAE A;  4FKD A;  1LR9 A;  5CCL A;  2ORW A;  1OMU A;  3QWP A;  2GKV A;  1PCE A;  3SEK C;  1KBE A;  1X74 A;  2ROW A;  1W3S A;  4OVO A;  3PDN A;  1Y1B A;  1UVF A;  2UZ3 A;  2A20 A;  3SGQ I;  1XA6 A;  3B4V C;  2WVJ A;  3OXF A;  5FUY A;  1IW4 A;  1FAR A;  4HGU A;  2CJS C;  2NU1 I;  3MEK A;  2B0U C;  5EX0 A;  5FUV A;  2DIP A;  2ERW A;  1TBR R;  4B6D A;  2JYY A;  2L7X A;  1TBO A;  3GOX A;  1TGS I;  2ENN A;  2NU0 I;  1H0Z A;  2L8E A;  1SGY I;  1CT0 I;  1IY5 A;  3QTL D;  2LEO A;  2VRW B;  2W0T A;  3UGD A;  2E73 A;  5JHW C;  2N52 A;  1YU6 C;  1DS2 I;  2M5X A;  2V53 A;  3UGI A;  2KMP A;  5FUX A;  1N13 A;  1TBN A;  1TUR A;  4GI3 C;  2QQD A;  2ORV A;  3VDP A;  1LR7 A;  1V1H A;  1XX6 A;  1BMO A;  4UXJ A;  3VE5 A;  2N17 A;  2SGD I;  2QQE A;  4SGB I;  2N1A B;  1V1I A;  2WCY A;  5EX3 A;  1OYV I;  3SGB I;  2KMO A;  3OXG A;  1NUB A;  2JXD A;  3UEJ A;  1CT2 I;  2SGE I;  1CSO I;  1Z7K B;  1PTQ A;  2ODD A;  3OL0 A;  4E1P A;  1RFH A;  3UEY A;  1HDL A;  2V1C C;  3KY9 A;  3TJQ A;  1KBF A;  1OVO A;  2NU4 I;  2QPO A;  1XBT A;  2ARP F;  1SGR I;  2F3C I;  1DS3 I;  2J9R A;  2YQP A;  1UUC A;  1IY6 A;  2KMQ A;  1U5K A;  2GKT I;  1W4R A;  5CCM A;  2JW6 A;  3HH2 C;  1LR8 A;  1CHO I;  2SGP I;  3UGL A;  2B8T A;  2YUU A;  2P6A C;  5HI7 A;  1SGE I;  2OVO A;  1YTP A;  2E5R A;  4UXI A;  2GVI A;  3E2I A;  1PJU A;  3OXL A;  2GKR I;  4E1R A;  4UXH A;  3RU0 A;  2SGQ I;  1SGN I;  1CGJ I;  1AN1 I;  2QQC A;  2JZM A;  1TUS A;  1PTR A;  1UVG A;  1HJA I;  1R79 A;  2JA1 A;  2XRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...