5FUVA

Catalytic domain of thymidine kinase from trypanosoma brucei with dthd
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
181
structure length
173
Chain Sequence
HGRIELIIGPMFAGKTTELMRRVQRHKHAQRSCYIIKYTGDTRHDQRALTANVSVSNLHDVGDEWRKYDVIAVDEGQFFPDVAAFCSKAADSGKVVIVSALDADYLQEPFEEICLLVSRADSVVKLSAVCMECHNRKASFTYRTVKSDERKLVGGSDMYMSVCRSCYETKRNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords THYMDINE KINASE
publication title Cell Cycle Regulation and Novel Structural Features of Thymidine Kinase, an Essential Enzyme in Trypanosoma Brucei.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 55
structure length 173
sequence length 181
chains with identical sequence B
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2016-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 5fuvA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fuvA01
5AR1A 3I72A 3W34A 3THWA 2JEOA 3RAPR 1ZNZA 2FV8A 4I81A 2FSFA 1NBMD 3MMPA 1XU4A 4G5RA 3UMFA 5HKKA 1X8LA 2DY1A 4NCHA 2VF8A 3I4LA 1DTSA 3MJHA 3SJBA 4YDHB 4DDTA 4C0KA 5IK2D 3NHBA 1M6NA 4A92A 4QFMA 1C9KA 4DDUA 4Q7LA 4BLSA 3E2IA 1VG8A 2OFWA 2ZAOA 3AF1A 2AFIE 3DO6A 1O87A 3ASZA 3RYTC 4YMSA 3AM1A 2JLRA 2Q21A 3FMIA 2CMKA 3GJXC 5IK2A 3OEHD 3SEAA 2O8FA 1QHNA 3REGA 2Q6TA 1NJFA 3EPLA 5HTKA 5AK0A 2ZU6A 1CP2A 2GHIA 2QZ4A 3CR8A 5D3QA 5FPYA 3TR5A 4MA4A 2JLZA 5KYKA 1E9RA 2GESA 2PJZA 1OXXK 5FUYA 3EWAA 4N0EA 3R9IA 3FPAA 3OEHA 3UGDA 1ZNXA 3A6PC 2PBRA 2ZRHA 4ACAA 4A15A 2F7SA 1OIWA 3UG7A 1FW6A 1N6IA 1XEWX 3HU2A 3CR7A 3NKVA 1Z6GA 4HLUA 1XA6A 1JQJC 4GT1A 1GWNA 2PEYA 2OM2A 3B78A 1E1QD 4C4PA 2JDIA 4M9ZA 2QP3A 4A36A 5GVSA 4DBLC 2QBYA 3BFKA 4UXJA 3HP1A 2YNMA 2DPXA 1KK0A 1VYUA 3B13B 4TWZA 1E0AA 5BN5A 1E1QA 2ATXA 2CHVA 4Y0VA 1W1WA 2GXUA 3OE7D 4IDNA 4BEJA 1N0WA 1P62B 2A78A 2VA8A 4L9MA 2CBZA 5GVRA 1Q20A 3ZVNA 5SZIA 4U5XA 2CEAA 3A1UA 4NL4H 4YMWA 1OLOA 3FKQA 3OE7A 3AF3A 3GFOA 1G7RA 4MITA 1X1RA 1A1VA 2ZJ8A 4K46A 4QJ4A 2KWIA 2QTFA 1QHSA 2WJJA 2GJAA 3OESA 4WIAA 1Z2AA 1CEEA 1IY2A 1IJFA 4LHXA 4DT1B 1G17A 2ANCA 2OE2A 4Q9KA 1LW7A 1MABB 3EZ2A 4Q1EA 3HPQA 2J9RA 5JEEA 4IDOA 4LJ5A 1S3SA 1SXJC 4HZUB 4P0TA 3VFDA 1Z28A 5KSPA 1XF9A 2RGXA 1OF1A 3NEJA 3QG5A 4R71A 3IDQA 2P65A 1ZNYA 2ZRGA 3QXSA 5L3SA 3L0IB 2ZROA 2JLUA 4ZI3A 4DUGD 3JZAA 4UQOA 2QP4A 1R8SA 2FNAA 2R6DA 1FMJA 3B1WA 1NN1A 3K9NA 3RS4A 5HZKA 4H1VA 2F3RA 2L0XA 4B71A 3BS4A 2KI5A 3UGIA 1UBCA 1YZNA 1R5NA 3TE6A 4Q9LA 2H17A 3IBGA 3LBNA 5CM9C 5EQTA 1G41A 3QKRB 1GSIA 2V6IA 1VPLA 4IHQA 4ZIRA 2ZR7A 2OV2A 4AWXA 1Y8FA 3AUYA 2VHJA 3LY5A 1E2MA 2XX3A 3NBYC 5J4LA 1XD2B 2VP4A 3B2EA 3K9HA 5JRZA 2A3RA 1OT3A 4DIDA 2ZI6A 2GXAA 2NO7A 3T61A 3VR3A 3GJ0A 2DFNA 5EXPA 2UVQA 4FCTA 5FBQB 3RS3A 2IEYA 1E69A 1UAAA 5CDFA 1E1RD 1F48A 1U8ZA 2BEJA 2KBFA 3B1XA 4HB4A 4JLVA 2ODWA 4HAWA 2GZAA 3PUWA 1IAQA 4IOKA 5CM8B 3GLGE 1HT1E 3RS2A 5G41A 2IWRA 2BJWA 4IVQA 5IDVA 3FOZA 2F1JA 3ZZ0A 2Z5FA 1E1RA 4JZKA 5JEDA 3W6OA 5EE5B 4G3XA 1XCPA 4JLAA 1JEEA 3QEOA 3SU8A 2JJ1D 3SDZA 4JVNA 3GD7A 2OXRA 3PXGA 2BBOA 5DO9A 4B74A 4LUCA 1RC8A 2CLCX 1ELOA 2IYQA 2GZDA 3ADCA 2XB4A 1SKYE 2PZGA 3TUZC 2C99A 2JJ1A 3PITA 4DLYA 1OFIA 1XTIA 1Q44A 2YYZA 1CRQA 4BFXA 4TLBA 4ZDKA 3NBXX 2HJGA 3C16C 2XAUA 3UANA 5K8UA 1KTVA 1A2BA 4GP7A 2HXYA 2ZRFA 1KO8A 1N6OA 4Q21A 1E9EA 4AC9A 3KJGA 4Z54A 4EJSB 4LHZA 2WPDD 1XDBA 2PCJA 1N3BA 2JJ2D 4Q9IA 5DSZA 5J40A 3BWDD 2WAXA 5CB8A 5KDLA 3TLXA 5EP2A 2GJKA 3T5DA 1G21E 3R20A 1UBFA 1RRFA 1E0KA 3LLUA 1OE0A 4KU4A 1J8MF 3SYLA 2WPDA 2X2EA 3P26A 3D7MA 4AD8A 1E96A 2JJ2A 2OCYC 4HB2A 3KFXA 1TEVA 4DLUA 4B3GA 4D82A 1YE8A 4WVFA 1NIPA 2ZE8A 1AS0A 3HYTA 3MSXA 4NCNA 1I4LD 2VO1A 2C04A 2YOGA 1TPZA 2IYVA 4WW0A 1P72A 3QUSA 4JYBA 4IW3B 1ZUHA 4M9XA 2PLFA 5LB4A 4QNMA 1A2KC 3FMOB 1DBSA 4LWZA 1TQDA 3DKPA 1CJTC 3K0AB 5ELXA 1JJVA 3QF7A 1KBEA 3GJ8A 2IW3A 4M22A 2QT0A 2ASEA 2XJ9A 3PUVA 4WXPA 2A7QA 2PZFA 1JQLB 4FINA 3R7WA 4TN1A 4RJLA 5CIQA 4IDHA 1UPTA 2OG2A 2VP6A 4OK3A 3CWQA 1Z0KA 4UNPA 1DADA 4C3ZA 1E2HA 4PPNA 2AD5A 3KKPA 4FI3C 3WYGA 5JWHA 1ZRHA 1SHKA 3KFVA 3IPXA 3CRMA 3CX6A 3VKWA 1CS4C 1ZINA 2Q9BA 1W5SA 4TLDA 2FOLA 2J46A 1FQKA 2W6ID 1COWD 4P4SA 5KSOA 1NRJB 1KI6A 1LS1A 1YR9A 2QN6A 4TSFD 4KHZA 4DLRA 5JWRA 2ZRKA 4BLRA 1KSHA 4AI6A 2NZ8A 5H68A 2O8FB 4PXAA 4PAOA 1NJGA 4KLZA 4OBEA 1HA3A 5BW8A 1Z0FA 2AXNA 2W6IA 2WAYA 1COWA 1JR3A 2UZIR 1OPXA 1ESNA 1GKUB 4TSFA 1E2FA 3SHFA 2DWPA 2ZRCA 3WYFA 2Z83A 5JHGB 1MOZA 4O25A 4C0BA 3QG1A 2WWIA 2WIAA 5GJVC 2FEOA 4GOJA 1OH7A 2YUUA 4B3DA 3B82A 2C8VA 1Z06A 2PT5A 2GBLA 1R7RA 2BVNA 3CRW1 3GEHA 4WZ6A 4PFSA 4A0GA 5HR5A 2IK8A 4C9BA 3RRMA 4MRSA 4ZCMA 5F9HA 2IXFA 3PCRB 1G3MA 3ASYA 3D31A 1V43A 5DH9A 2NO1A 2EU8A 1KNXA 1KZ7B 2GRJA 2IL1A 2GZHA 3W5IA 3BXZA 4LHYA 3LFUA 3HPRA 4FMDF 1ZD8A 3H86A 3TW8B 1RZ3A 4P32A 2AKAB 1IOZA 3A1WA 1UEIA 3E5HA 4XTCS 1ZAKA 3VU9B 3WHLA 1M7BA 4WAUA 5CJPA 3T06B 2O8DA 2JAQA 3I8SA 4OI0A 3FFAA 4MKHA 2J0SA 3KXIA 4LK2A 3AKYA 1QZXA 4V0OA 4Q7MB 1M2OB 3PUZA 2P6NA 1XWIA 3K70B 1PV4A 1CIPA 1CR4A 5TV2A 3VR6A 3ICQB 4LJ4A 4OK5A 3AVUA 3LAWA 4WA7A 4DXAA 4L15A 2CDNA 2WV9A 5AJVB 2ENZA 2VRWB 2ZRLA 3U4QA 3BD9A 4ZCLA 4M1OA 2AK3A 3EA5A 3GLHA 1HURA 4R7ZA 1TADA 5CLLA 2NO9A 4Z8YA 4PHFA 2XITA 1NSTA 2GAOA 2GNOA 3LVQE 3RANA 2PLRA 1FARA 2GVIA 2IS4A 2JLVA 1KOFA 1OSNA 3IIKA 4YXWD 3TIFA 4BPBA 4D6PA 3ZD6A 1DAHA 4OYHA 1JAHA 1FZQA 3X1DA 2QAGA 1DAIA 3D3QA 4HI0E 5FOUA 2H16A 2OFOA 4M9SA 3TUIC 2Q3FA 2RHDA 2IYLD 1NVUQ 3GMTA 4ZIRB 3FE2A 2BMJA 1RVDA 1OB2A 3K09A 3BBPA 3KXLA 4OQFA 3SC3A 3EIHA 1UKVY 3BK7A 3CX8A 5DYGA 2O8BB 3PENA 5DGXA 3CZQA 4GOKA 1G7TA 5M04A 3I62A 2GCOA 1JBKA 2WM9B 3PEVA 4QHYA 5FPTA 2CCGA 2P5SA 1G3IA 2EYQA 1BYIA 3BAFA 3CM0A 3OIUA 4DSUA 2IYUA 3ZYCA 3VKGA 3ZIAD 2Q9CA 2W0MA 4OJKA 3Q5DA 1G16A 2FE4A 4EAQA 4J0QA 3AQ4A 3QVUA 4GMDA 4A0RA 1U9IC 2C95A 1UFQA 2ORVA 4RD4A 5HE9A 1W48A 3ZIAA 1IBRA 221PA 2QRZA 1N25A 1ZUNB 1KO7A 1AN0A 1ONBA 2FG5A 5IF9A 2H57A 3CUEF 1OB5A 3PUXA 2AL7A 2WTUA 1G3RA 3WMEA 2C96A 2GEDA 1AZTA 2GXSA 4PC1A 1G9XA 3UXMA 1U0HC 2D4HA 2QGNA 1H65A 3MG9A 4EQ6B 5BWMA 2YWFA 3CPEA 1NG9A 4DLSA 1GRNA 1RW4A 3C4JA 4IOLA 3PVSA 3AH8A 1BIFA 1U0JA 4LC0A 2EWWA 2OCAA 2ZETA 1EESA 2D3WA 4GDFA 1PZNA 3FFBA 5AJZA 1KYIA 1SZPA 2FJUA 1EGAA 1MT0A 3BFVA 1Z0DA 3F3YA 4S2EA 1RPZA 1I2DA 3TR0A 2E87A 4TLCA 4DSTA 1OYWA 1BMFD 1KY3A 3DZ8A 1Z6YA 5F2EA 4KJZA 3QXXA 1ZM7A 2WKQA 3PQCA 3AVOA 4DLZA 1NN5A 4NYMR 3CO5A 1TF5A 1KSJA 2MSCB 1J90A 1CR1A 4XH9B 1W44A 5FPSA 1BMFA 3LBIA 4EPRA 2VP5A 6Q21A 1MV5A 2A5GA 1US8B 4OQLA 4A2WA 2N42A 3EAQA 1W36C 5FOTA 2ZREA 4GZLA 3AP2A 1KAGA 1EFRD 5FI0B 2G1JA 4LJ8A 4TYYA 1XPRA 2ATVA 1VYTA 2QI9C 1IXSB 4CIDA 4KO8A 1G20E 2G1KA 3SR0A 3B1VA 2CVFA 3ZS9A 3THYB 4TZ6A 1W2GA 3DEFA 1YHNA 1NLZA 3WRYC 5F9FA 1EFRA 1TUIA 4HB0A 4JSTA 3GCGA 2QPOA 1OV4A 1H8HD 3GJ5A 2I1VB 4YXWA 3WY9A 2ZRAA 4NYIR 3H1TA 4BWYA 3H2YA 4DCUA 2R6CA 5EXXA 5BQ5A 2CL6X 3HR7A 2BJVA 3WNCA 1E79D 4ZI2A 1XEFA 4DT1A 4PX9A 4A2PA 4US2R 1H8HA 2BV3A 5CLQA 5AUPB 4U7DA 5FL7A 4Q7JB 4F38A 3QIAA 3EPKA 3RS5A 4TMXA 2RGNA 4U02A 2ZS8A 4UNSA 4B75A 2FH5B 4WXRA 1XRJA 1TF7A 1E4YA 2G9NA 2XSZD 1Z3IX 1DE0A 4D80A 5F98A 3EIQA 5G53C 1D6JA 3KDSE 3QE0A 3SE0A 3W3ZB 1M7GA 3QNUA 4KFSA 2ZSDA 3CPJB 1XEXA 4EIWA 3C8UA 3LWNA 1QG2A 1DAKA 2XSZA 5FL3A 4M53A 2JLSA 5TARA 1KJZA 1X8KA 1HQCA 2WMOB 4LDJA 3QKRA 4YC7A 4Z8XA 4AY2A 5CIWA 1IN7A 2ZR9A 3L82B 3GJ4A 2IYYA 3WP0A 1N2CE 4V0ME 1XD2A 1NY6A 1UKYA 1PLJA 1CTQA 1E9DA 3EPHA 3RSOA 2I3BA 5FFMA 1J8YF 2JIZD 2PX3A 4X8MA 1P9RA 1S3GA 4LCBA 1BH2A 4RCYA 3TW4A 4GSYA 4BLPA 2IXEA 3CBQA 1HQYE 2FSHA 4DEXA 2ZVQX 4F7WA 4MGKR 2FF7A 1QHYA 2QGZA 3DHWC 4QGAA 2A5JA 1VCNA 2JIZA 4EPTA 3PEWA 1KK2A 3KY9A 4UXIA 3PFIA 3TQFA 4PPGA 3GLIA 4KVAA 3LQRA 2Q0HA 5AJXA 4DB2A 1S2MA 1F5NA 1VKJA 4Q4AA 1FUUA 2E73A 1KO5A 3DPUA 3P20A 5JWOA 2IHYA 1KI1A 3K9GA 1ANKA 4CT4B 1W49A 4GL2A 3THXB 4LYJA 1RYFA 1E32A 5E7MA 4B3CA 1AIPA 3LO5A 1VECA 1LVGA 4UNQA 3X1XA 3VAAA 4OQNA 5GADl 2DB6A 1Y63A 1Z22A 3Q85A 2K5UA 4OHXA 4ZO4A 4B3BA 1GUAA 1GVNB 4LV6A 4XVUA 3TH5A 5EZ5A 4Q1CA 1XBTA 3K0CA 4A8JC 4YONB 5EP3A 1CRPA 3AVVA 2CHQA 2MSEB 2C5LA 5EXTA 4ZV4A 1TBOA 2IF0A 1FMLA 4NHOA 3GFTA 3U44B 2RGBA 3T35A 3I73A 1GDDA 4EUNA 4EJSA 1KI3A 1YQTA 2G77B 4OK6A 3WRXC 2JGNA 4JKYA 2BIFA 4R2HA 2HYIC 3PUYA 4OI4A 1XXHE 1W4AA 2W0SA 2IC5A 3KKOA 3MCAA 4UNNA 1JJ7A 3QY0A 2XTNA 4BZXA 2Z6VA 4URWR 1D2NA 5JRJA 3BH6A 3CKLA 1Z5ZA 4GFDA 2O52A 1G6HA 3L8ZA 1ZUIA 4DLTA 2GTPA 2FNFX 1NIJA 3KQHA 1CR0A 2XGJA 2O0HA 1UJ2A 2N1BA 1KI9A 5JBQA 1OH8A 1JXOA 2EFEB 1CLUA 4HLDA 1GKYA 3CF0A 2ECKA 4NYJQ 5KUTA 2V1UA 4LY6A 3QBVA 1SHZA 1AQUA 1U98A 3D8BA 4PSVA 3LRPA 4CVNA 1HTWA 4LHWA 2OFXA 5LD2C 4MRRA 1O3YA 3K9LA 3Q5EA 2KJQA 1EWRA 4QOSA 3RNLA 4QJ3A 4D81A 4X8HA 2B8TA 1N6NA 2ZM5A 5CK4A 4KODA 1S9DA 4DZZA 1MRNA 1IM2A 2J5XA 3UG6A 4A2QA 3SJCA 3BFXA 2O8CB 5C2JB 4N0DA 4PANA 5EZ6B 2J7PD 4D4LA 1Z07A 3EASA 3A4LA 2OZEA 4DSOA 3W3AA 3NTUA 1WBDA 3C7KA 1JALA 4PC2A 4HZIA 1NBMA 4FW9A 4LC1A 1DAMA 4IDPA 4MGZR 2F6RA 1ZU4A 3V9PA 3I5YA 3EPJA 2BMFA 3BB3A 4ON9A 2WHXA 5E4FA 3EZ7A 4HDOB 4B6EA 3T5GA 2J7PA 3CX7A 1FFHA 1KK3A 1Z0AA 2ZEJA 3SHWA 4DC9A 5H8WA 2D06A 3CPHA 2ZQ5A 1E99A 2Z4SA 1IN8A 1S8FA 1ZM4A 1G3UA 2EFDB 2PH1A 1WB9A 5UKDA 1FTSA 5KU1A 4CW7A 1DARA 2F43B 5FBWB 1TU3A 2J45A 5JCZA 2LKCA 4HB3A 2WOJA 1OXTA 2QEQA 2QY9A 3QKSB 1S9HA 4KFTA 1DELA 1Q1BA 3QSYA 4BECA 4PQRA 1G7CA 1KKMA 5KHOC 2WJYA 2A30A 5EE9A 2RKOA 3TAHA 2ZRJA 1KJYA 4RD0A 1XEWY 5J47A 1PUJA 1QG4A 2A9KA 3RWMB 4A0HA 1XPUA 2P2LA 2VQSA 2QSZA 5SZHB 5JI2E 4AYWA 1XPOA 5LPNA 2BBSA 2G3YA 4Q00A 2VP0A 3CNLA 5KDOA 1PTQA 2EFHB 2WOOA 2XOKD 4M1WA 2ZS9A 3K70D 3IHLA 1XJQA 3VU9A 1NNEA 3TRFA 1G8YA 4QM6A 3KQUA 1G8PA 2GXQA 4Q9JA 4PTLA 3LW7A 4OHZA 1U90A 2ZJ2A 4FMCB 4F92B 2P67A 2D7DA 2REOA 4MDFA 2IS6A 2A2ZA 4URVR 5EUMA 3H84A 1T8TA 5FOXA 5L3QB 4US1R 4X8OA 1GNRA 3IKJA 2QA5A 4HAUA 3VKHA 4G01B 4G5QA 1SVLA 2VRWA 4L9WA 4O3MA 4HAXA 2P5TB 4ESHA 1FNMA 2IHBA 2HF9A 5H1YA 4PR0A 1GNQA 4XOIA 4B73A 2H7VA 2OILA 4AKEA 3AV0B 3RVBA 3T1OA 2O0KA 1XEXB 1E94E 4QKQA 1MO5A 4PO8A 4GBMA 1OIVA 4B34A 2ZYTX 3NH6A 1ZP6A 4L8GA 4Q19A 1DAEA 4XSGA 5TVKA 2QU8A 1TTTA 5HE8A 4DUGA 2VH5R 4KAXA 5L3VA 2ZRNA 5JS7A 1BYUA 2GF9A 1OYYA 1YZLA 1QHHB 3NC0C 2CHGA 2H1LA 3AVWA 2O8BA 4RZ2A 1OXSC 3CLVA 1KGDA 1M8PA 4PHGA 3AKDA 4TTQA 4IEEA 2OBMA 1IXZA 2FN4A 3QKUA 4PHHA 1KMHB 4M1SA 5CJ2A 4XVRA 4JLMA 3ADKA 3K0SA 1G8FA 1BS1A 2QROA 5AJYA 4URXR 1WA5A 2C9CA 5CK5A 4B2PA 5KNBA 2FSIA 2YWHA 3GLIB 2A5DA 5K8LA 1ZC4A 4Q18A 4Q4AB 1P3JA 2AD1A 4V0KA 3THOA 3CXLA 2C03A 2AXPA 1R8QA 2B8WA 4QL3A 1KSGA 4BZPA 5AWFC 3R9XA 3BGWA 2MMGA 4C7OB 3IPYA 4D25A 1NKTA 4QG7A 5CB6A 3ZD7A 1OKKD 4TTPA 3NEYA 5DHAA 3A4NA 1U99A 2KSQA 5G3YA 4PO1A 5CDFE 4KSCA 4IRUB 2IYWA 4JYCA 4P4TA 4LBWA 2GILA 4AK9A 4EQ6A 1N5IA 2VTKA 4HDQB 1XTSA 5LBIA 1OKKA 1P9WA 1P9NA 4F4JA 2DWOA 4PSAA 5EP4A 2OAQ1 5E95A 3I61A 2X77A 2IXGA 1SVMA 1AJEA 3RRNA 3WP1B 2ZRDA 5L8VA 4PPQA 1EFCA 4GP6A 1TX4B 1GNPA 3BH0A 4MKFA 4IKEA 2HXSA 2OLJA 4WBSA 2V4ZA 2YOHA 3QXCA 3GLFB 1N5LA 4DIEA 5B30A 3CRVA 2IUUA 3W90A 3KKMA 3Q8XB 4LPSA 1KJWA 3OEED 3DM5A 3EC1A 1WQ1R 3IQWA 4TQAA 1E2EA 4JBYA 4D4JA 4LBYA 1GKIA 3NC1C 2I4IA 4BLQA 3FHCB 2H8KA 1T3HA 2JASA 2YHSA 3GJ6A 2RHMA 3ZZUA 2WWYA 3GJ7A 3OEEA 1AK2A 1US8A 2FX3A 4EKDA 3MWKA 4I99A 3EX7C 4B32A 5FOSA 2D2FA 1E2GA 1MO6A 1TEXA 4UKDA 3EW9A 3TSZA 1GL9B 3U3OA 4Q01A 3WMFA 3R9WA 4AG5A 1J70A 2G0TA 1G291 2C2HA 4K8OA 2E1RA 3U6KA 1RE0A 3THYA 3MLEA 3SFVA 1B0UA 4KYIB 1K6MA 2VPPA 3AUXA 1DG1G 4B2IA 4RD2A 1G5RA 4EPXA 4PO9A 1IJEA 4QM7A 3T15A 2ZTSA 3VNVA 2VL7A 3QOFA 1YRBA 1ZU5A 1C1YA 1D5CA 1ZJ6A 2HV8A 2ZRPA 4JVLA 3T1QA 3UEJA 5CYOA 1FQJA 1T8UA 4W5HA 1GG2A 2QRNA 3GQBA 2ZSFA 4Q66C 3AP1A 3CF6R 4WZBE 4BLTA 3VHXA 2IWHA 1IXRC 2QE7D 2DCUA 2YZ2A 1ZVQA 2G0NA 5B57C 1KO4A 4CEHB 1HE8B 1KDTA 5K8IA 5GJWC 2ZJAA 1OW3B 1UM8A 1R0XA 1KNQA 2Y8EA 1TQ2A 1T6NA 2F1RA 1L8QA 3UMSA 4HAZA 2QE7A 3ZVLA 4C2UA 1ZMXA 3QF4B 1N5KA 2J87A 3WBJA 3QPWA 4Q5IA 2OT3B 5FTJA 4FWIB 2J0VA 3EARA 1N0VC 1ZIPA 3QPVA 1XZQA 4MYUA 4JLPA 1HV8A 2HJVA 4C0AC 1P61B 3P27A 2DB3A 3AVTA 3AVXA 4TMZA 4JL5A 2H92A 3IILA 2O5VA 2DFKB 1X86B 4QRHA 2OESA 2ZRIA 1Q1ZA 4BFWA 4BE7B 5EJEA 2GJSA 2QM7A 1EFHA 4GI7A 1SXJD 1U8YA 3VR5A 2ZS7A 4MUBA 1JR3E 3VNUA 2ZE5A 3LQQA 3V4FA 3CIOA 1EG7A 4AIIA 4XWKA 4LJYA 3VR2A 1XCMA 4V0LA 4NDZA 3FTQA 5D3MA 1SXJA 3TMKA 4K81B 5FBLB 3RRZA 4CT5A 3DMNA 1LNZA 1DO2A 1GM5A 2BWJA 4BFSA 5KPDA 4EPVA 1M7HA 2VIIA 4PQYA 4TYPA 1XTRA 4QC2A 4Z1MD 5BYKA 4LYAA 4W9MC 3Q72A 4IOMA 3OZXA 3BIFA 2CLDX 4OJQA 3SFZA 4E22A 3CH5A 2VLIA 1VG9B 3HU1A 1CJUC 3THXA 2BMEA 4IXNA 4W5JA 1X8JA 4W7SA 5KDDA 1R4AA 1NL3A 5HCNA 5TB5A 2A5FA 5C18A 1HE1C 1MH1A 4LSGA 1G4UR 1NMYA 3P4XA 4LZZA 3ZDQA 4PZLA 1V5WA 3N2IA 5H70A 1P2UA 3ND8A 1FUKA 2IYZA 4US0R 2R6AA 1RFHA 5C4MA 1SVKA 3IUYA 1KY2A 3VX3A 4RZUA 1W0JD 2JLQA 2QPAA 4FCVA 2YC2C 1IHUA 2YINC 4TLEA 1VHTA 2HLDD 4NTZA 3U44A 4TMKA 2QENA 3BJIC 1KI8A 3ONWA 4N1AA 4KFUA 2VEDA 1P2VA 1W0JA 5E3HA 3K8YA 2BEKA 3P32A 3W6NA 5DN6D 3AGQA 1KKLA 2B92A 4DCSA 2HLDA 4QJ5A 4BZQA 1G6OA 1WP9A 4OQMA 1GZSA 1T0JB 2RB4A 4MH0R 3AVPA 1GFIA 3GLHE 4B76A 3Q7PA 4GMXA 4P3YA 1GRQA 5FBRB 1Z08A 5DN6A 4JMPA 4AYTA 5FTLA 5JCPA 1TF2A 4MKGA 4ACBA 4QHTA 1HT2E 5GJBA 1OH6A 2QORA 1W47A 4JLNA 3O8RA 1E2PA 3GLGB 1OJLA 2R44A 3B1YA 2ZRBA 1OXVA 3VTKA 3KKNA 2QNRA 4OKSA 4A8JB 5KOYA 1II0A 2F1HA 2VHUA 1WMSA 1IN5A 4CDGA 1N5JA 4NMMA 1OXUA 1VIAA 4E07A 1R0ZA 1NKSA 1WXQA 2A5YB 2P3SA 3TGPA 2ZPTX 1E2LA 2WWGA 4M4SA 4LJ9A 5J4YA 1FL9A 1SKYB 4NKRA 3G5UA 4TMTA 4P31A 5BN3A 3GPLA 2O8CA 5SZKB 1G8HA 2QPTA 4C0QC 1P60A 3F8TA 1W2HA 421PA 3CF2A 4JLDA 1QVRA 4ZDWA 4A1FA 4TQ9A 5J4HA 2FMXA 2REXB 1AGPA 5BYJA 4JJKA 1E9CA 2IUTA 4MRVA 2XXAB 2LKDA 4FIDA 4RZ3A 4AURA 2GEUA 1XNJA 2ZR0A 5IRCD 2XZPA 3IBYA 1L2TA 4PHTA 3J81k 2REBA 1GIAA 1VTKA 4HSEA 1M74A 2NIPA 4BRUA 3DMDA 4B47A 1IN6A 2FGKA 4JBXA 4TL7A 3VR1A 2B7BA 1XTQA 2ZYVX 5B58C 3B6EA 1KBFA 2F43A 1CJMA 1N6HA 3BE4A 2P6RA 4KFRA 2HCBA 1D2EA 2W6JD 5LD2B 3T12A 2JLYA 3FHTA 3QKSA 4C2TA 3ICEA 3FB4A 4IVRA 2ZITA 2UZ3A 2ZUCA 1NN3A 3O8BA 4MQBA 2CXXA 3U7HB 2NPFA 4P33A 4YLGA 1E2DA 2W6JA 4IXMA 2ROWA 1FPMA 4PSKA 2GF0A 4FMDB 2IYTA 2CK3D 4MRPA 2NG1A 721PA 5KSZA 4M9QA 3WXMA 3KTAA 4HDCA 4TLAA 2EFGA 4TTRA 2XNDD 5FR2A 3UKDA 2VP9A 4GZMA 3X1ZA 4AKIA 2ANBA 1GP2A 1Q12A 1YZUA 2ODEA 4BRWA 3GP8A 2RAPA 3U6BA 2OO7A 3LNCA 2P6UA 4FWTA 1BKDR 2CK3A 3HJNA 4Q47A 5ANRB 2YKGA 2WVJA 4B2LA 4CGZA 2BDTA 3VR4A 2XNDA 3LXXA 1OFUX 3WNBA 1F3OA 2WKRA 4GRAA 1HYQA 4IFEA 2ODBA 4D0LB 3C5HA 2ZJZA 4DLVA 2C98A 2J0UB 2ZI5A 1QF9A 1XTKA 4M8NE 3TNFA 2CNWD 4V0NA 1VYVA 2NZJA 1E2JA 4ASUD 5L3QA 1MRSA 4A82A 3I3SR 1ZBDA 4M1MA 3R8CA 1E4VA 5LB2A 1WE2A 1E2IA 2QMHA 1FX0B 1E79A 4HLUC 2WWWA 3RABA 2GETA 2NTYC 3KQLA 4O2LA 4RFSB 1LTQA 4ASUA 1P2SA 3BH7A 1YU9A 3NBFA 3SN6A 3A1VA 3CNNA 1YZTA 3CRQA 3OIWA 4N3NA 1II9A 4IDQA 1KDRA 1XFAA 4DLWA 4BQSA 5EP1A 2G6BA 3EC2A 4XTRA 3EIEA 3I5XA 2V54A 4HAVA 4D2IA 3IGFA 2NO6A 2ERXA 2J7KA 2FGJA 1ZCBA 2V1XA 3PR1A 3DL0A 2E9SA 4LPKA 2QTHA 4QBIA 5BXQC 3C15C 5B64A 3GFPA 5FPHA 4TL8A 4Q4LA 2TMKA 1QHHA 521PA 3ZLJA 1TBNA 1Q3HA 3CZPA 2WWHA 1SVWA 4NONA 3ADDA 2NGRA 1TL7C 1AA9A 4M1YA 1GL6A 2B6HA 4TQUS 1T3LA 4NU0A 1SVIA 3TAUA 3ZQJA 1IONA 1KMHA 2ZRMA 3OFND 4ILEA 5D3MB 3VMFA 4CEJB 1SXJB 1UF9A 1A5TA 3NWJA 4ITRC 3RHFA 1R79A 1SVSA 1YRAA 1PLKA 2Q9AA 2CVHA 1EX7A 3U3RA 1G5PA 1T5IA 1NF3A 2OLKA 3TKLA 1JI0A 3OFNA 5K8TA 2PMKA 2XJ4A 4B48A 4ESVA 2HCJB 4A0FA 1JEDA 2NPIA 2QTVB 3P1JA 2ONJA 3AF2A 4C7OA 4G1UC 2F3TA 2FFBA 2WIBA 1KDOA 1U8AA 2BBWA 3K0FB 1VCOA 4I4LA 3RDPA 2H5EA 1TU4A 4JLBA 5E7IA 4RSGA 3KQKA 1G1MA 4LJ7A 2MSDB 3A36A 1PVOA 1R5OA 3RC8A 4KLNA 3U7EB 3KJHA 1G5TA 4M1TA 3W8RA 4C0SA 4MUAA 3UWKA 5JJLA 3VX4A 4ERNA 1HUQA 5A5GA 4F4CA 3SI7A 1UADA 2X19A 1K8RA 2YOFA 2YWEA 1ZD1A 4O0MA 4E03A 1Q1EA 1ZIOA 3BRWD 4JSYA 1S0UA 1ZW6A 4QGGA 3I1FA 2GJ9A 4EFNA 1NVVQ 2ZIAA 3GLFA 3LVRE 1W0KD 1GL7A 1AZSC 3PEUA 4PQFA 4PC3A 2NOAA 1IY1A 1F60A 1S4QA 3FDIA 4NCIA 2Q3HA 1R0YA 3HWSA 1YZQA 2XTMA 4E5UA 1Q3TA 3FGNA 4TYWA 2Z43A 1J99A 4ZKEA 1AS3A 1AKYA 4KBGA 1S1CA 2QM8A 2CLSA 1XCGB 2YVUA 2GCNA 4LOAA 1CULC 3N70A 1KIMA 1R0WA 5IT5A 1EK0A 4TMVA 2VYFA 2ZI9A 1GOTA 3TSOA 3T1TA 3L43A 2FA9A 4D26A 3IO5A 3LX8A 1ZC3A 2AFHE 1XB2A 4LHVA 1CKEA 4CRWB 1NP6A 1R2QA 3CB4A 4DEYA 1XX6A 3LXRA 1L4UA 2OXCA 1G18A 1W4BA 4ABYA 4FD2A 1Z0IA 2Z4RA 1P5ZB 4URYR 3VQTA 3MWJA 3NIBA 2H18A 3DOFA 3SBEA 4ZDIA 2IYSA 3DOEA 3FKSD 4DVGA 1T9HA 1DPFA 1I2MA 3EZ9A 3LX5A 4JS0A 1LFDB 1MO3A 1TUEA 1II8B 2EW1A 3BC1A 5TDHA 1Z2CA 5EXSA 4DHEA 1CXZA 2LWIA 1KMQA 4B44A 1G19A 2PJRA 1D9ZA 5EE0A 3FKSA 1W36D 5HCIA 4WOPA 2V8OA 3LV8A 4CEHA 2ZAMA 3UWOA 4DCNA 2OUKA 4JLOA 3UMRA 4RFVA 1NVVR 5JS8A 3IEUA 2CE7A 3A1SA 5A4JA 5DI3A 1IN4A 1T0HB 4TZ0A 2ORWA 2FPMA 1OHHD 2R65A 4R98A 1GAJA 4AKGA 2WSSD 5FUWA 1MR3F 3QF4A 4POAA 1I4TD 2ENNA 3RS0A 3KL4A 4LV5B 4FKDA 1HY3A 4MGIR 2BHRA 1OHHA 2WSSA 2W83A 3RSLA 2HF8A 2HDNB 1R10A 1NBME 3FHOA 5JZVA 2ZU0C 4NYJR 3AVYA 2W2XA 2WSMA 4YDSA 1KI4A 4Q1AA 3SQXA 4DWJA 3HR8A 1LY1A 1R6BX 2W2VA 3W9YA 1Z47A 2R8RA 5C4GB 3NVAA 4TT3D 2JDID 1HH4A 3KTAB 1VHLA 1Z29A 1GRRA 2J41A 3A8TA 4Q1DA 1DG3A 2X1VA 3KJIA 1XD8A 2PMDA 4L5BA 1EFTA 2IYXA 4TT3A 2KBEA 3WHKA 2PL3A 4NBSA 2EYUA 2QMEA 5FUXA 3GEEA 4QNRA 3NDPA 1F2UB 2FEMA 4JVMA 5AUOB 2NMVA 2O8EA 4Q4HA 4P4UA 3WBKA 3ADBA 1SULA 1NG1A 2KB0A 3O8DA 4KV9A 3IIJA 2XOKA 3CH4B 1AGRA 2V7QD 5AUNB 3PG5A 1KSFX 3QQ5A 4RY2A 1P7CA 2EQBA 1CR2A 4CEIB 4B6DA 2ORIA 3S1AB 4BFVA 1UBGA 2R2AA 1EXMA 1KDPA 2ZI4A 1E9BA 5JJKA 2V7QA 2AR7A 2GBLC 1ZM2A 1W4CA 4G5GA 4QBFA 1F6BA 3K0EA 1LF5A 3ZGXA 5FTNA 1PTRA 4S35A 1ZYUA 5HPYB 2JCSA 4DLXA 5G3ZA 2BKUA 1T91A 1RKBA 4HUQB 3FMPB 2ZUBA 1Q22A 4EDHA 2ZVPX 3U60B 3O8CA 4C30A 1TQ4A 2GEVA 2X2FA 1ZM9A 2Z0MA 2RH5A 3B1ZA 2BMDA 4YMUA 3D6TB 4QGHA 3TQCA 2QG6A 4FMBB 3QJYA 1P6XA 1S96A 4DB4A 3C14C 1Q0UA 5DISB 5CITA 2BCJQ 2XEXA 3ZVMA 1E3MA 1NLYA 2AN9A 1X1SA 4MGYR 4DDWA 1RJ9B 1FAQA 1VIYA 3AKEA 1RRGA 1XMIA 1E98A 1C4OA 2WBLC 3GLGA 2GCPA 1XJCA 3FWYA 1W46A 2R6GA 3ECCA 3N2EA 2CE2X 2CCKA 4TYNA 1NVXQ 1XZPA 4L9SA 2ZSAA 2D7CA 2J3EA 4A8JA 4II7A 1P4SA 5J4VA 1E0SA 5DE3A 3QXJA 5SZJA 5KSYA 2QUZA 1SVOA 4EFLA 1WBBA 2AWOA 1QDEA 1RIFA 3CONA 4A9AA 1R5BA 4E09A 5FH9A 5TMPA 2EVWX 3M6AA 4LBVA 4Z51A 5LDDC 2QAGC 4FXPA 4R9UC 3W5JA 4BLOA 4L16A 4DDVA 1FTNA 2IX3A 1MO4A 2FU5C 1NN0A 2F1IA 2DFLA 3K09C 3ZVRA 3G82C 3ZJYA 5JSZB 3C5CA 1XMVA 3GJ3A 2GWHA 5FOWA 4RD1A 2XXAA 4I1OA 3LDAA 1XJ0A 1P75A 2PEZA 3SOPA 2B21A 3DZDA 1XXHB 4EFMA 4IJMA 1VCMA 5DNYB 4D0GA 1YZKA 121PA 1XD9A 3REFA 2FPLA 3UATA 1CBUA 3EZFA 3B9PA 1UKZA 1B23P 1F2TB 2CL7X 5KTYA 2OCBA 3H0KA 2GAAA 1JECA 3QI2A 3MRSA 3TVTA 2N46A 4MKIA 3X1WA 4HATA 1DEKA 1CJKC 1Z6AA 5FR1A 821PA 1KI7A 3ND9A 4QBHA 4KXFB 2QQ0A 2XNSA 5JECA 1CF4A 3DKVA 4IEIA 1J7KA 3IQXA 3HDTA 2ZI7A 2WJHA 1DAGA 4ZPXA 4B3FX 1NI3A 3B9QA 2QQEA 4BFUA 2QAJA 4PC7A 4D4MA 5E7JA 3ZZTA 4ZCIA 2DFTA 1IY0A 3JVVA 1Z83A 3LD9A 2ZJ5A 3LA6A 2CJWB 2PCLA 3HYRA 1YR6A 1WF3A 2OBNA 3RWOA 4JL6A 3LH5A 3NXSA 4EPWA 1D2MA 1VDZA 1E2NA 1YVDA 3W8NA 1QVAA 3I32A 3WNDA 2J0UA 3A1TA 4LGMA 3CRRA 4JBWA 1XTJA 4CF7A 2XZLA 4Q48A 1N0UA 3OF5A 2G83A 4BFTA 5DYIA 2DYKA 4YMVA 1JAIA 4MRNA 4OI2A 1FX0A 4IVPA 4NCJA 1TQ6A 3F0TA 1RRCA 1LB1B 3THWB 3F5FA 5DI3B 4GPTA 2V6JA 2W00A 2WKPA 4RFSA 2DBYA 2IA5A 3MFYA 4A6PA 1W36B 1SKQA 1ETUA 2ODNA 4M0LA 4RD3A 2FFHA 2W2TA 4KYUA 2CL0X 1E2QA 1NMZA 3QPUA 1BO6A 1U94A 1BOFA 4HLCA 4LI0A 3U3JA 1NLFA 2C78A 3B8HA 3TVDA 3AP3A 1JPNA 2FWRA 4AG6A 1VMAA 2ZANA 3FVQA 1JPJA 1UEJA 1JR3D 2RGGA 2XTZA 3BORA 3AVQA 3CW2A 3L0SA 5FI1B 2GJ8A 1W4RA 3TJZA 2J59A 4RKFA 3WYAA 2IT1A 4PAQA 2ZJYA 3NH9A 1AM4D 1KI2A 1PLLA 3HU3A 1T3SA 5DLQC 4ARZA 2Q3MA 1G7SA 4H9GA 3TK1A 4JT2A 1AS2A 2JLWA 4PC6A 3U3MA 3Q7QA 3IHWA 4IFBA 3IEVA 5KO2A 4YMTA 5A0FA 1N6PA 2F9MA 2YC4C 4CEJA 2VSOA 2V3CC 1PUIA 3C41J 1DO0A 3K53A 4OL0A 5CYPA 4FN5A 2RGNC 3NHAA 3LLMA 2ZSEA 2GK7A 2EFCB 3UK6A 4PPFA 2QSYA 4D4KA 2QBYB 1P73A 3JZMA 3I92A 2GVDC 2O8EB 4G0NA 4Q4HB 4F93B 2HYDA 4R2IA 1A4RA 4KITB 2GK6A 4Z1MA 5EE3A 1Z6TA 3OHMA 1ZNWA 4JT4A 3K1JA 3A4MA 3K0FA 3LBHA 3B60A 1KAOA 4G5OA 1FNNA 2AX4A 4V02A 2FSGA 1T5LA 3PV0A 1SXJE 5BN4A 5J5CA 2G88A 2J0QA 5FTKA 3H4MA 3SYNA 2AWNA 4DCVA 3CNOA 2SHKA 2UKDA 3RS7A 4U00A 2IEZA 4UXHA 3X2SA 1YR7A 1Z0JA 4AYXA 4NP6A 2IS2A 4OHWA 2J1LA 3EG5A 2C9OA 3M1IA 1QHIA 3WMGA 2XZOA 2YJTD 4DSNA 1FOEB 4TMWA 3G0HA 2HUPA 3MGCA 3SQWA 1G64A 3CWZA 2I1QA 5C1BA 1FP7A 4OHYA 3T1VA 4KVGA 1PJRA 1N6RA 4JL8A 4WZAE 1OFHA 3UFFA 1XP8A 4I1UA 3RLFA 1D8TA 4KCGA 2QMUA 3M4YA 5L3SB 3RC3A 1EFUA 2AK2A 4RKEA 5FOVA 3QEJA 1RFLA 2RGEA 2GA8A 2WJIA 3DDCA 5DI9A 4UNRA 3PJRA 2ZE6A 1G8GA 2VHQA 4Q4JA 2HEIA 2YV5A 4C0JA 3B5JA 1QHXA 2GVZC 1U2RA 3MJRA 1L4YA 2D74A 3EXAA 5FTMA 5F3WB 3AEZA 3Q3JB 3V00A 4CYMA 2OEPA 4PZYA 3U2QA 1X3SA 4URZR 1Q1QA 2NQ2C 3K0CC 4I1SA 4F91B 4V03A 1U81A 5TY0A 1YR8A 3BOSA 1KHTA 2JA1A 3IIMA 1E6CA 3IO3A 4B3XA 3NDBB 4ZKDA 3KB1A 2R62A 3KQNA 3UEYA 5FBVB 4JLKA 4NYMQ 4RD6A 4BASA 5KNCA 4Q1FA 4QHSA 4EJSC 1WRBA 2JATA 3VHLB 1M1YE 3A58B 2ZI3A 4PZZA 3AF4A 1II8A 1S1MA 1DOAA 2DR3A 4D0NA 3NG1A 4JVSB 621PA 2PX0A 1OH5A 1VCIA 2V55B 4LRWA 2LCFA 2JJ8A 2NO0A 1A82A 1UKEA 1CU1A 3SJAA 1SQ5A 2AKYA 3ZH9B 1KK1A 4HLQB 8OHMA 4Q02A 5FUVA 3PEYA 1QHGA 2FFQA 3MWLA 4XVQA 2FZLA 2IYRA 2D2EA 1Q57A 2R9VA 1MKYA 2WJVA 4HAYA 1CJVC 5P21A 1TAGA 5DIFA 3U5ZB 2YWGA 1A7JA 1X6VA 2QT1A 4MYCA 4BGDA 4B33A 1P2TA 4NYIQ 2C77A 4QGFA 1E9AA 1H8ED 4NH0A 4OQXA 1WDTA 1I4DD 1NMXA 4DRZA 4H1UA 2ZE7A 1EX6A 3PIRA 2BM0A 2FPKA 3DM9B 1VG1A 3UGLA 3SNHA 5J4KA 2P0EA 3KUDA 1JNYA 2BC9A 1QRAA 4AKHA 1H8EA 2GDJA 2ZUDA 1G4AE 4TL9A 4NZYA 2OBLA 4A4DA 3FYHA 1JR6A 3L2OB 1JB1A 3OIVA 2IS1A 3Q9LA 2CCJA 1Q21A 2DHRA 3AKCA 3ZS8A 3OAAD 5FPKA 2BCGY 1K5DA 2ZJBA 3ZQ6A 3LW8A 4JLJA 3SS8A 3AF0A 2EWVA 4XWAA 3MD0A 3MUFA 4DJTA 2GKSA 1DS6A 3OAAA 2WZQA 1F2UA 4DKXA 4ZDJA 1U0LA 2HT6A 4LYFA 4Q03A 3QBTA 4CZ2A 1AKEA 1YJ5A 2BKEA 2ONKA 1L7VC 5JJIA 3EZ6A 3UIEA 2OHFA 4C0HA 1XMSA 4B43A 2VF7A 2OCPA 2VBCA 1NVWQ 3KUCA 5L3RA 1ZCAA 5B2ZA 4CEIA 2RGAA 1Z6XA 3AGPA 3S1AA 3R7WB 3L0PA 4NCKA 1N6KA 1IQPA 4HEJA 4YQFA 2CNWA 5FL7D 3DVLA 3L8YA 3EWSA 1WCV1 2WMNB 4M21A 1LS6A 2ELIA 1E9SA 1J2JA 2XB2A 4LYHA 3BB1A 1MABA 2F9LA 2ERYA 3U61B 3SZRA 2ZYWX 1UDXA 2C9YA 3FMFA 4HUQA 3KXKA 3L0OA 4P4SB 1KI6B 4EPYA 2IUSA 1G3QA 2VSFA 4HZUA 2R6FA 4RVCA 5KPJA 1NSFA 3GEIA 1W7AA 4M1KA 3BERA 1W5TA 1YZGA 2IBMA 3AB3A 1LV7A 4V0MA 2VP2A 3B7GA 4ARZB 1XMJA 5JLJA 5JMTA 3N5CA 3U7GA 2VHTA 3EA0A 3KJEA 4LX0A 1EWQA 4O2RA 4B35A 4I1VA 1Z8FA 3KB2A 1RJ9A 3K70C 3MAAC 1E9FA 2PZEA 4HYYA 3O47A 3QENA 1GTVA 1GILA 2DWQA 1YKSA 4GNKA 4RZXA 2QL6A 4QXAA 4OI1A 4A6XA 2WICA 1HEIA 1AQYA 2AHOA 2BBTA 3JVUA 3P4YA 1KZGB 4RCZA 5JFGA 3U7FB 3B85A 3R8FA 4JJZA 3TUJC 3MWYW 5C46F 3A37A 5GJCA 4BEBA 4UJ5A 2F55A 1ZD9A 4LBZA 1ODFA 1OIXA 5G40A 4DCTA 2W58A 3SJZA 3BJIA 2D62A 3RRYA 4BUJA 1FP6A 1NY5A 4G5SA 4JKIA 4TL6A 2ZXUA 2JLXA 3TBKA 4XSHA 1E0JA 2MMCA 1E2KA 3QVVA 2PT7A 2FDCA 4JIMA 5EE1A 5JHHB 2BOVA 1D9XA 4L4UA 3SBDA 4Q9HA 4FCWA 4NPHA 5DHFA 3GLIE 4QBGB 3ETLA 1KO1A 2O8DB 1DVRA 5JSZA 2V9PA 1ZM3A 4F4IA 4BFYA 4Q1BA 5IHPA 2RCNA 3UPUA 4GOXA 4X8LA 3X1YA 1GITA 5AJWA 4FMCF 3T34A 1UDWA 3E70C 2OSBA 1XXHA 3U3KA 4Y0AA 4M2LA 3W6PA 2RGCA 2RMKA 4Q7KA 3U4QB 4HUTA 4KBFA 3GLHB 1U9IA 2X8AA 1F2TA 5JI3E 1N6LA 3I8XA 5EUQB 4B6FA 4UJ3A 1SGWA 4NE2A 4XJXA 3KX2A 2HT1A 4PAMA 1T4GA 3BB4A 5TXGA 2VSXA 2FFAA 3NBZC 1TNDA 4KSBA 1ESMA 1W0KA 4MYTA 4Q4JB 4LJAA 4XD7D 3SYKA 2IF2A 4BFZA 1RYHA 5KNDA 2QAGB 3E1SA 2ZJOA 1UBEA 2BM1A 2FZ4A 3M0EA 2KE5A 2WWXA 3QKTA 5HZHA 2QP9X 4XD7A 4MYHA 3GLFE 4TYQA 2ZYUX 4XWOA 1QBKC 1TMKA 1VG0B 1LF0A 2QMOA 4MDEA 2GCOB 1DAFA 4URUR 5AUQA 2CJWA 1M34E 2OAP1 4C0LA 1K5GA 2B7CA 4LV8B 3KKQA 1JXMA 4XIGS 3QXHA 3TSWA 1Z63A 2RGDA 4LJ6A 2WJGA 3KZ1E 4IOJA 3OIYA 2VHCA 3V4RA 3K0AA 4KI0A 4W5WA 4OHVA 1OFTA 5HKKD 1Y3AA 2WWFA 2ZSBA 2O0JA 1RRPA
chains in the Genus database with same CATH superfamily
5AR1A 1KJJA 4HT3B 2JEOA 3RAPR 3EAFA 3NMUF 3O8OB 2REQB 1ZNZA 3RROA 3ZWBA 1GCUA 4WK4B 1QRRA 1NBMD 3WNVA 1XU4A 4XQCA 4GWLA 5LQRA 4NCHA 4IGEA 1QIFA 3FPGA 4L0QA 1L5LA 1DTSA 4WBNB 1KTIA 5HF6A 1DPGA 3BEDA 2QXTA 1OLXB 3VSAA 2OXTA 3WIUA 3NHBA 5IK2D 1XTVA 4RQTA 4DDUA 2CFSA 1ID1A 2OFWA 4Q7LA 4CT0A 1RKQA 2YJNA 3AF1A 2RHRA 4KSYA 2J33A 4C03A 2WQ7A 3EMDA 4GI1A 2GK3A 1F38A 5DXJA 5HQTA 1OGYA 1UMBA 4YMSA 1AKRA 4WNCA 1YH3A 3OEHD 4I3HA 4G86A 5KQSA 3RFXA 1GUDA 7GPBA 1QAMA 2Q6TA 1NJSA 4OYLA 3ANTA 4GEKA 3N74A 3ZBUA 5AK0A 3ZDXB 4CLRB 5ALWA 4YR7A 2R7LA 3PLNA 3G9XA 4ZAZA 5FPYA 4MA4A 5AK5A 3ZWOA 4AZ0A 2JLZA 3ZDDA 2D0PB 3EWIA 2GESA 4X61A 1SVNA 3PX2A 1VL6A 2YASA 1KH1A 3FPAA 4MO9A 3VZPA 5FBVB 2ZQYA 1TK9A 4LSZA 3SZUA 3O8QA 3R23A 4YWHA 2RDMA 3CKKA 3UG7A 3HU2A 2CXTA 2O48X 2WT4A 1Z6GA 2YCBA 5JCXA 3MCZA 2B1QA 2WWVD 5E3IA 1FDSA 3LHKA 3PNPA 3UAXA 1Z13A 4LOLA 3UAWA 3HB7A 3P45A 4GQAA 3HVIA 2JDIA 3QMMA 4I4NA 1OTHA 2QP3A 4H6VA 1KFCB 2ARKA 2OK8A 4M9ZA 1LRLA 4UTXA 4W7IA 2QBYA 3T99A 2K4MA 1QZ3A 3HP1A 2YNMA 3G5AA 3JD1A 5HZGA 3HI6A 4E3ZA 4XIYA 3B13B 4ZT5A 1JIVA 4GI3C 2Z1MA 2ODAA 5DRYA 4B3SB 5ETJA 1AMOA 2ATXA 2HZBA 1C3EA 1Z82A 2ZIGA 3OE7D 5I7AA 4BEJA 3KUUA 4ZMBA 2Y9PB 3R5HA 4YO7A 2XMZA 4OD0A 1VBNA 3ZVNA 3TQTA 4N9QA 2AH5A 3GUYA 3WMRA 3WGTA 3VHRA 3E22B 1JEJA 1OLOA 1H1DA 3FKQA 1NWCA 2L18A 1QYVA 3N8KA 2ZJ8A 3FFTA 4K46A 2H0QA 4QJ4A 3KTOA 3OESA 2AXQA 4IIGA 4OFZA 4UPDA 3GZJA 4Y67A 4Y2TA 3ZXXA 4BB6A 4CF4A 1JFFA 3PTAA 1G17A 4YYZA 1UJMA 4Q9KA 4YRIA 4B6GA 1UXIA 3K9FC 4HDKB 3H5VA 1NQVA 1UAYA 5JEEA 4BKPA 1QONA 1SXJC 2N52A 1Z28A 4X1YB 3DVQX 1N78A 2PZMA 2YZKA 5JADA 5DM60 2VQEB 1NVKA 3NEJA 3QG5A 1T2VA 4NARA 1ZNYA 2ZRGA 1JJIA 1Z7GA 4DJ5X 1WSAA 1N2GA 4JNCA 1TO2E 3CUTA 1NU6A 3I05A 1JR2A 2AIRA 2HHCA 1F5SA 1A0OA 1JG2A 4R3NA 3JZAA 3OMWA 2Q7DA 3DUFB 4I5FA 4UQOA 4RH1A 1R8SA 5EIHA 1ZW1A 3B1WA 3K9NA 5DASA 3G8CA 2L0XA 4YRCA 2KI5A 3AUUA 4G5FA 4P58A 5EHQA 4B6RA 4DRYA 2PX6A 2OM6A 3IBGA 1AV7A 1AQ6A 3LBNA 4QQNA 4FHEA 3VR3D 3L6RA 5BSFA 2ICAA 4ZIRA 3OLVA 1EGHA 3UB2A 4L74A 3CJRA 2D5CA 4AWXA 5CVCA 1T8PA 2XX3A 3NBYC 5J4LA 2V0NA 1HFKA 3B2EA 5DNEA 3F3SA 2A3RA 3PLAE 1XAHA 4DIDA 3EXEA 5JATA 4BVAA 4CE6A 1R4NB 2WYHA 1N34B 2DETA 1EE2A 1ZZGA 2ZQZA 2DBQA 2DFNA 2H1RA 3N9IA 5EXPA 5FBQB 3RS3A 1R3UA 1E69A 1C9MA 1USGA 1E3WB 2BFDA 2GOYA 2OB2A 4PBSA 5BSTA 1YIAA 1U8ZA 3TRIA 4H7FA 4F3YA 1X74A 1UDRA 2ODWA 3NUGA 3L04A 3P0RA 2GFIA 4QOEA 1FS5A 9LDBA 2P9EA 1P7YA 2I6SA 1Y48E 3ZX4A 5CLIA 2IWRA 3ZCSA 1IEWA 4CM1A 4DMKA 3GOXA 4PIPA 4DQLA 1H0RA 1A8UA 5B3KA 2X5NA 2Z5FA 2WF6A 5FWXB 3K6JA 5EPEA 3LCRA 5EE5B 3NTQA 5THXA 3QEOA 3M9LA 1C4WA 3RU0A 3DDHA 4JVNA 3DBRB 2JD0A 4HZGA 1RP7A 3Q7RA 3PXGA 6CHYA 2I5PO 1AUQA 1DL5A 4EOGA 2WJ4A 4FVTA 3L4BC 1QGDA 2CD7A 4D92A 3UT0A 1XLTA 3ADCA 2X3TA 1XI2A 3D2BA 2AI1A 4Q3CA 1FYDA 1T2UA 2IIPA 5FLEX 3RHSA 1JU3A 3MJVA 4UBJA 2WLTA 4DLYA 1OFIA 1SBCA 2FWAA 3QE9Y 3NHSA 4JUIA 4A26A 3INTA 2Q5JA 3I9FA 4ZDKA 1B6TA 3UANA 1JQAA 3BTOA 2CLKB 1KTVA 2HK7A 2KW5A 4RH0A 4Y9SA 1O6FA 4GP7A 1QYRA 2FN7A 4C7BA 4RIEA 3ZHOA 4AS1A 3U40A 1J4AA 1N7JA 1YC5A 2CBXA 4EYEA 3JALB 3LLCA 2ZULA 1PYDA 1O4VA 1VLMA 1RYZA 4RLQA 4AC9A 4Z54A 5DCLA 2PL1A 3ZXUB 1LVUA 2PCJA 3R3VA 5AW6A 2PRZA 1JIQA 5LZ4A 4RPJA 4CM9D 4MQFB 1EDOA 2I2AA 3DP9A 2AFHB 3JQ9A 1SXHA 4MV1A 2WAXA 4L72A 4MWTA 3TLXA 4I5EA 3A4TA 4QTXA 4PONA 4C6SA 1MX5A 1E0KA 1LSSA 1PG2A 3I2YX 2BGGA 2G7ZA 2WPDA 2X2EA 3RV3A 3D7MA 4AD8A 2JHCA 1G4HA 3K6SB 3EOAI 2H1OA 1JEYA 4ARCA 2RC6A 1SZJG 3PDHA 5AVYA 4H6XA 1ZFNA 1YE8A 3BRSA 2FWPA 3E9CA 4NCNA 3MSXA 3HYTA 2RI1A 1TPZA 4B4VA 3OD1A 1TFUA 4PM4A 3QUSA 5DRTA 2H1FA 4R4JA 5LQDA 2Y27A 3D5EA 4QNMA 1A2KC 1Z16A 3B48A 3FMOB 5LB4A 1VE9A 1BQEA 1RABA 1F4VA 3BFJA 1J09A 4NG4A 1TMGE 2PGNA 2VJBA 2X7HA 2XXJA 3K0AB 3CVUA 2BHSA 5GZ1A 4UFOA 4KPUB 3GCDA 4M22A 2QTMA 4MLZA 4WXPA 1SCUA 4FINA 1JQLB 2WIFA 3R7WA 4TN1A 1QXSA 3QE2A 4EW2A 5CIQA 3A9CA 5AKIA 1LNQA 1UPTA 3VMMA 2VP6A 4OK3A 5JSHA 2O3RA 5FX2A 3IA7A 4C3ZA 2KHZA 4PPNA 1XVIA 4OFBA 1DJNA 1B0AA 3K2QA 4QUAA 3EFHA 3KKPA 5GGYA 3RQSA 3WYGA 1AMNA 5JWHA 4PWZA 1Y8ZA 2V6GA 1SHKA 2CLLB 3A25A 4RA6A 2E5RA 3KOZA 4WI1A 2EV9A 2WUFA 5LYJF 2DKVA 1QLJA 3R3UA 1CS4C 2GO1A 2Q9BA 2Y1EA 3G1WA 3HBNA 2W6ID 3NNSA 1I10A 4FGLA 1AV6A 3TR6A 1KI6A 4TSFD 5J1TB 1E5TA 5JWRA 4G84A 2FB9A 4I4CA 4AI6A 4B31A 2KS6A 3GDGA 2QRKA 3EEIA 3HEAA 5EPOA 4OBEA 2DECA 5FNVA 3GRVA 5K0TA 2VDRB 2PU7A 3V7UA 1D03A 4Q82A 5IW8A 4Z3DA 2XHEA 4K6OA 2ZRCA 2J08A 2YWCA 1GSOA 3NIFB 1CJCA 2WYWA 5FWNA 1MOZA 3ZE9A 2W4MA 4BPRA 5FWDA 3KL2A 2DT5A 2WIAA 1OWNA 2I7DA 2VJAA 5GJVC 1T29A 2IIQA 1ZSVA 1RKXA 4B3DA 1SVUA 1NJ8A 3B82A 1XL0A 1F8UA 2GPTA 3E5MA 3ELDA 1QPZA 3F71A 3H11A 5T5QA 2GBLA 4J6EA 2R8BA 4KACA 4KEAA 3DFUA 5CDYA 2HMTA 3CRW1 2ZT5A 4MJ7A 4PFSA 1RI3A 1U11A 3FYSA 5HR5A 1VJDA 3O3OB 5BUSA 3PWZA 3I9KA 2UUAB 2Q9UA 2W48A 2JZCA 1XZLA 3IXQA 4H7DA 2IXFA 3F1LA 4MRSA 3TM5A 3UT5B 2YX1A 1T10A 3G85A 3D31A 3SX0A 2XZTA 4XLLA 4BNGA 4HH1A 1U0SY 1QQAA 1VIDA 4UHEA 2EU8A 1FTQA 4H27A 4N82A 16PKA 3OZGA 5AO9A 1L1FA 3ZCUA 1M0SA 4O4LA 3I2FA 1J22A 3NC4A 4JJAA 3W5IA 5A4KA 4MUIA 2DZDA 2P75A 5IMBA 3RSQA 3H86A 3Q9SA 5C5EA 3ZOKA 4XYGA 1FFBA 2P69A 1IOZA 1Z56C 2F59A 2XYVA 5ENVA 1K4YA 1MPTA 1BXKA 1T9DA 1ZAKA 3FRJA 3LOPA 4IIUA 4PX3A 3LF2A 2R1TA 1PEKE 1QCYA 3KU1A 5DHUA 5K0JA 3KEQA 2LW7A 1SC6A 3EDRA 2O8DA 2UZ0A 4AJ1A 2QZ9A 2YIDA 2FRXA 2J0EA 4HVCA 4OI0A 2J0SA 1WDMA 3SQOA 3M5CA 3WTCA 1ZJ4A 1JHAA 4Q7MB 4Q9AA 3K70B 1J0EA 3ANYB 1PZHA 1CIPA 2HL6A 2SCUA 1C80A 1L5OA 1SHUX 3LS2A 3UH1A 5AVUA 4LJ4A 2WMYA 4OK5A 3HGMA 3GMIA 4TZTA 4L15A 1GPUA 4W82A 4IINA 2CDNA 1ECGA 3T9BA 4BGUA 3SHTA 2RIPA 2ZRLA 1Z6PA 3I04M 3QOWA 4CMEA 3I6YA 4ZCLA 2YL2A 3EA5A 4IO0A 4EHBA 3L1UA 4Z8YA 2PX8A 1OWMA 4EELA 4FFOA 1VZ3A 2C3UA 2BFOA 3WQHA 2PLRA 1FARA 4OUKX 3TNYA 3NYIA 1GNVA 3GP5A 1S20A 2ONYA 1VKNA 1JVSA 1KOFA 1S01A 3NUZA 3GA7A 5D5QA 4B2YA 4PR3A 1N8TA 1T6BY 10MHA 1JAHA 1FZQA 3X1DA 3MEKA 1H2RS 2QAGA 4E14A 4HI0E 1K6JA 3KYDB 4Y1FA 5HRCA 3ZX5A 4QA9A 1DBVO 1U0NA 2PBLA 2NM0A 4OKNA 5LZ7A 3TUIC 1S2IA 5MGBA 4QJBA 3F49S 3FE2A 1AO3A 2NPOA 4JASB 4JU8A 2PZKA 3CLKA 1HPLA 3K09A 4TTSA 5A7FA 3BSWA 3NAGA 5DYGA 2I9PA 4OREX 2BUAA 1ID8A 3GFBA 2OD1A 4GOKA 1G7TA 4DXHA 4HBGA 2GCOA 4DQKA 2WF5A 5BURA 1UPUA 1Y34E 1P9OA 2Q0QA 3U17A 4NHEA 3AMVA 3OIUA 3TPZA 4KLRA 1J8DA 3ZE6A 2O7NA 4WKPA 5EMLA 1EHCA 1W6RA 4Q3DA 4ZCPA 2CVZA 4JI4B 1P1RA 2ZKIA 3OQPA 4AY4A 2JZOA 1V7PC 1VKHA 1R9GA 2FE4A 3BIJA 3KAJA 4GLJA 5EJ8A 1IQUA 3UK2A 1SCBA 1TZJA 4UPEA 1Y7LA 4J0QA 1V48A 3CB2A 4GMDA 2NN3C 2K2WA 4AW9A 3A6KA 5BMVF 4XRRA 1UFQA 5M29A 3E9YA 4F4HA 3ZIAA 1IBRA 3PP8A 1R0LA 1MUUA 4GW3A 1ONBA 1V26A 2R60A 2H57A 3IV9A 4MEAA 3X1KA 4LWPA 1VCHA 3DQPA 3PUXA 4IKPA 5F7JA 2OOSA 3DDWA 2SKDA 2C96A 3G7UA 3P97A 1G9XA 4E33A 1X70A 1QVZA 2Y2UA 3P0HA 1L5HB 3IIEA 5BRNA 3TOAA 1QNFA 3G8YA 1UAGA 3PVSA 4CTJA 4EA7A 3B1KA 3TOCA 3OZRA 1U0JA 4EY3A 4KR6A 2OCAA 1JIUA 4NJEB 2R1ZA 3K31A 2VXCA 1N5MA 4INPA 4R2WA 5AJZA 1Z4MA 4F9GA 2D5AA 2ECPA 2LR0A 4MW9A 4G4GA 3TLEA 1RI2A 3R3ZA 1MT0A 4S2EA 2WJZB 4HGQA 3V48A 3HDYA 3N2KB 1C41A 1Y37A 5JD3A 4EW6A 4TLCA 4DSTA 1NNSA 2P5YA 1P39A 3H1EA 1AKQA 4L4XA 3K1ZA 5E1DA 4Z7OB 1XNRB 1E20A 3QXXA 5ILQA 1UVGA 3CO5A 1OYVA 1TF5A 4LF6B 2V97A 3F2VA 4IJKA 1RTTA 2RJOA 3DBLA 4D9GA 1J90A 2JFXA 1W44A 2BAGA 1JNXX 3JQFA 1BMFA 1IWBB 3OT1B 4GYWA 5JRDS 3UC5A 3G0IA 2YN4A 4EKNB 6Q21A 1Y4AE 4W1SA 3LGSA 2XQGA 5K8JB 1US8B 3PCTA 1S6YA 1IEVA 3N0TA 4NRDA 4A2WA 2VJPA 1WUIS 2J67A 2L17A 2HUNA 4JB3A 5FOTA 2BHNA 2FR8C 3E1GA 3AP2A 4F86A 3FVVA 2BGTA 2XT6A 3DONA 1VYTA 1W7AA 2A4MA 4WASA 3UGJA 4UBLA 3N86A 1USUA 5T3YA 4D46A 2G1KA 3T9FA 3ABQB 3CSSA 3B1VA 3SR0A 4BXOB 2QRQA 4PSDA 3THYB 2O1SA 5ALNA 1M6VB 1W2GA 1C4KA 1K98A 1ZY2A 4P5EA 1YHNA 5TVGA 1NLZA 1EVZA 1HG1A 4HB0A 1U4NA 1DCFA 2PR2A 1H8HD 4UHFA 1VPWA 2E4WA 4WFIA 3VC7A 1F2VA 4YXWA 4R2MA 3ENVA 1GEGA 1NR1A 2IPAB 2R6CA 4DR3B 2PS0A 3PXAA 5IAAA 3MFQA 4Z2AA 5JANA 4CIWA 3FSJX 2PLNA 4DT1A 1PR4A 4PX9A 1J00A 3JWEA 4JX8A 3ZQUA 4A2PA 5IZCA 2E5WA 1LLQA 1QG6A 3CQ9A 2DTXA 3B5IA 5GONF 4BS9A 5T8KC 5G0WA 4Q7JB 1E7SA 4EA9A 5J2UA 3AERA 4JA2A 5HQJA 1TE2A 3TX6A 1QBGA 3RS5A 4TMXA 1IIRA 3BTUA 4RTNA 1KEEB 2DAPA 1JYFA 3WGLA 4RABA 3V7YA 3MOIA 4ZV7A 1X92A 3AUTA 1Z3IX 4RX1A 1EB9A 4D80A 2HF7A 3Q11A 3CVOA 3EIQA 2VAPA 4N3BA 1U5AA 1D6JA 3KDSE 5G53C 3TECE 3ZU5A 2R1VA 4C3UA 1M7GA 4KIFA 1KU0A 7MHTA 3G5TA 2ZSDA 1XEXA 4QUJA 2EZ4A 2H54A 4PU0A 5ECDA 3TPFA 1NZFA 1Z4NA 3IX7A 3LPNA 3WLFA 1RHUA 1TECE 2XSZA 4WNAA 1DJOA 1Z8DA 3HKCA 2FF5A 2JLSA 5EKXA 4MARA 3T4PA 1B15A 1OX4A 4M9UA 4MVJD 1HQCA 2WMOB 4LDJA 3QKRA 4Z8XA 5DBOA 5BSUA 3RGGA 1GLVA 2Q28A 5CIWA 3WOHA 3LOQA 1XQWA 3A2LA 1GQOA 1NDUA 2QR2A 3JCZA 4D8WA 2X76A 2O5RA 4LTDA 4XWTA 3TL2A 5JC8A 4EA8A 2ZT7A 2Z8YA 1Y1QA 2VJCA 3RSOA 3ZCRA 5FFMA 1QG0A 1RZUA 2JIZD 3G59A 1S3GA 1UMCB 2BP7B 4TKUB 3TW4A 2FX5A 2QSJA 4TV8B 4BLPA 2FSHA 4I4TA 4DEXA 2CSUA 5IDYA 1OXMA 4PQEA 4QAJA 1X1AA 2GBCA 2FF7A 3EGXA 3SEKC 3T0GA 3DHWC 5I7UA 3WJAA 1VCNA 4EPTA 3PEWA 5BV2P 1SRRA 1KK2A 1TJYA 1YR2A 3DLPX 5DJ5A 4PPGA 4KVAA 2IV2X 4J4BA 5AJXA 2N3ZA 3CXUA 1CV2A 1KO5A 3DPUA 3MPOA 3RF6A 5JWOA 1JEQA 5BVGB 1LI5A 3TN7A 1HOTA 1GPYA 4GL2A 4LXHA 3THXB 1RYFA 1E32A 1V96A 2PGIA 1X39A 1AIPA 3LO5A 3ZQ4A 3OX1A 3PQ7A 5GPBA 3DKRA 4UZSA 3JVIA 1HYEA 3D0QA 3AR4A 2DB6A 1Z22A 4B3BA 4GNRA 1GUAA 1LTHR 4Y7DA 3HV2A 4R0NA 1G66A 4DE5A 1T5SA 1CFJA 3TH5A 4XVUA 4ONEA 2ZIEA 3EULA 2FG6C 4RLHA 5J2TA 3P9IA 2PUDA 1LZKA 1USIA 2AW5A 1FDOA 4YONB 4HNHA 1JG3A 2A9QA 2MSEB 2PJUA 2UZAA 1TBOA 3WLNA 5LNK6 1YQUA 3QVMA 3GFTA 1WS6A 1RXEA 2Z2ZA 2QN3A 4C08A 4EUNA 4EJSA 4QQFA 4CR8A 1YKGA 1ZVJA 2G77B 3WSTA 2Y9MB 2WFLB 3C7CB 1O08A 1XDZA 2IUYA 1Z0ZA 4OI4A 1XXHE 1W4AA 1ADFA 2W0SA 1U28A 2WHRA 4KRXA 5ESWA 1I3MA 4NLLA 3II6X 2O2ZA 2C2GA 4CNBA 5CA0B 1NZJA 4CU2A 1D2CA 4NBTA 2BFCA 2WD7B 3TZ6A 2NU7B 4R7GA 3FWZA 8ADHA 2IU6A 1DKPA 5JRJA 1JAZA 3CKLA 2Q3CA 1G6HA 3KHSA 3DNPA 1MG5A 2AV6A 5BOSB 5B58T 2JGMA 4RIHA 3RU7A 2GTPA 3ZH2A 1BXGB 4LECA 3COVA 1CR0A 3RT9A 5B55A 3KQHA 2XGJA 5I7EA 3CEHA 5JBQA 1JXOA 1PR5A 4ZO6A 2V1UA 3CF0A 3DD5A 3GEMA 5CA1F 4QOJA 3Q2KA 4ZHQB 4L6AA 4DR2B 2A0YA 1X1TA 1MAVA 2B3DA 1U98A 1QZUA 4B7CA 3LRPA 3M4ZA 4H3KB 4CVNA 3HEMA 4LHWA 3URKA 3Q88A 4YRDA 1BQ3A 4MRRA 1ZK1A 5LD2C 4QOSA 1M1NA 2CYBA 1TA9A 5HF8A 2HIGA 4J3FA 3TJMA 1C3JA 1T1SA 2C8KA 4UOZA 1V1JA 1XVTA 3LK7A 3AW8A 2ZDHA 1S9DA 3RUCA 1MRNA 4HVTA 1XMPA 3UG6A 5J5VA 4NPAA 1SH7A 4MV8A 1JP7A 1I6LA 4H7PA 4BV8A 2FWMX 4DC0A 1FYBA 1IHYA 2J7PD 3O7WA 4IP0A 1X1EA 3A4LA 3BZUA 3SQMA 4D4LA 1W94A 5KTPA 4FD3A 3C7KA 3GLKA 1ULAA 4M60A 4S1VA 1NBMA 1FRVA 1K27A 2LUYA 3H8WA 4IDPA 3V9PA 3ZXSA 1VLLA 3HVKA 2I1WA 4JVOA 4ZT4A 4TUYA 3ZWKA 2FMKA 1ORDA 1I7DA 2VDNB 2VJMB 1ZJZA 3EZ7A 4HDOB 7ADHA 2HF2A 3MLBA 4R8LA 1FFHA 1Z0AA 3SHWA 1W87A 2C20A 1GAWA 5H8WA 5EL0A 4TS3A 1E8DA 3CPHA 2ZQ5A 2YHBA 2V1CA 3FNEA 1S8FA 4M8LA 5KWSA 1V8ZA 2FMIA 4ALMA 1K7SN 1G3UA 2PT9A 2QTAA 4UE2A 4O2AB 2LIVA 5K2MA 3IOMA 1FTSA 2YRFA 1TCCA 3FTNA 4EQZA 1SQGA 2C9MA 3FDZB 2C5HA 3H9UA 1EZ4A 4INZA 1DXOA 5JCZA 2B2NA 4Q3LA 2VNKA 4N76A 3R40A 2SGDI 1S9HA 3WGOA 1U0RA 1W2WB 2VBIA 3QSYA 1KKMA 1X1QA 1OD6A 3E9DA 4BNVA 4BTEA 4JEIA 3H3JA 5EE9A 4RTKA 2RKOA 4GOOD 3UV3A 1IULA 2IRWA 2H2HA 3GLVA 5LXTB 1XEWY 1FTYA 4OOFA 1YFLA 3PE4A 3WLJA 1IBMB 3DWEX 3V1LA 1O58A 4IH1A 1PSZA 2QU7A 2ZIXB 2A9KA 3RWMB 3ZWMA 3RUEA 1OXBB 1CUAA 1BJTA 2RJ3A 4OHFA 5GIPE 5SZHB 3TOXA 3IR5A 2CV2A 1E62A 1O8CA 2CVQA 4YJHA 2H7YA 2BBSA 2PBZA 3EFOB 4H17A 3CUYA 3HM9A 1X87A 1E3SA 1MJGM 2WABA 3TW8A 5C4IA 1RWQA 2GASA 5KDOA 4DN6A 1PTQA 2WOOA 4M1WA 4ZRMA 1CRLA 2HPVA 1XJQA 2CMHA 2I4LA 4FYHA 2UDPA 3S27A 3VU9A 5A9SA 4QM6A 3KQUA 3OFSA 4KWEA 2Y6UA 3LW7A 4J0DA 1U90A 1YASA 1R18A 4Y2QA 4C89A 4MVJG 1K2VN 4H7IA 5CFMA 5FQOA 2REOA 1LFAA 1UJBA 1MG0A 3FPLA 1P1IA 5AT1A 3ZLBA 4AFNA 4ZTUB 1OA0A 4JI0B 5CCMA 3EOBI 4US1R 1GNRA 4CI0B 4QWMA 2GM3A 1XZMA 1D2RA 2JBWA 2QA5A 2VPZA 2WFAA 3FF1A 2HRQA 1VSQA 4HSGA 3PQ6A 4G5QA 4MHOA 2HW8A 4D74A 1IPEA 1K6XA 4O3MA 4R1MA 3DE6X 3UV7A 1EWYA 1N7IA 5KOIA 4EZBA 4KJXA 1AC5A 1GNQA 2NADA 4XOIA 1A9QA 1PFKA 1SD5A 1T4CA 3UYKA 3DFIA 2H7VA 3B6MA 1R3DA 3R5SA 3M9XA 4MVYA 2ZYDA 1QFZA 1C0IA 3G49A 1Y4SA 2EAUA 4AUNA 4PO8A 1PN3A 2ID7A 1OIVA 3R3YA 4B34A 3DE4X 4ZQHA 1ZP6A 1M8KA 4JBLA 4L8GA 4Q19A 4PFJA 2QD3A 1HTBA 1H5UA 3GLQA 4KAXA 3D6HA 1JJFA 5HGJA 4UVDA 3T5AA 2I6UA 2XCRB 2VJQA 1UPFA 4AL4A 4P2BA 4IIJF 1OYYA 1ST3A 4PX5A 4D4IA 3A2KA 2ZIVB 1X1CA 4QOFA 4ZI7F 4OMCA 3RRFA 4WKOA 1M10A 1BWSA 4DDMA 1CUSA 1M8PA 2XNHA 1EIZA 4BO0A 4Y1RB 5KNBD 3SLGA 3NNNA 4D3FA 4E2YA 1F4PA 4F6CA 1KMHB 1K0UA 4Z4IA 3ZDEA 1VPTA 4M1SA 5CJ2A 3KIPA 4YY3B 2M32A 1GXSB 1HE5A 2W90A 3ADKA 1X0XA 5CX1A 1VP3A 1EXNA 1G8FA 3SGBI 5CVEA 4AQYB 1DC7A 4B2PA 2FSIA 2JANA 5T6MA 3GLIB 5K8LA 1H3EA 1ZC4A 1SGRI 4Q4AB 1P3JA 1GA4A 4J29A 1Z33A 2AD1A 2Y0EA 3WSWA 3CXLA 1WETA 5LCXA 2HDOA 4N5LA 3EUFA 2H5JA 2PFGA 1P77A 4IZOA 4KOAA 4QL3A 2HPHA 3RAGA 2DTDA 4KE9A 5A2GA 1NKTA 4QG7A 1GQYA 1QYXA 4FDVA 4KPFC 3HC7A 4YCLA 3NEYA 5DHAA 5TEWA 5IVIA 4WLFA 3NX4A 5G3YA 1XZGA 2H06A 2XCQA 4JYCA 3I6IA 5C8YF 4LBWA 2GILA 1X7XA 2C2KA 3DNFA 2G5CA 3QBDA 2MINB 3H2JA 5LBIA 1OKKA 1QFSA 3BTSA 5K0LA 1YVUA 1DQYA 2WA2A 4PSAA 2QIOA 4TQGA 4AN1A 1SOAA 3H2BA 4XR4A 1FK8A 4YIHA 1SB8A 3R7BA 1PG5A 1RQGA 3O8NA 4F72A 3TG8A 4BMVA 3RRNA 3WP1B 2EGUA 2ZRDA 4PF1A 3MWDA 3RTCA 3CUKA 3VNQA 4EX6A 3BH0A 3VA7A 1CUWA 4MHSA 5TEVA 2V4ZA 1K9SA 1N5LA 1J8VA 1JFLA 2VYND 1TM5E 1J07A 1J2TA 4DIEA 3L8DA 3JR7A 3T3MB 4F0JA 2QTWB 4UM8B 4ZICA 4M3NA 2HNKA 3W90A 1TA0A 2HRCA 3KKMA 3Q8XB 4NG5A 3LPCA 3OEED 4CKBB 3OZTA 4TMYA 2CFIA 3RVRA 3D4LA 4R2KA 1WQ1R 5TT0A 1E2EA 3VZCA 3NC1C 1HLPA 5CVJA 3O75A 5JZBA 2H8KA 4EJ6A 1Y5RA 2YHSA 5JU6A 1I4OA 2XCUA 3IC5A 3DYVA 1BMDA 3B89A 4H60A 5AIBA 1RRKA 2Z4TA 1AK2A 3BN3A 4NAHA 3ZU2A 3MWKA 3BWBA 3NBAA 4I99A 3EX7C 3N2ZB 5FOSA 2XY4A 1NBIA 3FRIA 2GHQA 4YJGA 1QH9A 4D4GA 1EJBA 5FUMA 1DT5A 4UKDA 3U3OA 1U9JA 1U3VA 2AVDA 4IYRA 3R9WA 1Y8RB 2X15A 4MB2A 3E9MA 1KYZA 3LECA 4AO8A 2V7EA 1P0CA 2CXQA 5EWMA 3T52A 3U6KA 1EG2A 4ENQA 2XTJA 3ZWNA 3OIDA 1IHDA 4RGBA 1KHHA 2R96A 3N58A 2FKNA 4ZOCA 1UM9A 4RD2A 1MENA 2I6TA 4WFJA 1Y5NA 3GJTA 4EPXA 3G1UA 5T3UA 2JAXA 2XDWA 4KQJA 5JNUA 4Z4QA 1ZJ6A 1ZU5A 2IYPA 3IYLW 7AT1A 3TMAA 3UEJA 4Y2YA 5CYOA 2R85A 4HOYA 2QRHA 5FNZA 2QRNA 5E6RB 5T6BA 4I4IA 4Q66C 2O50A 1W35A 4E70A 3OF3A 1B2LA 2QE7D 5F1OA 5CRIA 2YZ2A 3AEKA 3V32A 1ZVQA 2ZRQA 4CPDA 2QG4A 2WNIA 3OM1A 1KDTA 2D0OB 4FJ1A 5K8IA 3HXTA 2AOTA 1OW3B 1UM8A 2FK7A 4MR9A 1YJBA 2FK8A 1XL1A 1FNCA 2IU4A 2Y8EA 1LU9A 3LDUA 4YFYA 5D87A 3ABSB 1BZYA 1T26A 2B1GA 3LWZA 3N8IA 3NHFA 3BK2A 1O77A 5FTJA 1MDBA 1KVSA 1T5BA 2J0VA 3C3XA 3L6UA 5B1YA 4F6RA 1T2EA 2FEKA 1H1TA 5E3QA 1R15A 1XZQA 2WD8A 2Y0BA 2HJVA 3EODA 4JLPA 4MZDA 3REOA 1P61B 3NWBA 4C0AC 3JZIA 4A0QA 1H0HA 5H4GA 2J09A 3NAZA 1JTVA 5BNIA 1TC2A 1ZL2A 3DBVO 5H9VA 3N8HA 2GM5A 4JL5A 2H92A 4EYOA 3IILA 4CMCA 2O5VA 3X1JA 4H31A 4WJZA 3ASVA 4X20A 1Q7GA 3AFMA 2W6CX 3Q7IA 3TCNA 3TZBA 1VJRA 3BXGA 3STXA 3FZQA 4ENUA 2Y67A 4UHJA 2QM7A 5D01A 3VR2D 4GI7A 2YH2A 1I4WA 1MXFA 1SXJD 2DPMA 4HHEA 5LFAA 2V6MA 2NU9A 3FPHA 3PU6A 1S7GA 3LT5A 4CM4A 5KVCA 3HKBA 2Q45A 2E4VA 3LNTA 1V5GA 2PBFA 2QRPA 3NP7A 1JMYA 4AIIA 3W2EA 4XWKA 4YQEA 1VDDA 3O82A 4ETMA 1YCDA 3FTQA 4CUKA 3JV7A 1B41A 5NLLA 2A9JA 5FBLB 4CT5A 2I9KA 4MYRA 4BFSA 1P29A 4IDDA 4L50A 9MHTA 3MT8A 2PMCA 3B7PA 1AMUA 4CKWA 2WE7A 4DNOA 2I91A 2FDRA 3IDOA 7ABPA 5L95A 3PTZA 4E22A 4MHTA 1JEAA 2VLIA 2KM1A 4HXEB 5HFNA 5CFOA 1F8FA 2Y1WA 3O83A 4DM7A 1CR6A 3CXRA 4MCHA 3KO8A 2BGLA 2Y4OA 2XYGA 4DW8A 5KDDA 4ZCSA 3VC2A 4L5AA 2PYIA 2C1ZA 2XZDA 3UPTA 1EK1A 2V5UA 4NS4A 1G4UR 1NMYA 1CGII 3P4XA 4R5HA 4AJEA 1V5WA 3E15A 5B1HA 5ICSA 1P2UA 1IUOA 1FUKA 3I0NA 1Y7IA 1KAEA 1A8QA 4ND8A 4UBIA 2R6AA 3DMFA 3J7TA 1RFHA 4RMJA 5C4MA 5IDWA 1SVKA 3ZKWB 4LE1A 2BFWA 4G0QA 5TC4A 1W0JD 3CH7A 2I03A 3RTGA 2FE1A 2QPAA 1S8NA 4FCVA 4ZCTA 2OA0A 3GGSA 3HO6A 4GX2A 1PFYA 5TNXA 4KZKA 1CUBA 1C5KA 1XR3A 4EGCB 3P94A 4ZGBA 3FTCA 4L8YA 4XYEA 3H1PA 1PJSA 4I1IA 4U1RA 5EJAA 1ODTC 4DJDC 1TMYA 4OQZA 4JBIA 3V8MA 3T7EA 5E3HA 3CZMA 2NACA 4RJJA 1HDRA 4FYJA 2VYQA 1KKLA 3DYIA 3UM9A 3UXEA 3ZOZA 4DCSA 2HLDA 2W43A 1QIJA 1G6OA 1QK3A 2SBTA 3M34A 3PHGA 5ESXA 4YREA 1YWGO 1GZSA 2RB4A 4J0KA 4MH0R 4CMIB 1ULSA 4B76A 4GF5A 2F90A 5IANA 2C4HA 4GMXA 2BF4A 2HK8A 3GC6A 4ILKA 4TXLA 4YO8A 1USWA 5G4LA 4ZYYA 3K4PA 4EDFA 5AVTA 1E60A 4RNCA 4BX0A 3R0JA 1O95C 1ZLYA 3S28A 4E5MA 4IMPA 3HCEA 3RJ9A 4GKVA 4I3FA 4MA5A 3ZWDA 3C39A 3O8RA 4R1LA 3LWBA 4QICA 4F3RA 2AC7A 2EIXA 3B1YA 2ZRBA 5KTKA 4FFBA 3C85A 4EI7A 3CN9A 5KOYA 2JCVA 3OQNA 4AY3A 1J97A 2F1HA 1H42A 9ABPA 1NT2A 5F35A 3S2GA 3L7NA 3CTPA 4F2DA 4CDGA 8AT1A 3QHAA 1OXUA 3L0YA 3DE3X 4C6TB 4E07A 2A5YB 3TGPA 1EFPB 3HRKA 1MT1A 2ZPTX 5EMMA 3TTTA 5AJUA 4PN3A 2WWGA 4P3OA 4PPYA 3STTA 4ERXA 2JLAA 3PHLA 1K97A 3I5MA 5E9AA 1I0IA 5GONA 1JQ3A 3CNQS 4P35A 1VSBA 1S8OA 2DTEA 4TMTA 4DNXA 1KEKA 4L7QA 3PA8A 3UUEA 4E0BA 1XTZA 4BIIA 2CZGA 4GI5A 1RAFA 1P5FA 3GRKA 1XU9A 5DGDA 4FYXA 3F8TA 4LZPA 3E5RA 4R6WA 1W2HA 421PA 2BMWA 1BDIA 3I9JA 1MO2A 3U48A 3WISA 5J4HA 4XD2A 4YRQA 2CD9A 2Q2QA 2B30A 4P92A 1SUDA 4JJKA 2IUTA 3NYWA 1NP7A 4BBAA 1F06A 2LKDA 4FIDA 4RZ3A 4XWYA 1UZLA 3OC6A 3C3AA 3V46A 2ZR0A 1Z2PX 2XZPA 1L2TA 4PHTA 4QPCA 3HLYA 2VXYA 2X4IA 2WRZA 5JLAA 4UAVA 2HSWA 3UAVA 4BEVA 1P2GA 3DPSA 4AUKA 1N77A 2RK3A 2UVDA 1DUSA 1IN6A 2FGKA 3N2GA 3VR1A 4NPCA 3D1VA 4F5ZA 5B58C 2ZYVX 3B6EA 2IEBA 1KBFA 2F43A 5FTWA 3ZHZA 2P6RA 3DFKA 2AC4A 2HCBA 4W4TA 4LMAA 1D2EA 2CHUA 2W6JD 1I14A 4YUWA 3T12A 4ARVA 1TQHA 1PWHA 3D64A 1NAHA 2MCFA 4C2TA 4IVRA 3ZE8A 2NQ8A 3E3NA 2ZITA 2UZ3A 3JWGA 2ZUCA 4L73A 4PV7A 3B7WA 1LCIA 1K66A 4JP8A 1D1QA 2H1VA 4WVLA 5SY6A 3ZUGA 4DM4A 3FD8A 3TTSA 1KQNA 1FJ2A 2X3YA 4E7PA 2ROWA 1NXUA 1SQ0A 4MAMA 1VBKA 1CUCA 4RORA 5WRFA 2IYTA 2CK3D 3D6FA 1ESDA 3DE1X 3Q0EA 1PS8A 5KX5B 5IKMA 1RKVA 4TTRA 3JSXA 4GZMA 3X1ZA 3ONNA 2H9YA