5FUVA

Catalytic domain of thymidine kinase from trypanosoma brucei with dthd
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
181
structure length
173
Chain Sequence
b'HGRIELIIGPMFAGKTTELMRRVQRHKHAQRSCYIIKYTGDTRHDQRALTANVSVSNLHDVGDEWRKYDVIAVDEGQFFPDVAAFCSKAADSGKVVIVSALDADYLQEPFEEICLLVSRADSVVKLSAVCMECHNRKASFTYRTVKSDERKLVGGSDMYMSVCRSCYETKRNM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords THYMDINE KINASE
publication title Cell Cycle Regulation and Novel Structural Features of Thymidine Kinase, an Essential Enzyme in Trypanosoma Brucei.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transferase
total genus 55
structure length 173
sequence length 181
chains with identical sequence B
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2016-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 5fuvA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fuvA01
2EFGA 3K1JA 1GM5A 3UWOA 1DE0A 2GXSA 4NYMQ 4UNNA 2Z6VA 3MAAC 1TU4A 4JT2A 1KI2A 3PQCA 4U7DA 1NMYA 1N2CE 3EASA 2N42A 2IYUA 2R9VA 1G20E 2AR7A 1BKDR 2JATA 3TSOA 2IYVA 3UEYA 1NKSA 4QXAA 3UEJA 3P20A 5DI3A 3HR7A 2ZREA 2RGDA 1U8AA 2B21A 3N2IA 4KLZA 1WMSA 4OJKA 4YXWA 3ZZTA 1NIPA 2JDIA 1NVXQ 4BE7B 4HZUB 1VYVA 1XWIA 4B6EA 3IBGA 3WNBA 3FMIA 1E2GA 5HZKA 3KKPA 4LPKA 3RRNA 1WE2A 3PCRB 4PHHA 5E7JA 4GNKA 3R8FA 1KGDA 1R4AA 4KAXA 1QZXA 4DDVA 2DFKB 2FZLA 2B7BA 3JZMA 3T1VA 2FX3A 4DUGD 1N6LA 1M2OB 4F4IA 3S1AB 4Q1EA 1MO5A 4XWKA 4LC1A 1R0XA 1U98A 3GCGA 4C0JA 2ATXA 1E2PA 2DCUA 3MJRA 1WB9A 4WA7A 3FB4A 4EJSB 3OEEA 2FPLA 2XOKA 3J81k 1IOZA 4CDGA 2H8KA 1EESA 2ZU6A 2IXFA 2YVUA 4J0QA 3SU8A 1G6OA 4KCGA 3VX4A 1IJEA 3BBPA 4AK9A 3SDZA 5FPSA 3SFZA 3A58B 1PZNA 1U8YA 3VNVA 3FFBA 4V0KA 5AUNB 2WAYA 1CJKC 2Q9AA 1GFIA 2V4ZA 3K9NA 4EFLA 1G8PA 2WWGA 3U44B 1OB5A 3AVVA 4Q4JB 1IXRC 2FV8A 3B9QA 3ZS8A 4RD0A 1M1YE 2F43A 3HJNA 1NN5A 1VHTA 3B82A 4N1AA 2ZJBA 2GCOB 4LJ6A 3VR6A 4RFVA 1MR3F 1WRBA 3CM0A 2RGBA 3GLHA 3L0SA 4I81A 3PUZA 1ANKA 2QSYA 3UG7A 1LF0A 3B5JA 3K70C 2IYSA 4BFSA 2O8BB 3AB3A 2WSSD 3I61A 5JECA 2FH5B 2JLSA 4LBZA 1P62B 1IJFA 5FUYA 2R6CA 1KAOA 2ZJZA 5FBLB 2K5UA 2ATVA 3TJZA 5JHHB 3GLHE 3EX7C 5H8WA 2A5YB 4LYHA 2FSGA 1YE8A 4Z8XA 1Q21A 4JLJA 1XCPA 4JSTA 4JZKA 2CVHA 2QGNA 4M4SA 4NDZA 5CM9C 4IHQA 1ZMXA 3LBNA 4DCUA 5JCZA 3LLUA 3QBVA 4JLAA 1XX6A 4A0FA 2YC4C 1Q1QA 2BMDA 2GRJA 2ECKA 4Q00A 4UNSA 1YZTA 4BUJA 4II7A 3B8HA 3GLGA 1DAHA 4M1KA 1OHHA 2J0QA 1VIYA 2X8AA 4LHWA 8OHMA 5FL3A 5JWRA 4DB2A 5FBQB 2PLFA 4JJZA 4TQUS 2WMNB 4F91B 2REOA 4MGKR 2ORIA 2Q3MA 4D0LB 5JRJA 1GDDA 3RC8A 5JFGA 1CR1A 3GLGE 2FZ4A 3F8TA 4A92A 4M8NE 1TMKA 2DB6A 4ILEA 4W5JA 1ZU4A 2ZRPA 2FPKA 4EPXA 4AC9A 3JVUA 3GJ3A 1FUKA 1H8HD 4KV9A 2G83A 3O8CA 5FOUA 2YYZA 4US0R 3K0CC 1X8KA 2ZRNA 3VU9A 1W5SA 2QRZA 5AJWA 4LSGA 4WZAE 3R7WA 1SKQA 4X8OA 3DEFA 4KYIB 3IIKA 4CZ2A 4C0LA 5DNYB 1ZINA 3PUVA 4JBWA 1XBTA 1E99A 1VCMA 5G41A 2IW3A 4D81A 2DYKA 5JI2E 4D4MA 2F3TA 4AURA 3VHLB 3K70D 3QG1A 2F1JA 4OQNA 2J3EA 3AV0B 2TMKA 3KJIA 5C2JB 5JRZA 4FCTA 3AGQA 3G0HA 2HCJB 1KBEA 1G17A 4JLNA 3K0AB 5AJYA 4BASA 3KJEA 4HAYA 1E4VA 3CZPA 3DZDA 5FR1A 1F60A 2ZJ2A 4AD8A 4B74A 4DCTA 4ZKEA 1R5OA 2J41A 2UVQA 3VKWA 1G7RA 4NTZA 1E2QA 1Z29A 4QFMA 2ZRKA 1TF7A 4B73A 3FTQA 2QBYB 4TTQA 4RSGA 5KNDA 3GJ0A 1Z22A 1Y63A 4DZZA 1P2SA 2NO6A 1LF5A 2DWQA 3TRFA 3ECCA 4JVNA 2B8TA 3OAAD 4Q5IA 4PPFA 2XAUA 5JSZA 2VRWB 4KITB 5KSYA 1KNQA 3TMKA 1CKEA 3T1OA 4TZ0A 3M0EA 4TWZA 2J45A 4GBMA 4KFUA 3IDQA 2ZI3A 1KI4A 1EXMA 1CJVC 1JEEA 2ZE5A 4ACAA 1GIAA 1MRSA 3OEHD 5L8VA 4B3GA 1XTKA 2CK3D 4MQBA 4A0GA 4NHOA 1E2EA 2GJAA 1W46A 2AKAB 1UDWA 2ODEA 3C7KA 2C9CA 3PFIA 3SYLA 2XX3A 3R8CA 2YNMA 1M34E 1QHHA 1DVRA 3M1IA 4RZXA 2G9NA 1IY0A 2IT1A 4IOLA 3CXLA 2BC9A 3D3QA 5L3SB 4DJTA 1P5ZB 2RMKA 1N0VC 2QORA 2QAGB 2VLIA 1U8ZA 3SEAA 2OBLA 1FX0B 2Z4RA 4PAOA 1Z0KA 4RZ3A 1ZNYA 3HDTA 4KJZA 1ZNXA 2PZFA 4FMDF 1HV8A 3RLFA 4TLDA 3I1FA 2CLCX 4U5XA 3QF7A 4FINA 1KI6A 1II0A 1NLZA 1D2EA 4U02A 2J0SA 4PR0A 4DLUA 3OIYA 2J87A 4B3BA 5B58C 2ZR0A 2EYUA 2JCSA 4D2IA 2AN9A 2F3RA 1CTQA 3K9GA 3T34A 1XPRA 1XMJA 4BFUA 2XZPA 3NH9A 4KBGA 2BM0A 5AJZA 4YLGA 2UZ3A 1YHNA 5KNCA 5B2ZA 3BFXA 4C3ZA 3NXSA 5IK2D 1UBFA 2G1KA 3BAFA 3VMFA 3GMTA 4M9ZA 1RIFA 4DDWA 2OILA 1AQYA 1SGWA 3W8NA 1TF2A 4IXNA 4PO8A 1SHZA 4D25A 1E0SA 2Z5FA 4TT3A 1J99A 3D6TB 2ZSAA 5F9HA 1J2JA 1SXJC 3LV8A 3T12A 1JBKA 2RGNC 3UKDA 4EIWA 4LV8B 4GL2A 2ZS8A 4POAA 4QM7A 5BN5A 1OXSC 1OH6A 1KO7A 3V4FA 1JNYA 2D06A 4LJ4A 5LB2A 3PG5A 1B23P 4IXMA 1KKMA 1N5JA 4PHGA 4LJ8A 1CP2A 1DELA 3REFA 2QM7A 1SKYE 2HDNB 1QHNA 3DOEA 3X2SA 4NCJA 4GPTA 5DLQC 1AGRA 4TL8A 1ZD1A 2QQ0A 4OHZA 1E98A 1WQ1R 5TV2A 2ZJAA 3GLFA 2PBRA 4KHZA 3B60A 3NG1A 1P2VA 1XP8A 2VHUA 3MMPA 3MRSA 4HLCA 5LD2B 4Q7JB 2KB0A 5HPYB 3AUYA 2ONJA 1HE1C 3W5IA 2BCGY 3SJBA 4KBFA 3ICQB 4DXAA 2GXQA 3RANA 2IWHA 4RD2A 3TQCA 5FBVB 2PJRA 1IN6A 1X6VA 1W44A 3T06B 2OT3B 5A0FA 4JT4A 4IEIA 1KI7A 3QKUA 4AWXA 4ZCIA 2ANCA 2ZRAA 3EPJA 1VYUA 3JVVA 4PO9A 4B3CA 1G3MA 2L0XA 4TLBA 4AG6A 1W1WA 5CIWA 1VYTA 3BB1A 1JJ7A 4MYTA 4OJQA 1AQUA 4DVGA 1JAHA 2DR3A 4ZIRA 2CCGA 1ESNA 4TL7A 1A4RA 4ZDKA 4MKHA 4ZO4A 3BH7A 1UKYA 1SVMA 4NE2A 1L2TA 4US1R 1CF4A 3DM5A 2BV3A 3QQ5A 3UGDA 3CRW1 5E4FA 5J4YA 4MKGA 2GJKA 5HKKA 3HU1A 4XD7A 1OT3A 5FPKA 5CITA 2XTZA 1NBMD 1TTTA 3I62A 3AGPA 2NMVA 1E9FA 1SXJD 2NZ8A 3NEYA 2IUSA 3EARA 4UNRA 421PA 1SHKA 2W2VA 3SE0A 1CXZA 1SVOA 4P4SB 2GZDA 4LOAA 3QVUA 4BFTA 1T3LA 2V7QD 3TGPA 3U2QA 5DIFA 1W0KA 3N2EA 4JBXA 4GT1A 2C2HA 1G64A 1SZPA 2GTPA 2WKQA 5GJCA 4XSGA 3ND9A 3NVAA 4MRNA 2QT1A 2ZJ5A 1JALA 3KTAA 5G53C 1E0KA 2A30A 3EZFA 1S4QA 4HYYA 5EP4A 1E9DA 3OFND 3UMFA 2DWOA 2VPPA 4AKIA 2RGNA 1W2GA 4KVGA 5DI3B 4JJKA 2GEUA 2NO9A 4CRWB 1PVOA 1KJZA 2FNAA 5KDDA 4MYUA 3OZXA 1ZM2A 2VHQA 4OQMA 1RFLA 5KYKA 4I1OA 3AKEA 4KI0A 4KFSA 3Q7QA 3THYA 2ZI6A 1KY3A 1AZSC 1SXJE 4UXJA 3GLIE 3PEUA 3NHAA 1KO1A 3CRRA 1L7VC 3CRVA 4DEYA 5DN6A 2H16A 3RWMB 1GUAA 4A0HA 3ZS9A 3QPVA 2EWVA 1R10A 4MYCA 3FYHA 3L8ZA 3VQTA 4IOJA 2EWWA 4AKEA 1NMXA 2ZI7A 1BMFD 3CPEA 3GJ4A 5KDOA 4HUQA 2CL6X 3QXCA 4PQYA 4JLVA 4Q47A 2BEJA 3RWOA 2R8RA 2PH1A 2JA1A 4MH0R 4YC7A 4JLOA 5AJXA 1D6JA 3ZGXA 4TYNA 3RSLA 1N0UA 1Q57A 1A82A 4ARZB 1AKYA 2CL7X 1NKTA 2REBA 3LLMA 2ELIA 5FOXA 3AF1A 2O8DA 2OLKA 3T1QA 2PCLA 1IONA 2ZTSA 1GVNB 4FIDA 1N6RA 1P4SA 5FTJA 1WBBA 3CX6A 2ROWA 2ZVQX 4UNQA 3UATA 1PUJA 1CRPA 4H9GA 3FHTA 5D3QA 3WNDA 1DAEA 1KMQA 2YOHA 4ESVA 4TYWA 1EFUA 1TU3A 3AQ4A 3EZ2A 3P1JA 1OW3B 4YDHB 4EFMA 5G3ZA 4IDOA 4MDEA 2CL0X 4PTLA 2ZI9A 3AVOA 3LQRA 2NO0A 1F2UB 1NJGA 3B85A 2F43B 1NVUQ 3FMPB 1JB1A 3K8YA 2QQEA 3UFFA 1JR3A 4B34A 5KUTA 4NBSA 4OI4A 2ZUCA 2ZS9A 4DSNA 4GOXA 3SHWA 3HWSA 3GLHB 3AUXA 3HR8A 1H8ED 2ONKA 1RVDA 4LCBA 2ODBA 4Q03A 2W2XA 5P21A 5TVKA 2XB2A 1VHLA 3QBTA 2ZRGA 1OH5A 3QF4B 4K81B 4EQ6A 2YOGA 1KI8A 2BVNA 1TUIA 2ZR9A 4GFDA 1VG8A 4JVSB 1E1RD 2JLYA 3LD9A 2GXUA 3CKLA 3U4QB 2Q3HA 4HI0E 3WHKA 1U94A 1NG9A 1PLLA 4O0MA 5GVSA 4TZ6A 3FOZA 3ZD6A 4EPYA 1D5CA 3NTUA 5BW8A 5C1BA 1E2HA 3N70A 5FTKA 3UXMA 3WBJA 3KB2A 4WVFA 3MCAA 3E1SA 2I1VB 3I8SA 2PZEA 2MMCA 3MWKA 3GEEA 1E1QD 2KBFA 1JR6A 3WXMA 1RJ9B 1XJ0A 2VSFA 3MWLA 1P6XA 4A4DA 1MO6A 4NH0A 1D8TA 4LPSA 2O8FA 3X1ZA 1T5LA 2DFTA 4EFNA 1GKUB 1QVRA 4Q4HB 4QC2A 4TSFA 4B3FX 3PENA 3AM1A 2AL7A 1ZNWA 1FQJA 2QTHA 3AVPA 4CEHA 4UJ5A 1LY1A 1BS1A 5JS8A 4AIIA 4RCZA 5EE0A 4DLZA 5CDFE 2D62A 4TQ9A 1KKLA 3BFVA 1KK3A 4E22A 3B78A 3ZJYA 3EW9A 2WJHA 3TAUA 1COWD 3CR7A 2X19A 1M7HA 4BLTA 2LCFA 3I5XA 1GILA 1AIPA 1UDXA 3ZQ6A 3ICEA 5L3QA 1P73A 4Q4AA 1TX4B 5J47A 2ZUBA 2H17A 1ZBDA 3FGNA 2E1RA 4RD1A 2V55B 3DMNA 4JKYA 2QT0A 4M1SA 3V00A 1KAGA 4ASUA 4FCWA 4O2LA 2F9MA 3L82B 1N25A 2JJ1D 3CRQA 4FCVA 3SFVA 2PEZA 3ADBA 2X1VA 2YV5A 1DG3A 2W6ID 1E9CA 2NQ2C 3BH0A 3O8DA 3EXAA 2WJJA 1GNQA 2HUPA 4FMCB 5A4JA 2IEZA 3ASZA 3I32A 2AK2A 4PQFA 1GL7A 1Z08A 1KMHA 1E79D 1Q0UA 2V6JA 4XSHA 1CULC 4CIDA 4GMDA 1EFHA 1H65A 1II9A 1TEVA 5HTKA 1MOZA 4MKIA 1NY6A 4DSUA 1E96A 1HYQA 4TLCA 2J46A 4KLNA 2WIAA 5BQ5A 4MRSA 1QVAA 3R20A 1FMLA 2OBNA 1PTRA 2V9PA 4MUBA 5AUPB 1CIPA 4XVUA 4F93B 1XA6A 4UXIA 3QXHA 2FOLA 4XOIA 5CLLA 4BZXA 3X1YA 4UJ3A 3K70B 1A5TA 3U6BA 3ZIAA 2GK6A 1G3UA 3SYNA 4OQLA 5DSZA 3SBEA 1Z06A 5FI0B 4S35A 2V1XA 3LX5A 3BOSA 4DB4A 4R9UC 1AZTA 4UXHA 5FOTA 2DB3A 5HE8A 1EFRA 2ZETA 2IL1A 3W5JA 3QJYA 1W7AA 1OPXA 2IUTA 4HB4A 5D3MB 4B6DA 1GAJA 1OSNA 3W3ZB 4R2HA 2OG2A 2ENNA 3IEUA 3K9LA 1OXXK 1EX6A 4QGGA 1G7CA 2A5GA 3A1TA 2WMOB 4LRWA 2QSZA 4G01B 1NY5A 3H84A 1EK0A 4BRUA 1M8PA 3CB4A 5AUOB 2SHKA 2ZM5A 2G1JA 3AVXA 2BBWA 2WIBA 1JAIA 4YXWD 5J4KA 2JDID 3KJHA 4LJ7A 2W58A 2O0JA 2IS6A 4W9MC 4GOKA 5EZ5A 2VHTA 3CPHA 5FFMA 3THOA 4DSTA 2C78A 3D31A 3QKRA 1TEXA 1K5DA 1KI6B 2RB4A 2ZPTX 3KKOA 3EA0A 3QEOA 3UANA 3TR5A 3AP2A 3PXGA 2FA9A 2WZQA 4IDPA 3ZVLA 1E2MA 2C5LA 2HJGA 4HDCA 4JL8A 2HF9A 2OCYC 4LJYA 3LDAA 3NBZC 2V3CC 5DYGA 2WWXA 3BRWD 4JIMA 3WMEA 4FWTA 3RSOA 2NOAA 1KDPA 3KQKA 2ZYWX 4LV5B 2CHGA 2GBLA 2XNDA 3OEED 3PEWA 2XOKD 2CCJA 4OI1A 2NO7A 2GEVA 3GJ8A 1RKBA 3E2IA 2J7PA 2UKDA 3IPYA 1E2JA 2ZXUA 1G1MA 3N5CA 1SKYB 3U7EB 5J5CA 5DGXA 5C4GB 1HUQA 1ELOA 4B3DA 2VSOA 3F0TA 3KZ1E 3QOFA 4C0SA 3DOFA 3W9YA 4IVQA 4P33A 1FPMA 2ORVA 4BPBA 3B1ZA 2R6GA 3FMOB 4YMWA 1IM2A 1Z6XA 2ZRDA 3C5CA 3Q72A 1SVWA 1TUEA 4R98A 2FEMA 2W83A 4HEJA 5GJWC 1GKIA 3T61A 1LVGA 1XU4A 2VH5R 3QKSB 4LYFA 3BJIA 3QY0A 4LJ5A 3FKSA 3RS3A 1X1RA 3LQQA 4A9AA 4IOMA 1A7JA 3VFDA 2HF8A 4TQAA 2DBYA 2REXB 1OF1A 3HU2A 3TUJC 4ZI3A 3H4MA 1W4BA 2J0UA 4G5OA 4O3MA 1XZQA 4NYIR 1VG0B 4NKRA 2E9SA 4LJAA 1ZM9A 2WKPA 2IWRA 1EFCA 2HYDA 1M74A 1JQJC 1W48A 4JVLA 4BGDA 1II8A 4WZ6A 2HEIA 2CLDX 4M9QA 1IN5A 5EJEA 5FPYA 2JIZA 3LRPA 4ZCLA 1AK2A 1WBDA 4L15A 4M22A 1Z63A 3G5UA 1DS6A 2ODWA 4DSOA 5EUQB 1FNNA 1RRFA 3QXSA 4QGAA 1ZUNB 4NCNA 4EPRA 5E7MA 2WJIA 1MKYA 1OV4A 1EG7A 1OHHD 1K5GA 1W36C 2OXCA 4B6FA 1G7TA 4OHWA 5L3RA 2RGEA 2D3WA 3DPUA 3PUYA 1SVIA 4WAUA 2CBZA 3UPUA 2WBLC 4IVPA 1G5PA 1Z28A 2GKSA 1KSHA 2GILA 2JASA 3U5ZB 2OM2A 2I4IA 1CRQA 4PAMA 1OXVA 4URZR 4DCVA 5H1YA 4PPNA 3R9IA 3KQNA 1OFUX 2EFCB 1R8SA 4HLUA 4UNPA 5TDHA 1XD8A 3TIFA 2XXAA 3NDBB 1I4TD 4G5GA 4BEBA 1BOFA 1Z2AA 3AP3A 4LDJA 3C8UA 4Q9LA 1G7SA 1XD2B 2EW1A 3B6EA 3UMSA 4OHYA 2P67A 2CE2X 1XB2A 1W47A 2GZHA 4TL6A 1SXJB 2XZOA 3GLIB 1Z0FA 2ZR7A 1DO0A 4NCIA 3C16C 1Z6GA 3A37A 4IVRA 1R0WA 1RRGA 1MT0A 1DADA 1FP7A 2WJVA 5E7IA 2PEYA 4P0TA 1LB1B 4PAQA 4E07A 5E3HA 4C9BA 1XF9A 4FXPA 4P32A 1FW6A 1O87A 3K0EA 1P9NA 2NO1A 5BN4A 1JEDA 1VG9B 3L0PA 3T15A 2BM1A 4A2WA 4G5RA 1E9SA 1FTNA 1XNJA 2ZJOA 5JEEA 1M7GA 4L9WA 2G6BA 3E70C 4LI0A 3GD7A 1Z07A 1KSGA 2ZUDA 3AF0A 4HDQB 1UBGA 3RS5A 1NMZA 1N6NA 4C7OA 4G3XA 1OIWA 3ZVMA 4IW3B 5FPHA 4ZV4A 2IYRA 2A7QA 3K0SA 1T5IA 2A5DA 2VEDA 5KHOC 4HUQB 1AJEA 4OQXA 2FPMA 3IIJA 2OV2A 4C0KA 1E94E 4JL6A 5KSZA 2O8EB 4CEJB 5FBWB 3SS8A 2JLXA 1N0WA 1W36D 4BFXA 1OB2A 5FPTA 4KSCA 1GRRA 4D82A 2W2TA 4ZDJA 4LBVA 3EWAA 3C4JA 1Z8FA 2HCBA 2NPIA 2F55A 5KSOA 2C98A 1J8MF 4X8MA 4C4PA 4EJSC 2ZI5A 2WSMA 2O8CB 4HUTA 4ZCMA 1R2QA 2RGAA 3ZZ0A 2VTKA 2HLDA 1KDRA 2WV9A 1U9IA 3TSZA 2ANBA 5EXSA 5EE5B 2QPAA 3PV0A 2AWOA 4RKEA 3EZ9A 1Z0IA 4M53A 2ZRLA 3DVLA 3GPLA 2VIIA 3LX8A 1MRNA 1MV5A 3B13B 5EXPA 2OCPA 2D2FA 2VO1A 4QJ4A 4B48A 1UKVY 1ZD8A 1XEXB 4HSEA 2GJ9A 4RZUA 2JJ2A 1XPUA 3MWYW 1KK1A 2VP9A 2WKRA 3SQXA 5DH9A 2YWHA 3TVDA 2ZJ8A 2RGGA 1U0HC 4BFWA 1AGPA 2OFXA 2HT6A 4MGYR 4NPHA 4URUR 3CIOA 1UF9A 4TMTA 4B35A 2VF8A 4A8JA 2Y8EA 2H18A 3TE6A 1W49A 4RFSA 4BLSA 2ZS7A 3ZYCA 1Y3AA 2IF0A 1KOFA 4TTPA 1WDTA 2QGZA 1XMSA 3K0FA 1DAFA 1Z83A 1Q12A 2Z43A 2J1LA 2KSQA 2QM8A 3NH6A 2VQSA 3ADCA 4G1UC 1G3RA 3CX8A 2EYQA 4M2LA 4TT3D 2BMEA 4D6PA 4F38A 4F4JA 4URVR 2PT5A 1J90A 2ZYUX 1IXZA 1YKSA 1ZCBA 1KNXA 3A1VA 3IUYA 1IQPA 1J8YF 4RD6A 3PVSA 3RC3A 1OXTA 5DI9A 4A0RA 5HR5A 3DKVA 2OFOA 4NCKA 3GJXC 3O8BA 3GFTA 4MDFA 3B9PA 4XWAA 3FHOA 1LTQA 2X77A 2VA8A 4DCSA 4K46A 3UGLA 3BORA 1CS4C 4QHSA 1IBRA 5LBIA 6Q21A 1KHTA 4LBWA 1R0ZA 4M0LA 4YMSA 3QKTA 1TPZA 2UZIR 5HCIA 1T0JB 1GWNA 1YRAA 3BWDD 4AG5A 4PZYA 4B44A 4C0HA 3Q5EA 2NIPA 2EU8A 4D4LA 1HQYE 2FGJA 4X8LA 4LUCA 1X8LA 2FFQA 2VP5A 2WWWA 1US8A 3PITA 2VP4A 4HZUA 3BIFA 2AXNA 3WY9A 4BWYA 1YVDA 2J7KA 3HPRA 3U6KA 3QSYA 4EPWA 3THXB 3Q3JB 1NLYA 3IIMA 2P2LA 3TW8B 5F98A 3WBKA 2ZRCA 4Q9HA 4BFVA 4OI0A 1EWQA 1LNZA 1IY1A 1CR0A 5B57C 3EWSA 3DKPA 1XMVA 3S1AA 4C0BA 1IN4A 3LXXA 1BYUA 4LX0A 2OESA 4Q66C 4A2QA 1CEEA 1YZNA 1G8HA 4M1OA 3BS4A 4WIAA 2QPOA 4EJSA 1NI3A 4IDHA 3PEVA 2QRNA 1GL9B 4CT5A 1OJLA 1G4AE 1ZD9A 1G5RA 3OE7A 3SOPA 2WWFA 4DDTA 5DHFA 1KMHB 1G5TA 1UM8A 4V0MA 3WP1B 1P3JA 4JSYA 2GJ8A 4GOJA 3P4YA 1E2IA 3D8BA 4CEIA 5JWHA 4CGZA 4FW9A 1U90A 2LWIA 4MRVA 3GLFE 3E5HA 121PA 3QVVA 3VR5A 4Q19A 4XIGS 1G19A 1XTQA 2GHIA 1KZ7B 1Z6TA 2NTYC 3CO5A 4A2PA 1ZM3A 4YQFA 1ZM4A 5ELXA 4QGFA 3FE2A 2AWNA 2H7VA 4Q4JA 3O8RA 1DAIA 2XB4A 1A2BA 5JLJA 2P5TB 1G18A 1VG1A 5HKKD 4V0ME 1N6IA 2FWRA 4JS0A 5KDLA 4XD7D 2ZE8A 5FL7A 2LKDA 2GCOA 4HAUA 4NYIQ 2XZLA 1FMJA 4FWIB 1VTKA 4IEEA 1OFHA 4TLEA 2OEPA 1C9KA 1MH1A 3WRXC 2DFNA 4W5HA 1XPOA 2O8BA 1GRNA 1UKEA 1W0KD 3NDPA 1P2UA 2GCPA 4DT1A 2XSZA 4MKFA 1CU1A 1E32A 4RD4A 1R79A 4P3YA 4LYJA 2RGXA 4PSKA 3THWB 2CEAA 3OF5A 2AKYA 1ZNZA 4AKGA 1AS2A 1E9AA 1S2MA 1ZM7A 4JMPA 4NYMR 1NIJA 3B2EA 4LGMA 2R6DA 1OYWA 2YC2C 4QOSA 5J4VA 4ZDIA 3C41J 5EUMA 5EE3A 3TLXA 1WF3A 1Z0DA 1OKKA 1L4YA 1W0JA 2I3BA 3QKRB 5AK0A 2FU5C 5FTNA 3CWZA 4OHVA 3LA6A 4XTCS 1E4YA 1TADA 3ZLJA 3M4YA 2EVWX 3RS0A 4B71A 4DC9A 5DN6D 5E95A 2LKCA 4XVRA 2DWPA 5DO9A 2FFAA 1NJFA 2RGCA 2OAQ1 3FMFA 3RDPA 1GNPA 4LBYA 2GVDC 2WPDA 1Q1ZA 5G3YA 2O0KA 4US2R 3H86A 4DLWA 5FI1B 3A36A 4R2IA 4CVNA 5CIQA 1G8YA 4C0AC 1RYFA 4A15A 3DM9B 3CRMA 3KXKA 2BDTA 5HCNA 2QAJA 1Z5ZA 4DLTA 1UBCA 4EPVA 3GFPA 1T8UA 2F1IA 3KUDA 1JI0A 3NEJA 1UKZA 721PA 4HAZA 2YOFA 4MA4A 4RVCA 1G41A 1NVWQ 2WM9B 2XNSA 4DKXA 1PV4A 4E09A 3VKGA 2VSXA 5BYKA 2BBSA 2F9LA 3LVRE 3ADKA 4FD2A 3TBKA 4LHXA 4PO1A 1JR3D 4H1VA 4TMZA 4OBEA 4Z1MA 3SR0A 3ZZUA 3PJRA 2ORWA 1QRAA 1ZW6A 1DAGA 1VCNA 2FF7A 4GP7A 1GG2A 2PMDA 4BRWA 2HT1A 4YMTA 2RHMA 2E87A 2C8VA 3K0AA 1ONBA 4DHEA 2Z4SA 2GDJA 4TTRA 2NG1A 4MGZR 5TB5A 2J9RA 3TK1A 2EFEB 3RRZA 4NP6A 3NBXX 3WYFA 4N3NA 1Z3IX 3IEVA 3KL4A 1XXHA 3AKDA 2YWEA 3A4NA 3VR3A 2BBOA 4L16A 2V54A 3QXJA 3ZH9B 3ZQJA 2FSIA 1F6BA 4LJ9A 1KI3A 4LK2A 3A4LA 1KO8A 1FNMA 1L4UA 3L0OA 2ZAMA 1E3MA 3UIEA 4C0QC 5JHGB 1WCV1 3HYRA 4DIDA 1W4RA 2OHFA 1SQ5A 3DL0A 4MRPA 4RZ2A 1ZYUA 1JR3E 2IYWA 2ZYTX 2A9KA 4XH9B 1Z0AA 1XXHE 2QN6A 1FTSA 5BYJA 1HT1E 2WJGA 1NN0A 3P27A 1I4LD 2YUUA 4AYWA 4DLYA 1KDTA 2IYLD 4TSFD 1G21E 3CH5A 2NGRA 5EP3A 2QNRA 2O5VA 1Q3HA 2YKGA 2P6RA 2FG5A 5L3SA 1E9RA 4PANA 1NLFA 2QAGA 1T9HA 1LW7A 1FX0A 2H1LA 5KOYA 4D0GA 3EZ6A 3KB1A 5F2EA 5KPDA 3GLGB 4HZIA 4IJMA 2RKOA 1SVKA 4D4JA 2EFDB 1T91A 2QE7A 3OIWA 1T8TA 1G4UR 1FARA 1E2LA 4V02A 4NU0A 4KXFB 3LAWA 5JJLA 1GKYA 3F5FA 3GJ6A 2X2FA 2KWIA 1ZAKA 2GWHA 5GVRA 4ASUD 2QP9X 4Q7LA 1E6CA 4KU4A 1VECA 3LBIA 2YINC 1TBNA 5CLQA 2MSCB 3FHCB 2FN4A 1D2NA 2GJSA 4D80A 2C9YA 2KE5A 5EXTA 4M1TA 2GBLC 3AF2A 3U3KA 4E03A 2C03A 1CLUA 3Q7PA 2IS1A 2OBMA 3NWJA 1QG2A 4EPTA 1Q1BA 1YR6A 2R62A 3VU9B 1LV7A 2PZGA 1R7RA 4IDQA 3R7WB 4B75A 2VP0A 2QA5A 3M6AA 3K9HA 5ANRB 2CNWA 2G0TA 3KKMA 4Q21A 2VHCA 1XCGB 1E0JA 4A82A 3OIUA 1NF3A 1ETUA 3MUFA 1YR9A 3EG5A 4C7OB 2I1QA 1U81A 2P0EA 3GJ5A 4QL3A 3ZIAD 4DIEA 2OO7A 3DZ8A 5TXGA 5FR2A 4FI3C 5EE9A 1ESMA 2N1BA 2WVJA 2VBCA 1XTIA 4V0LA 2FNFX 1YJ5A 3KXLA 4BLOA 621PA 3ZVNA 4MUAA 1R8QA 3P26A 2GF0A 1EFRD 3O47A 1CBUA 4JBYA 4LZZA 2IBMA 4TMXA 1U99A 2ZYVX 3BJIC 4QJ5A 2OCAA 2VP6A 4ZKDA 3VR4A 2JLUA 1GRQA 3LFUA 4ACBA 5JSZB 3BB4A 2QUZA 1IN7A 3QXXA 1Z6AA 3KY9A 3GJ7A 1YZGA 3K53A 5CYPA 3F3YA 3CONA 3RAPR 4ESHA 2FDCA 4HAVA 4PZLA 2IYZA 2GAAA 2Q9BA 1G291 2ZRFA 3IO5A 4RKFA 2IXGA 1W36B 2B7CA 2BCJQ 3T5GA 3G82C 5JEDA 4V0NA 3WNCA 5K8TA 1MABA 4JKIA 4OHXA 4TYYA 1FUUA 2CJWA 4G5QA 2H5EA 1F3OA 5JJIA 2JGNA 1KSJA 1DG1G 1QHHB 3CF6R 2W6JA 3VKHA 1QBKC 3AVQA 4QKQA 1T3HA 2A5FA 2AXPA 1QHIA 2QY9A 2KBEA 5C46F 4UQOA 2AX4A 4R71A 1XEWY 4Q1AA 2V1UA 2D2EA 1FL9A 4LYAA 2XNDD 3PIRA 1KZGB 2KJQA 1KJYA 4RFSB 1YR7A 2X2EA 1TL7C 4CT4B 4W7SA 2J7PD 2VP2A 1UEJA 2FE4A 1S96A 4M1WA 3I4LA 4P4SA 2IYTA 4NZYA 3QEJA 4QG7A 2CXXA 4EKDA 5F3WB 5AWFC 5FUXA 4HLUC 4PQRA 2J59A 4PPGA 5TY0A 3U3RA 3QG5A 4Q48A 1P72A 1F2TA 2V8OA 3Q9LA 4URYR 1DAMA 3QPWA 1YZQA 3UGIA 2ZROA 3PUWA 4TMVA 1NNEA 2GAOA 2OCBA 1RFHA 3VX3A 5KU1A 2DHRA 4K8OA 2J5XA 1HEIA 4FMDB 4Z8YA 1IY2A 3CZQA 4I99A 4L5BA 3AVTA 1US8B 3H1TA 2OAP1 1CJTC 3FKSD 3GFOA 4M1MA 1VCOA 1ZUIA 1ZUHA 3CNNA 3VHXA 2QTFA 3V4RA 3A4MA 1P9RA 1XFAA 3R9WA 4I1VA 4BFYA 5FUWA 2OLJA 3DMDA 3EPKA 1OH8A 2D74A 2ENZA 5FOSA 2QP4A 1RYHA 1U0LA 1ZC4A 5FOVA 1V43A 3EIQA 1UAAA 3TSWA 3GQBA 1FOEB 2WOOA 2VYFA 4W5WA 5AR1A 4F92B 1XDBA 4DLRA 4L9SA 3TAHA 5LPNA 4B47A 3UMRA 2JIZD 2A3RA 3GLFB 1UEIA 3P4XA 1N6OA 2WWIA 2WHXA 3EA5A 2Q3FA 4HLDA 2EFHB 2QMEA 4BFZA 1WP9A 4ARZA 5DISB 4FMBB 4QBIA 5CJ2A 3RS4A 2FSFA 2NZJA 4DLVA 1DO2A 4OL0A 1ZVQA 1ZIPA 4DUGA 4CEIB 2VF7A 2HXYA 4WXRA 1G16A 2P6NA 4MGIR 5EP1A 1GTVA 4Z51A 3SJZA 1N6PA 1GITA 1WA5A 1BH2A 1PLKA 4OI2A 4PC2A 3X1XA 5GJBA 4F4CA 1F48A 2QZ4A 1F2UA 5SZIA 1QG4A 3LNCA 4NMMA 1Q20A 1S9DA 4Q7KA 1AA9A 1U9IC 1W4AA 3KQLA 2R6FA 5KPJA 1KI1A 1DARA 5JS7A 1HE8B 2ZE6A 3IBYA 4DBLC 4NYJR 2YJTD 5IF9A 4ZIRB 1YRBA 1E9BA 3B1YA 2ZRJA 1DBSA 2RAPA 3UK6A 2AFHE 2QROA 2QMUA 4AYTA 3RNLA 3U7HB 5K8IA 4KYUA 3VR1A 3QF4A 2FSHA 2MSEB 3H0KA 1Q22A 1N5KA 3MWJA 4DT1B 4HB3A 2XGJA 3AEZA 3X1WA 4TYPA 5SZHB 2CCKA 4TN1A 4D0NA 3U4QA 3Q85A 4M9XA 2BHRA 4G5SA 2ERXA 4Q1DA 2ZIAA 1E2KA 3AKCA 4A8JC 3UG6A 3A6PC 2PJZA 4I4LA 4KFTA 4LHZA 4M1YA 3CNLA 3VTKA 5K8UA 3U7FB 1TAGA 1W4CA 2QI9C 2R6AA 2WSSA 2BMFA 1XTJA 3LW8A 2BJWA 2FEOA 2VHJA 1QHYA 4KSBA 1MO4A 5CB6A 4B76A 5C4MA 1QHGA 1LS6A 1RJ9A 1EWRA 2ZSFA 2ZRHA 3KTAB 2F6RA 2A78A 3BFKA 4B3XA 3GEIA 5CB8A 2OSBA 1G3IA 4WZBE 5B64A 4Q4HA 4YONB 1NG1A 2AFIE 3U3MA 4DDUA 4D26A 3QNUA 2WAXA 3ONWA 4NL4H 1BO6A 4QNMA 1UFQA 1NP6A 1B0UA 3L2OB 4YDSA 1X3SA 4Q01A 3VAAA 1CJUC 4FMCF 3W8RA 1OFTA 3EZ7A 3NC0C 3THYB 1N6HA 1UJ2A 1KI9A 2Z83A 2BBTA 3TVTA 3W3AA 4U00A 3BH6A 3QI2A 1KJWA 2P65A 3A1SA 3AVUA 3IO3A 1XJQA 1J70A 2ASEA 1QHSA 5J4LA 1AS3A 1AKEA 5KSPA 1DTSA 2R65A 2KI5A 1G9XA 5FBRB 5BWMA 1DPFA 1GSIA 4DRZA 4A36A 3SJAA 5H68A 3I8XA 3AVYA 2ZEJA 2HLDD 3L43A 1L8QA 1Q1EA 4O25A 1RC8A 2W00A 4PHFA 4O2RA 1M7BA 2Q0HA 3FWYA 4RJLA 3RRYA 4D4KA 3EPLA 3EIEA 5EP2A 5AUQA 4DEXA 3IQXA 4DLXA 3SN6A 1HURA 4BQSA 3AKYA 2O8DB 3B7GA 4B2PA 2P6UA 4PSAA 3DDCA 2JLVA 1H8HA 4TMKA 2JJ2D 3A1WA 4YMVA 2ZSEA 3EC2A 4KODA 4M9SA 1VKJA 2FFBA 2QU8A 1S8FA 1OIXA 2BWJA 3ZDQA 1R0YA 1TQ2A 1SVSA 2G3YA 4LHVA 3LO5A 5G40A 5GJVC 4IDNA 1TBOA 4PPQA 1JECA 1T3SA 2YWGA 3RVBA 3TR0A 5SZKB 2IS2A 5EXXA 3V9PA 2IA5A 2RCNA 2CHQA 4JYBA 1XXHB 4URXR 1YQTA 2O52A 1P60A 5LDDC 3AH8A 1R5NA 1PUIA 1WXQA 2BOVA 4LHYA 1XCMA 3CX7A 2C99A 3IHLA 4EQ6B 2IYXA 3L0IB 4NCHA 4UKDA 1Y8FA 4P31A 2NPFA 4JVMA 1CR4A 3NKVA 5FTMA 3TH5A 3EPHA 1VIAA 2GETA 1NN1A 1CR2A 2MSDB 4Q1BA 4PZZA 5D3MA 2H57A 1G8GA 5JI3E 4L8GA 5GADl 1G8FA 1PJRA 1ZRHA 1T6NA 3ETLA 4G0NA 3U3JA 5EZ6B 3BXZA 1VPLA 2HJVA 4YMUA 1ZIOA 3OAAA 2JLRA 4Y0AA 2XTMA 2QG6A 2ZITA 3B1VA 5HE9A 1N5IA 1EX7A 2P5SA 2Q21A 1K6MA 2Q6TA 2ZE7A 3DHWC 4MYHA 3KJGA 4TL9A 4X8HA 521PA 5TARA 4RY2A 3NHBA 2W0MA 2GCNA 1KYIA 2GXAA 1XEFA 3EAQA 4IFEA 3OEHA 4TLAA 2O8FB 2CK3A 1G3QA 1S0UA 2CHVA 1E9EA 1HQCA 2OXRA 3EC1A 2IHBA 2DFLA 4IOKA 2QP3A 2PLRA 3KDSE 1D2MA 3SQWA 4CEHB 2YHSA 4OK5A 2QMHA 4A6XA 1YR8A 5KO2A 4WBSA 1LFDB 5IHPA 2CMKA 1FQKA 1S9HA 2D7DA 5JZVA 4BLQA 2XTNA 1DEKA 2AHOA 3I92A 1OIVA 1P61B 3CUEF 4BECA 1SULA 5A5GA 3A8TA 2H92A 1D9ZA 3FDIA 3AVWA 5DE3A 5L3QB 4Q4AB 3JZAA 2CLSA 2EQBA 3AF3A 3K0CA 4Q1CA 3OE7D 3FKQA 1E0AA 5CYOA 4TMWA 4Q9IA 4DLSA 1UPTA 2IK8A 3IILA 5IT5A 1EGAA 2BJVA 2ZVPX 4HATA 3C15C 3MD0A 3ASYA 4Q9JA 5H70A 1DOAA 1XMIA 3NBFA 5FH9A 4PXAA 2AD5A 5IK2A 1JPNA 1W2HA 4WW0A 3LY5A 3QE0A 2C04A 3OESA 4JLKA 2OE2A 5FL7D 1NSTA 2GESA 4IRUB 5BXQC 1OLOA 2F1RA 3RS2A 1BIFA 1KIMA 3BE4A 4QM6A 2A2ZA 3LWNA 3BERA 4PC3A 4GSYA 3SZRA 3I3SR 4QBGB 4OYHA 3QKSA 3ADDA 3Q5DA 5EQTA 4R7ZA 1S3GA 2PX3A 5FUVA 2ZQ5A 3U44A 3C5HA 1PLJA 1UADA 2FMXA 3CR8A 4GDFA 3KXIA 1IXSB 1IHUA 2D4HA 2XSZD 4URWR 2HXSA 2B8WA 5LB4A 2J0VA 1ZP6A 4KFRA 2ZRIA 3LW7A 4BEJA 5TMPA 1TF5A 2IEYA 4Q02A 3SHFA 1ZCAA 4H1UA 3KQHA 4OQFA 1GNRA 1BYIA 2ZRMA 1RRCA 2G0NA 3FFAA 3ZVRA 5JJKA 4AY2A 2DY1A 1HT2E 1NL3A 2C95A 4ZDWA 2PMKA 1X1SA 5JCPA 2GZAA 2BIFA 4AYXA 5B30A 1OKKD 1R5BA 1W0JD 1MABB 3AP1A 1J7KA 1V5WA 2IYYA 1NVVR 2CJWB 1IAQA 3MGCA 3L8YA 2VL7A 4TYQA 5IRCD 2R44A 2ZAOA 4QHYA 5FOWA 4PC6A 1C4OA 3MG9A 2IYQA 2QPTA 2WOJA 3CF0A 3NIBA 4NYJQ 3T5DA 4EDHA 3R9XA 1GP2A 4Z54A 3BC1A 1HTWA 2WPDD 3KFXA 3CLVA 3QUSA 5J40A 1P9WA 5IDVA 1AN0A 5CM8B 4XJXA 1N6KA 4HB2A 2P3SA 3OIVA 4PC7A 3T1TA 2QAGC 2D7CA 3CWQA 4GRAA 3K09C 2W0SA 3RS7A 4JLMA 1W5TA 1Z6YA 4JLBA 4KVAA 4PSVA 3IGFA 3RHFA 3W6OA 1XRJA 4PC1A 1NSFA 1RZ3A 2GK7A 1XD2A 2QMOA 1LS1A 4FN5A 3Q8XB 3FVQA 4V03A 3HPQA 4QNRA 1F2TB 1OH7A 4N0EA 3FPAA 4Q4LA 1RW4A 4Q9KA 2IX3A 4PFSA 4HDOB 1YZLA 1MO3A 1NBMA 2A5JA 3I5YA 1SXJA 2GNOA 3GLIA 1T4GA 4Z1MD 3OHMA 3CW2A 3SNHA 1IN8A 1I2MA 3W34A 3VNUA 4QBFA 2R2AA 4C2UA 2F1HA 1FP6A 2V7QA 3U61B 4LV6A 1C1YA 4B2IA 1DAKA 2CVFA 4P4UA 1A1VA 1U2RA 5BN3A 3QIAA 3SBDA 221PA 5F9FA 1E2DA 4AI6A 3B1WA 2WTUA 3UWKA 1F5NA 1NBME 2RH5A 3BB3A 3CPJB 5L3VA 3DO6A 4L9MA 2C96A 2CE7A 2IC5A 4HLQB 3MSXA 3OFNA 4BZQA 2IUUA 3VR2A 2BKEA 4V0OA 4IKEA 3U3OA 4AKHA 3HP1A 2B92A 3TQFA 4ITRC 3IKJA 1YZKA 1KO4A 1X86B 3PUXA 3TNFA 4OK6A 5UKDA 4LY6A 2HYIC 4CEJA 2G77B 4DWJA 2O8EA 1P7CA 1TQ4A 1ZJ6A 2J0UB 2WWYA 1HA3A 2AD1A 3TW4A 3KQUA 4KO8A 1VDZA 2OFWA 4BLRA 2ODNA 2FFHA 2DPXA 2ZJYA 2QBYA 1KSFX 3QENA 2HV8A 2MMGA 1II8B 1BMFA 1VCIA 3WYAA 1A2KC 5AJVB 1Z2CA 2O8CA 4EUNA 1P2TA 2XJ4A 3IPXA 2VRWA 2GVZC 2ZU0C 4PX9A 4GP6A 5LD2C 1Q3TA 2BMJA 1OXUA 2QL6A 4WOPA 1U0JA 2QEQA 5K8LA 2N46A 4QRHA 4ZI2A 3RABA 1ZU5A 4BZPA 1S1CA 1ZC3A 2F7SA 1AM4D 4LWZA 1O3YA 2ERYA 3IQWA 3MFYA 3WHLA 3C14C 2XITA 4B33A 1UBEA 1E2NA 1XEXA 1YU9A 1FFHA 1GZSA 2QE7D 1T0HB 4RD3A 5JBQA 4C2TA 3KKNA 5CK5A 5DYIA 3CBQA 4MRRA 1OYYA 3SI7A 3TUZC 2GF9A 2ZRBA 3X1DA 1XJCA 3KKQA 4P4TA 4Q1FA 4B32A 1KDOA 4HAWA 4NONA 3WMGA 1I4DD 3P32A 2JAQA 3K09A 1GL6A 1XTSA 2ZANA 2PL3A 5CJPA 5SZJA 1KK2A 2XEXA 2GA8A 4QHTA 1TQ6A 1HH4A 3B1XA 3NBYC 4ON9A 2G88A 3T35A 4JLDA 2FJUA 2XXAB 1FAQA 1H8EA 3H2YA 4QBHA 1ODFA 3KFVA 4DCNA 3LBHA 3WMFA 1I2DA 4HB0A 4B43A 1E2FA 4A1FA 4CF7A 4GMXA 2JLZA 2WJYA 3LVQE 5CDFA 3ZD7A 1E1RA 2JLQA 5EE1A 3TKLA 1R6BX 1TNDA 3LH5A 2XJ9A 1XZPA 2CNWD 3WP0A 1AS0A 1VMAA 1RPZA 4QJ3A 4JL5A 2OZEA 4I1SA 4OK3A 4ZPXA 5KTYA 4BLPA 4L4UA 4Y0VA 3U7GA 1YZUA 3TUIC 2Q9CA 2CDNA 2ZSDA 4XVQA 4B2LA 3SJCA 2O0HA 1G6HA 4A6PA 2WICA 1P75A 4ERNA 1RE0A 2ZI4A 1E1QA 1S3SA 1RRPA 1M6NA 1TQDA 4N0DA 2RHDA 1FZQA 1KK0A 5DHAA 5CK4A 4C30A 3THXA 2YZ2A 1NRJB 3WRYC 5JMTA 2IHYA 3BK7A 4LC0A 4M21A 2IF2A 4Q7MB 1JXOA 3CH4B 3RYTC 4ABYA 4EAQA 1GOTA 5KNBA 1Z47A 1KY2A 2JEOA 2JJ8A 2C77A 3NC1C 2IS4A 4GZMA 3D7MA 4XTRA 1KTVA 1COWA 2ZSBA 2GEDA 4MITA 821PA 4JLPA 3WYGA 2JLWA 4QGHA 4F7WA 4IFBA 4PHTA 3PEYA 2BEKA 2PX0A 3MLEA 5J4HA 1S1MA 4JYCA 3CNOA 1Q44A 1JPJA 1D9XA 2W6JD 4S2EA 5HZHA 5JWOA 3KX2A 1JXMA 3BD9A 2JJ1A 4XWOA 4GZLA 3LXRA 2W6IA 1QHXA 4OKSA 4Q18A 3GP8A 2E73A 1EFTA 2AK3A 3HYTA 3BGWA 3GEHA 2C9OA 1JQLB 3MJHA 3QPUA 1CJMA 1NN3A 4FKDA 2FGKA 2PT7A 1SVLA 2PCJA 3EIHA 3HU3A 5C18A 1E79A 1JJVA 4HAXA 3RRMA 1PTQA 2OUKA 3W6NA 1KO5A 1QDEA 3ND8A 1K8RA 1Z0JA 2QENA 3IHWA 1X8JA 2IXEA 5M04A 2BKUA 3SC3A 3W90A 1XTRA 4A8JB 1QF9A 1N3BA 3REGA 4CW7A 2QTVB 1XD9A 3I73A 3PR1A 2Z0MA 3I72A 3KUCA 3SYKA 5FTLA 2YWFA 1N5LA 1KBFA 1OE0A 2B6HA 4RCYA 2GVIA 3THWA 4GI7A 1XEWX 3K0FB 3U60B 4WXPA 2V6IA 1E69A 2WWHA 1HY3A 3W6PA 3AF4A 4E5UA 3A1UA 4CYMA 1NVVQ 1OFIA 3CF2A 4I1UA
chains in the Genus database with same CATH superfamily
2EFGA 2ZSHA 3PHJA 5I5EA 1DXOA 2E18A 1ZH4A 1KL7A 3OQIA 2EL7A 4RIGA 2JIPA 4TKZA 4JOSA 5JH7F 3MAAC 1Y6FA 3WWPA 2ZWPA 1MD9A 3BD8A 2AQHA 2KPOA 5C0OE 4AP9A 3QVMA 1H3EA 3T7IA 2OO5A 1KI2A 3FZYA 2O2XA 4U7DA 4UAGA 5IS2A 2NZVG 1G20E 3IB3A 4IINA 2WJAA 3N8HA 1BKDR 3TSOA 3QWAA 5EKDA 3LF1A 4G8CA 3DLBA 4GUDA 5IAKA 3IP6A 1HI9A 3HR7A 5FWXB 1RTKA 1MIOB 1XRLA 2RGDA 4MRMB 2B21A 2XY4A 4KLZA 3ZZTA 1NIPA 2ID9A 2BDUA 2EC5A 4EENA 1VYVA 4X3PA 5DWQA 1J33A 1W76A 2J5RA 4UHHA 2UZ4A 2RIJA 3FMIA 3FFTA 2XRZA 1SOMA 2ONZA 3PCRB 3ZOZA 1TYDE 5AI8A 1SUFA 5T8KA 4D9GA 4DDVA 1QZXA 4X61A 5JH7A 3OOEA 4ZO9A 2B7BA 2FLKA 4IV0A 2DHCA 5JY1A 2VHVA 1M2OB 4CV0A 1ORTA 3ZW9A 4EATA 5EHGA 2D7JA 1PSWA 3OOWA 1Q0PA 3AY3A 1U98A 2WM3A 1SN7A 3GCGA 4C0JA 5IJ9B 1E2PA 1WEKA 3HJBA 3F2VA 4PNZA 1K0FA 1X2EA 3BL8A 4K40A 3VJMA 2VK1A 4QUDA 1UXIA 1JYEA 1B8PA 2C9BA 2FPLA 2DWUA 2FPXA 4PYMA 1IOZA 1AF7A 4DNCA 3WK7A 3J81k 5COAA 4AW9A 1NX9A 2BZ1A 4FYXA 4J0QA 2Z5GA 2Y92A 1IJEA 1FRVA 1Y9AA 5HI7A 1DOHA 5FPSA 2V7UA 5IAEA 5G02A 4H3HB 3MS2A 2PX4A 3LZ6A 5F1YA 2G1AA 2I2AA 2NU4I 3IIIA 3FFBA 5EYPA 5T64A 3PX7A 2YYSA 1TJ5A 3FUCA 2EKLA 4WN3A 2Q9AA 3K9NA 4ZZ2A 2B0JA 4JU8A 3U44B 4R1LA 1GQRA 3UCXA 1Z4JA 2GFIA 2FV8A 1SUCA 1XGKA 2OZLA 3B9QA 5FJIA 3ZS8A 4KE9A 1N2GA 4RD0A 1FJGB 4WJLA 5KVVA 2FOIA 1P8AA 1ZVJA 2FPSA 3H3FA 3QU4A 4LJ6A 5E7QA 3S2EA 1B8NA 2ZB7A 1J2UA 3NOOA 3QOWA 4FNAA 4W6QA 4Z4CA 1KORA 3DNPA 1PK9A 4FKBA 5DK6A 3MB8A 2P2CA 2RGBA 1ICEA 2OMEA 3L0SA 3WJ7A 2YIMA 2ZWIA 2PUBA 2GM4A 2NSYA 4YRIA 2IYSA 2O8BB 1EINA 1NZFA 4M1EA 3VU8A 1Y1PA 3PUHA 1R16A 3GZNB 4QPDA 3TTSA 1LPOA 4LBZA 1P62B 4E5MA 5FUYA 3D7SA 2FZEA 10MHA 2R6CA 1KAOA 4L7VA 4WFIA 2OMKA 2ZJZA 3EIUA 1FQOA 2AN4A 1PJ4A 3OP1A 1A0OA 5LXTB 2F8SA 2VVTA 1VP3A 1X9IA 1Y48E 2DVMA 5I8ZA 1O0BA 2VRCA 2A5YB 1KOLA 1L4EA 1IWOA 2FSGA 2P4HX 3FZGA 1FPQA 4R84A 1Q21A 1QRUA 4GLOA 1KJJA 4WOCA 4G1CA 2PRJA 3EPPA 3CLSC 5FOQA 3JPWA 1DQSA 1I1NA 4JZKA 2EJCA 1ZMXA 1DCKA 3LBNA 1JSXA 3WWYA 3VVBA 3HDJA 4YRMA 1BWSA 1LRLA 2YC4C 1PEYA 4ARAA 1GPBA 2GRJA 3DD5A 4FYMA 4F97A 2JLBA 3PXBA 5IBPA 3ZH2A 4BUJA 4X94A 4M1KA 3GGOA 1VIYA 3E9MA 5LWHA 2X8AA 4P4LA 2W2PA 8OHMA 4CR6A 4YMIA 4XUGB 4JJZA 3K16A 1CERA 2W43A 4C21A 1IXKA 1WHSA 5BR8B 4UAJA 3AY7A 1ODSA 1I30A 1DDOA 4F91B 2REOA 5HIMA 1LBSA 1M33A 3JAWA 4H16A 4NRDA 4JI3B 4IWYA 4D0LB 5JRJA 2I7XA 2I7TA 4WZAA 3GLGE 3DDOA 5KOJA 3AR3A 3N8DA 2QRHA 3VPCA 2FAXA 2QM0A 2PH5A 2ILTA 3E9QA 3S7TA 1CJBA 5LN1A 3CEJA 4W5JA 5HRUA 1EK1A 1ZU4A 3HLKA 4FHCA 4IMJB 1ZH8A 2XEDA 2V98A 4EPXA 1GDTA 4XJTA 5TPWB 1NBEA 4WK0B 1FUKA 3EXHB 3IPRA 3PQ2A 4IDGA 3QWBA 4CFZA 1JA9A 2FSUA 2OBYA 4BX3A 4CL3A 4US0R 1KDVA 4WDQA 3BWBA 4D98A 3QRWA 5BN3B 4O4IB 2QRZA 5AJWA 3IDOA 5E3IA 4FYKA 2ISCA 1PQYA 2WFZA 5DTRA 1K3FA 3DFFA 4LQDA 3VZSA 1N5RA 4Q93A 3EEYA 1OPRA 3VSDA 1NM5C 1LDYA 2C3YA 3DZCA 4LN1A 1E99A 4PLGA 5K8VA 1AUXA 3B2NA 1H6AA 2I2DA 1NWHA 2IW3A 4JJAA 3TSAA 5ELXA 3ZGLA 2H1HA 2HCRA 3HCEA 4LJLA 4ND7A 5C2JB 2F1JA 2PSSA 1JE1A 2FLVA 2J3EA 4Q3AA 4CBVA 5HRAA 1NUPA 5A3RA 3RYFA 5LQJA 3QHAA 4JV5B 2Q46A 4EJ0A 4JLNA 1N7JA 2AGVA 5AJYA 4L76A 1LI7A 1RYNA 3H6HA 1UMBA 4L3OA 1H5QA 1O89A 5FR1A 4CKYA 5C5DA 2JI8A 3ES9A 3AMVA 3VKWA 1G7RA 1Y3BE 5A0TA 5B55A 4NTZA 1ULHA 3CW8X 3DFKA 3RLIA 1QVWA 3N2ZB 3DFIA 3MCTA 2CXSA 3FTQA 1JVBA 1WDWB 3CLSD 3TNYA 2EERA 2QBYB 5C1OA 2QWXA 5KNDA 2JGLA 1Q0RA 2QRVA 1P2SA 3K1AB 1LF5A 3P0EA 3QH4A 4IIXA 4NBNA 4LGYA 5F21A 3H2ZA 2B8TA 1TM4E 4J0FA 4LF4B 1DFGA 3LWZA 1EX1A 2XAUA 5ALWA 4KITB 4KRGA 3RAEC 1SA0B 4KXVA 4E5KA 4U9HS 2IPLA 1CKEA 1WG8A 2J45A 3CVUA 4KFUA 2RI6A 2SGFI 1J49A 4M46A 3ZXYA 1D6MA 1JEEA 4KI7A 4X45A 4AECA 1GUFA 2LPMA 3EGOA 5BSMA 2IYNA 1XTKA 3SZLA 1D1TA 4ZYXA 2HRQA 2B1RA 3CJQA 1UWLA 4LMPA 4MQBA 1E8NA 3JV7A 1E2EA 2GJAA 3INRA 3PJDA 5DJ5A 2ZWMA 5EJMA 4J3JA 5BORA 1RWXA 1JA0A 4KIJA 4C4SA 1VHJA 2XX3A 4LSZA 2YNMA 2HWKA 4FZ5A 3BX1A 3M1IA 4RZXA 2ZB3A 4BX9A 5I8PA 4K3UA 3SEFA 5BUQA 1ULSA 4JR2A 2CEKA 3H04A 3HS3A 3OQ1A 2PX2A 4MVJD 2KLHA 3IUNA 1VPDA 2AUNA 5L3SB 2H9YA 2RMKA 1N0VC 1HG1A 2C0QA 2QAGB 1GO2A 3NIGB 5DCLA 3O03A 2Z4RA 3CPSA 2IOHA 1YJBA 3E82A 3PWKA 1QO9A 3RC9A 3JYOA 4CF5A 3PNSA 4JBNA 1J2RA 4KJZA 1NOJA 1RJFA 1ZNXA 2GEBA 4V39A 4EYKA 5GWXA 4F5DA 1YCDA 1MEJA 4YCBA 5SICE 4FINA 1C7ZA 2J0SA 5EMLA 1QWSA 4PR0A 2A94A 2J87A 2CBXA 1OTXA 2QZJA 3OIYA 1XKLA 2Q0XA 4HWSA 2HBRA 2WF6A 2WM8A 3IAM6 4MZXA 4RPLA 2EYUA 4MRAA 4EUSA 3RV4A 2AN9A 3K9GA 4ECAA 2P8SA 1JDNA 3A1DA 2QYTA 3HSKA 5B1HA 1IY5A 3U5TA 1H2AS 2BM0A 5AJZA 1UHAA 3T94A 4RO0A 2GIVA 5KNCA 1JN0A 1V1MA 3KG2A 3QFTA 1E7MA 4Z2YA 2WF8A 5B2ZA 4BATA 3MWEB 4NS1A 3TPZA 3IT0A 1W9HA 2C83A 4C3ZA 1VI5A 4DXDA 5IK2D 1BVYF 1EAMA 2V74B 3WMRA 3OTIA 3VMFA 3W2TA 2W93A 1FVOA 5K3SA 5HIAA 1LBTA 4ZARA 1N1GA 4LMRA 4M9ZA 1AQYA 1Y81A 1SGWA 1TF2A 1Z26A 3GT3A 1ZN7A 4R7GA 5E9QA 1BE0A 4DR1B 1KQNA 1ISFA 1SHZA 1YGYA 5JNTA 2A84A 1E1YA 5BSEA 3PNPA 2ZSAA 5F9HA 1JWAB 1VA4A 3LV8A 4OA5A 4C89A 4DNXA 4IY1A 1N2EA 2RGNC 2MSKA 5JC1A 4GL2A 2Y2UA 3C5EA 1JLMA 1XZLA 4BNJA 1GNTA 3E1GA 4GI3A 3RT7A 4EBBA 4YAIA 5CLJA 1OXSC 3TQIA 1KO7A 1OH6A 3V4FA 1CETA 4ZT7A 3DZJA 2BFEA 1B23P 1AQIA 3ZNNA 2I3AA 4OLHA 3QE9Y 3VDXA 3AEKB 4PHGA 4FILA 3ZYZA 1CP2A 4AJHA 3WC4A 3NHYA 4JP5A 2VQDA 1ZK4A 4NQZA 1T5HX 1QHNA 4OP3A 1DQPA 1TTPB 3F90A 4ZCQA 4NCJA 4N5MA 4GPTA 1JGTA 2PS0A 5TQ2B 1H2EA 2DZDA 4NBKA 4TRMA 3R7LA 1NQUA 5AW3A 5JXJA 1ZD1A 3FTNA 5K51A 2QQ0A 4ALLA 3OJXA 4GMHA 1Y5IA 1W5BA 4QDTA 3X3HA 5HS4A 2PBRA 4KHZA 3GLFA 3SWWA 4RM2A 2X9LA 2A0KA 3AESA 1F8GA 3OKAA 3P2MA 1XP8A 4W5OA 1F0PA 3P9IA 2VHUA 4GE0A 1E7YA 4JBHA 3GRKA 3RFUA 4BLVA 4MIYA 1B26A 2RONA 3VGPA 1BEZA 5BOSB 5HYVA 3QIVA 3E4CA 3JYQA 3SHVA 5C8YF 1NOIA 4HPXB 1TW2A 3KDPA 3KV3O 3H8WA 2OFFA 1BXKA 4RD2A 3U7QA 2J3QA 4FZVA 5FBVB 1IN6A 1ODLA 1AU9A 1W44A 2QVLA 4D8TA 4RMNA 4UTPA 2QAIA 3DBRB 4WBNB 3OMLA 1B73A 2ZRAA 4P82A 3EPJA 3M9WA 1I0ZA 1VKRA 1M10A 3M82A 1G3MA 4BQIA 2ZKLA 1GRVA 1W1WA 1FF9A 3EZYA 3ROTA 3ZZ1A 3BB1A 3BHMA 4FTWA 1V25A 4OJQA 5CHEA 1YV9A 4DVGA 2JCXA 2P75A 2WFLB 2DR3A 4ZIRA 2CCGA 2VUUA 4UMDA 3IPCA 4WN9B 1KJ9A 3QLEA 5HM6A 1KQPA 3PUIA 4ZO4A 4C6SA 1FC0A 4EUEA 1Y1QA 1GCUA 1YWGO 1ZDMA 3V42A 2VSNA 1KC3A 3DMTC 4KAFA 3S28A 4US1R 3DM5A 5IVIA 5EA2A 2WINI 4R41A 1UM9B 3UGDA 3OF3A 5E4FA 5C8YA 1TM5E 2GJKA 3UJPA 3WBBA 5J4YA 1OT3A 4GM4A 3RM3A 5CITA 1CGJI 1G9SA 4JKOA 4O6VA 3IV7A 2XE6A 4FB5A 3AGPA 2NZ8A 3CNBA 1XLUA 3DGEC 2IUSA 2X1HA 1SZJG 3K32A 4HTAA 5JXWA 1KVQA 5TGZA 3SE0A 1CXZA 3TECE 5FNVB 3JQBC 3QVUA 4RUKA 4BFTA 1X74A 4KQ9A 1FNDA 2JIQA 4RGQA 3MJ4A 3QI7A 5FORA 4KOEC 3RHSA 3VAYA 1QONA 5ETJA 5CLIA 5GJCA 3GT0A 1PR1A 2DUWA 4XSGA 4XB1A 2QW0X 1HGXA 3ND9A 4MRNA 1F6WA 4P83A 4TV8F 1TKRA 1XCBA 1BX0A 3KTAA 3OX3A 1E0KA 1IWBB 1S4QA 4HYYA 4QYIB 3B1KA 1R6DA 2DWOA 2H7CA 2P2YA 2HIMA 1GQYA 2VPPA 3DYBA 4FFWA 4PG5A 3ESBA 4R1QA 2ST1A 1LJUA 2GEUA 1PT6A 2NO9A 2WTEA 2JIBA 4M49A 3RBZA 4CRWB 5JJBA 1PVOA 3DL2A 5KDDA 1V8PA 4MYUA 3VAZA 1NW9B 3C7DB 4I5DA 2NU8B 2RBGA 9ATCA 1FTWA 4ZK6A 1XALA 3O26A 1J5XA 2Q5FA 3FDFA 1ZJYA 2I6FA 1L7DA 3G8CA 3LVFO 3WNQA 4J16A 3UUFA 3PDIA 1JKMA 3Q7QA 2WWRA 2NYUA 2ZI6A 5F2KA 1KY3A 2ZIXB 1TAHA 4UXJA 1PFQA 4TS3A 1VBMA 2QXYA 3NHAA 3UWDA 5BUZA 3KYIB 3RAJA 2Y99A 5DN6A 1CEXA 2J9ZB 1GUAA 1L5FA 4YRZA 5ERXA 4TV8A 5B6PA 1LR8A 4G0QA 5NLLA 4AKEA 4PCAA 4GPD1 3QWFA 2AE2A 4DR4B 4GS5A 1BOOA 2BFAA 1HDXA 4I1IA 2B4RO 2H5IA 4CTNA 2R8RA 2PH1A 3ND6A 3OIDA 4WESA 3TXAA 1D6JA 4TYNA 6AT1A 3GPBA 1N0UA 1XNGA 4JR1A 4FFBB 4YP9A 4G2NA 1RZUA 1KR5A 1NKTA 2REBA 4P0QB 1FVHA 2ELIA 3M6MD 1LSJA 3M6UA 4RS3A 1W6UA 2AEJA 3TN7A 4AQ7A 2PCLA 2C7OA 1N6RA 3WAGA 3OTQA 3PPIA 4F3NA 1MGOA 2V1CA 1SC4A 3KEFA 3NNDA 1PUJA 3G2MA 1HSZA 4PVCA 1QGUA 2BD0A 2WYHA 4BN0A 1ZMRA 1K7EB 4YJKA 3HKDB 3RF7A 2YOHA 3BTOA 3AQ4A 3EZ2A 2IKSA 3ZDBA 4DA7A 4YDHB 4IGKA 4B45A 2FW8A 3AVOA 3LQRA 2NO0A 1C3EA 4NZMA 1RKUA 4F2WA 1U2DA 1NATA 3BTVA 4QFBA 1MNAA 3K8YA 1JR3A 4MWTA 2DBQA 4YAEA 2IIBA 3N7UA 2ZS9A 1DHTA 3FROA 1NJ5A 3HR8A 1A7AA 3OT1B 1ISPA 4LCBA 1CQPA 1PKXA 2W2XA 3UJHA 4FOTA 3DBLB 1PJ8A 1MXHA 1RLOA 3HH8A 3IXLA 4FWBA 4Y18A 5CD9A 5JYBA 1TUIA 3ZLTA 1K92A 3I53A 4GC9A 5CVUA 5ALMA 3ML1A 2XIJA 3CKLA 2QVGA 2Q3HA 3ET5A 3ZHXA 5CX1B 1NG9A 1TU0A 2QJWA 3LCVB 5GVSA 4NG5A 2WUDA 4TZ6A 1THMA 5F5NA 1BQ3A 3FOZA 1PR0A 2UUAB 3ZD6A 1G9TA 3OPYA 1VHWA 2NTVA 5FTKA 5HX7A 2DBVO 3WBJA 3KB2A 1K3TA 4WVFA 3ZHOA 4O1MA 2YHBA 3I8SA 2G7ZA 3KVVA 2B36A 1YR3A 3QSGA 3OC0A 3IMGA 1UQRA 1Q3KA 4GR5A 4KR0A 1EM6A 4UFNA 5I7OA 5KI6A 1P6XA 4EB0A 3BA6A 3CUVA 4UUNA 4WINA 4TOIA 4A4DA 5AFSA 1UK8A 5IAOA 5KNBH 2O2GA 4LPSA 3K4QA 4BNYA 4LF9B 1T5LA 3GDOA 3S68A 3WIVA 2PT6A 1QVRA 2JG3A 1HZJA 3V97A 3NT2A 2V6MA 1CUSA 4TSFA 4B3FX 3PENA 1ZNWA 4NBUA 1FQJA 2DLDA 1V1IA 3NAZA 5LP6B 2YWXA 3LQFA 4BBJA 3HBJA 3KWJA 5EE0A 2E85A 4DLZA 2YFKA 3T7KA 1KKLA 1N8KA 1E0DA 3G5LA 3ZJYA 5KMGA 4KPEC 3AJEA 3ENZA 2B4KA 3H1GA 1HM5A 4G86A 4E2YA 2J3KA 4BMNA 4MP6A 2A92A 4Y1RB 4F04A 1EDOA 1A4XA 1R3DA 4R8LA 3ZQ6A 5L3QA 4Q4AA 4XQ9A 1ICIA 1TX4B 2BW0A 1FP4A 2CW5A 3G88A 5FV7A 3CZRA 2H17A 4UUPA 5EEGA 4RD1A 2O7QA 4U2BA 1IPFA 1OREA 4TVKA 4DR7B 3DL4A 1NVEA 4JKYA 2QT0A 4YCNA 1QK5A 2C2ZA 3VHRA 3K8ZA 2IE8A 5ENZA 2FJ0A 1VI2A 4RTJA 4FE3A 3S44A 2XCLA 3L82B 3LF2A 2IX9A 3CRQA 4RHTA 3F6BX 2P69A 5AK4A 3RYCB 5EIXA 3AIOA 1CNEA 1ZEJA 2C5BA 2W6ID 4HG2A 5DBEX 4MCIA 3HLTA 1E9CA 1AB6A 1V7QA 5IM5A 4BNUA 3G0BA 3LXMA 5D87A 3JS5A 4MQFB 5KAMA 1G5IA 2PBZA 3I32A 4MWEA 4U2FA 4IGAA 3W5UA 1BFUA 4H3VA 1LNQA 2JHGA 5GPBA 3ZXIA 2FFRA 4NFYA 3WKCA 1EFHA 5M2QA 1II9A 4FS8A 1MC5A 1K8YB 1NY6A 2VOJA 4MKIA 4GI1A 1XPJA 1A69A 4KQEA 2ZRQA 4A6DA 4BP9A 2PRKA 1SG9A 2ADOA 2CD7A 1C7IA 1D4AA 2WIAA 2ZZKA 4MRSA 5BQ5A 3TXXA 3Q0EA 2I5PO 1QOQB 5AUPB 3K9FC 1FYBA 1ABFA 5CLGA 1MTOA 3COZA 4F93B 4UXIA 4UVIA 5CLLA 2AB0A 5J23A 3K70B 3MM4A 3WB2A 1CQJB 3U6BA 3ENWA 3ZIAA 2YV2A 1G3UA 3SYNA 2R86A 2C4MA 2B8NA 3QE4A 4IF4A 1Z06A 1T10A 2C8JA 2HRCA 4I9UA 1WY7A 4PN7A 2PRIA 1YI0A 4ZC8A 1NT4A 4DB4A 1PJTA 3HUFA 4G4JA 3ESZA 1V2HE 3GARA 3LX6A 2QQGA 1UFVA 3LZDA 5FOTA 4B3IA 5HE8A 5B6IA 4EHBA 2A9VA 4UBKA 5DGDA 1J0EA 1NQXA 2IKQA 1OPXA 2IUTA 4D4HA 3E27A 3I6MA 5F3DA 3HB4X 3CVYA 4B6DA 1FNBA 1Q0HA 1GAJA 2TECE 4LNAA 5CT6A 1FU4A 4YMLA 3OO0A 3EVTA 1OSNA 3LFHA 4ND6A 3W3ZB 2X23A 1EYZA 3IEUA 1GNLA 5LBTA 2ZK7A 4L6IA 3S2UA 2DUUA 2HU2A 1R0RI 1J0CA 2QSZA 2R7AA 3H84A 3IT2A 5HSGA 1EK0A 2PR2A 4NS4A 2ZM5A 4DADA 2G1JA 3V8PA 3E84A 4EY7A 2WIBA 4X00A 4CLDA 4YXWD 5J4KA 2JDID 4DFDA 2O0JA 4MAAA 4QYWA 3VNQA 4W9MC 2OOSA 3BM5A 1WDKA 2BT4A 4J7UA 5FFMA 3THOA 2J9FA 3C5WP 3VO9A 1QPGA 4CM4B 1X1BA 2OCGA 1K5DA 3O21A 2RB4A 2ZPTX 4GBED 1TZMA 3GAAA 3OZIA 3TR5A 3M9LA 2HWYA 2OR3A 4INJA 1CRLA 1WD5A 2C5LA 3ZVLA 4EK9A 5F7OA 4WP4A 1I6MA 4JL8A 2OCYC 4Z5XA 1BS9A 1YONA 1E3WB 2PUFA 5FI5A 2PTHA 4GWGA 3WMEA 4HT3B 5H9VA 4O4LF 4ZK2A 1KDPA 3MC1A 5SV2A 1C4KA 2JBAA 1HDIA 2MOKA 2XNDA 3S2IA 1U6IA 3FNQA 4CIYA 4OI1A 3PEWA 3ICPA 2NO7A 2GEVA 3P9KA 3PXXA 3TOZA 4D6YA 3DQPA 5IANA 1RKBA 5JLAA 1I3NA 1HKUA 2GAJA 3IJ5A 5PGMA 3HDHA 2R96A 3IPYA 1EI9A 3DA8A 3OMXA 3N5CA 3DKRA 1SKYB 1V71A 3M1YA 4L1KA 3STHA 3ANNA 5IEJA 2J31A 3K20A 4D42A 3B8EA 2NXEA 2BSQA 4R54A 1ESEA 3DOFA 3N2YA 1HEYA 4U3JB 3W9YA 2W8ZA 1EFVB 3BE6A 4V0RA 5DM4A 5BN5B 4UM9B 4LQ4A 1VRCA 1HYGA 1GPAA 2Q8NA 3WR5A 2J67A 3PD0A 3ZDDA 4H0CA 1ZLXA 2XUKA 3U19A 3OJWA 5MN5A 1FPMA 2CF6A 2VG8A 4GM1A 2XH8A 4YMWA 3Q3EA 4X93A 3RIYA 3A3PA 3P2JA 3Q72A 4O4LA 2C54A 3BPSA 3C43A 2J6HA 4LE2A 2WUVA 6LDHA 3HU5A 4A10A 2M1ZA 3FUTA 4ZYWA 1ZD2P 3GFGA 4LYFA 1DCMA 5BV7A 3FKSA 1HRKA 1X1RA 3EHEA 4EVQA 1O95C 1EVYA 1OF1A 5K0EA 1Y6ZA 1NE2A 1L6RA 4EA6A 5REQA 4B4WA 4G0ZA 4G5OA 1OC2A 1XZQA 1AUQA 4YQYA 2IH5A 4NYIR 2ZYHA 1D1SA 2HQOA 2NO5A 4U7JA 3KSMA 2I2BA 2AX3A 2WKPA 3KOZA 2G40A 4G84A 1VMEA 3EW7A 1Q7BA 1M74A 1XMXA 3I6ZA 4INZA 5DULA 2HAEA 3X1MA 2CUKA 5HZGA 5JS6A 4KXUA 1K7VA 1II8A 3IDFA 4QUJA 4BE4A 5FHRA 2BH9A 2QSJA 3SC2A 1V16B 2BGLA 3FPEA 1AK2A 4MX8A 2R8EA 4RK1A 2QRLA 2H2DA 2NV0A 3GEBA 4ZYVA 4CETA 3C3MA 3VUFA 1MEEA 4B3JA 3DEAA 4ZODA 3M33A 3AIIA 3EEQA 3QXSA 4MYSA 4QGAA 4I8DA 4NCNA 5E7MA 1MX5A 2WJIA 3HB1A 1OHHD 1A9OA 4AVYA 5L3RA 3IR5A 4HYTA 1AUOA 1WU7A 2M6LA 1DV1A 3A9RA 1RIIA 4I4TB 1J8DA 4M37A 1QYDA 1SOWA 1DXYA 4IVPA 5F1KA 1KPIA 1Z28A 3PJEA 4BB6A 4CUKA 4FDUA 2Z9BA 1VL5A 3J7TA 1LH0A 4XQEA 2MSNA 5KYTA 4TS1A 1J6UA 1TTQB 2JASA 4MROA 3OHPA 4M6WA 1TJ4A 3JCZA 2UUCB 3OUUA 2OM2A 4UUQA 1KU6A 4DR5B 4KWTA 1BWPA 5DAEA 1HNNA 1HZZA 2C7GA 4QYXA 1YGPA 5H1YA 5BWLA 3RKUA 2EFCB 4DC0A 1E4EA 1ZL0A 3PD7A 5BW4A 4YAJA 4CN9A 4BEBA 1N33B 2HRZA 5CFMA 3FB1A 4R2MA 2ACVA 1F8YA 4MWSA 4ZCTA 4XLTA 2GTIA 2EW1A 1EAYA 2NXWA 2VH2A 3EFBA 4D0RA 2GN0A 5JMWA 3IAAA 2FFJA 4OHYA 4ZALA 2P67A 4IQ4A 4P34A 3SF8B 2JGAA 3L7MA 4FDVA 3WGTA 1XB2A 4CF6A 4D02A 3T8YA 4F8JA 4R3UC 5EX3A 1VBFA 2GZHA 3JWIA 1SXJB 3P9YA 4GPAA 2OHOA 1Z0FA 4TL6A 1BXGA 1Z5UA 4W8OA 1UK6A 3VC2A 3W9BA 5EKUA 2UVPB 1RRGA 2OG1A 2X7HA 4NICA 2BZSA 1F1JA 4NE7A 2WUEA 2X42A 4AZWA 1EP9A 2QW8A 2NSHA 3BSYA 4B9EA 2BCEA 4MB6A 5E3HA 1J9EA 3INGA 2HQSA 1XVUA 2KYRA 9LDTA 1UC5B 1LDMA 1FW6A 4OKNA 2X0EA 4XUDA 4FJ1A 3ZE0B 4PLVA 3DVSX 2AG6A 1USGA 3L0PA 3KQSA 2GN9A 1JLLA 3LDUA 4RS4A 4A2WA 4ENQA 1P4AA 1K8ZB 4REQB 1D4ZA 3ZY3A 3WGKA 4QTYA 3KJFA 4JEUA 2MDTA 3E70C 1QG0A 1T6YA 2NXCA 3EMVA 1UDBA 1Z36A 4JNCA 1KSGA 3W05A 3G0IA 5MGNA 4G1MB 4HDQB 1RWBA 1D03A 3R3UA 4JBGA 1OIWA 2CV2A 1V8DA 5CYFA 5FPHA 1BW9B 3IOEA 1BHSA 1RQPA 3TZEA 1IE3A 1R5JA 3KJQA 3RIMA 2BGJA 2WYOA 1NPDA 3AU8A 4J2TA 4M60A 4D9MA 1JKFA 5FV4A 4HBGA 1V8FA 2UZ1B 2PBLA 3ISVA 5B3AA 1NLUA 5FBWB 2NWQA 5B1YA 3TG8A 3ZLJA 4L5CA 2B82A 3NTQA 1N0WA 5K20A 4LXYA 1A9ZA 2A5LA 4W1SA 3A05A 9ABPA 1K98A 1A8HA 1Z8FA 2NPIA 1E8DA 2B25A 4Z7QB 1YR2A 1LQUA 4G4SP 1TT7A 1RYDA 2R7MA 3QBDA 2KW5A 4C4PA 4RZSA 2DWCA 1ISMA 1QP4A 3WV4A 4EECA 4ZCMA 1R2QA 1AC5A 2Q29A 4HGPA 1MTZA 1K7FB 1P4GA 4Q3NA 2VTKA 4OAOA 4JOBA 5IULC 3A2NA 3CN7A 5IH3A 5JYCA 1U9IA 3OJ0A 1SNYA 3WK5A 4AJ9A 5EHZA 4YDRA 4RKEA 3SBOA 4RADA 4J0DA 3PTLA 1X7WB 4D8WA 1Q0LA 1HDYA 1K6JA 1FP2A 1GGHA 1KYTA 1DC6A 4FYHA 8AT1A 1SBTA 4N01A 2GX6A 4PY2A 5KNCH 1BHO1 2GF2A 4HDAA 4XR9A 1G42A 2PUEA 2JJ2A 4LXTA 4F7DA 1KK1A 1V9SA 2NSJA 3BWXA 2WKRA 1WCWA 5DH9A 1Z2PX 1KZ9A 2Z30A 3LK6A 2O2CA 4DBLE 2HA6A 3OD5A 4GZ5A 3E8XA 4GVXA 3QMPA 4OJMX 3S4YA 3U1TA 4QZVA 1H4SA 4HRXA 4XEHA 1CHNA 2QTVA 2SGDI 3BMOA 1QMGA 4WCDA 3TLGB 3A3YA 1LA2A 2H18A 2AUTA 2ZKIA 1W49A 2WHRA 4RFSA 4BLSA 2HA4A 4Q3OA 1U63A 4DM7A 1UDRA 2EEZA 4WJKB 1QVVA 1KFEB 3INYA 1DAFA 1XK7A 5G1NA 4LF6B 1ZIDA 3I4FA 2EX0A 2WJZB 3MWDA 1CY1A 2VHYA 4UU0A 2HBQA 4G1UC 1G3RA 3CX8A 4TT3D 3WLAA 2ZSKA 3SSNA 2ZYUX 1J90A 3PNBA 1PJLA 3AEQA 4BYGA 4LY3A 1EUDB 3FSJX 2AMLA 3G8DA 3O8BA 2JL1A 1LTQA 1I14A 4DARA 2VA8A 4DCSA 1T5SA 2OORC 2XWPA 1RBMA 4K46A 4LNUB 3U17A 2R8PA 2NU6B 4PYNA 1CK4A 2HU5A 1KHTA 4IQFA 1UZLA 4P53A 4W7IA 1R0ZA 5KZMB 3QKTA 4DCOA 1U7WA 3RUPA 3E5NA 4OXXA 1M72A 4ZYYA 4KTVE 1BHQ1 2AN1A 5F1OA 3E1KA 3Q5EA 2NIPA 1WXHA 3OPMA 2FGJA 4FDLA 2VJYA 3ZHQA 5JADA 4PRKA 4LUCA 3H9BA 5KBYA 2FFQA 2VP5A 4OXRA 1US8A 2JFOA 3FNGA 1KZ6A 6YASA 2X3TA 3QTLA 3LUJA 3SLKA 1YVDA 5CT5A 3TJMA 1CUAA 3QSYA 2GZ1A 4HVTA 4R16A 4Y2QA 4ZVLA 3ISTA 3TW0A 2H1OA 1YA4A 5KWVA 1DC4A 1ZCJA 4OXIA 5JBNA 3IIMA 2P2LA 4GWKA 3TW8B 1G66A 2VS1A 2P35A 2YMPA 3GLTA 2CLIB 3W78A 3VKVA 4CMGA 5LQRA 1NJ1A 2FK8A 2OV3A 4I1RA 5JPCA 1EWQA 3A10A 1IY1A 1CR0A 2R0QC 1PRYA 4PNEA 2EQAA 2Q2VA 3A32A 2BGNA 2VCHA 3DE3X 3FPGA 3LT5A 1F12A 5H81A 1IN4A 4C0BA 4BAGA 1Y1BA 3G8BA 3LXXA 3NPMA 3QWPA 4Q66C 4F86A 3CCFA 4XVCA 5AVXA 5K3OA 1G8HA 2VJDA 3BS4A 4WIAA 4TRJA 3T5MA 2QPOA 3JQ7A 5DBFA 4HX5A 1OAOA 2QRNA 4FYYA 2XMZA 1CY6A 4Y1GA 1SXGA 2IU0A 1ZD9A 4ILKA 2WWFA 1RBQA 1ZW1A 1GA4A 3I04M 4O8CA 4ZPJA 1XZCA 3CLKA 1KFKB 2YBEA 3UHPA 3IMFA 4HY3A 1U1IA 5BMVB 3LP5A 4JSYA 4JU9A 2UXDB 2CZQA 2YXDA 1TCUA 4IP0A 3GLFE 3NVMB 3QVVA 1OTYA 3S3TA 2E49A 3VR5A 4JX8A 2HSZA 3LG2A 1MHPA 1XTQA 2Z8ZA 3DFZA 1KZ7B 3GK3A 4XIGS 5FLYA 4ADSG 4DMCA 4MKXA 4A2PA 1Z17A 2CXQA 2L82A 1RLUA 3VA7A 4Q4JA 5CW1A 2QVZX 5IN5A 3G2PA 4L8YA 5JLJA 1PL6A 2VI5A 1XIVA 5TRTA 5HKLA 1V45E 1N6IA 1M6VA 3F9CA 3FUUA 5KDLA 2ZE8A 2ZUFA 1RI5A 3I01M 4D6XA 2GCOA 3IVMA 4HAUA 4LVNA 3WYNA 4UMEA 1EQUA 1JP7A 1FMJA 2XGGA 4LECA 2KM1A 4FWIB 4XDGA 4XARA 3OFJA 3WLFA 4J0EA 1JEJA 3DVAB 1L7NA 1IM5A 3E59A 4HADA 1MH1A 3OPNA 1XPOA 1UKEA 1W0KD 4GD3Q 3LKDA 2X9QA 3UZUA 3CN9A 1J0XO 1GADO 3NS7A 4DT1A 1C0IA 5A0VA 2HA0A 1IEVA 2RI0A 3VBCA 1OLXB 1EFKA 1R79A 1GLGA 3THWB 2RGXA 3HMKA 4YCMA 5B2EA 3IP3A 5L7TA 3H6GA 4ID9A 1V7ZA 5THQA 4EHHA 3FYSA 2CFIA 3FI0A 3GMSA 4M0KA 1K75A 3F73A 3GFQA 3B2EA 1ZH2A 1LV8A 1M54A 1OYWA 4IJWA 4II2A 3R5DA 1YH3A 1CSOI 1TW3A 1XN1A 4N40A 5EUMA 4A2CA 5CBPA 1WF3A 2ZCUA 5KQPA 2P5UA 5FFFA 2L8EA 1WDMA 2HPZA 1YAHA 1L4YA 2JCVA 4ZOQI 1W0JA 2C4VA 3QKRB 4ND8B 4OXNA 1DWPA 1O8CA 4RJJA 4PGAA 1QTQA 4GGPA 4GMFA 4LJRA 2FZVA 1W2WB 2CXUA 2LKCA 4XVRA 3D2CA 3DE2X 3EOBI 3ABIA 3ZWMA 4Y9SA 4YT8A 1H05A 2GD1O 2VT3A 4Y8VA 2RGCA 3L7DA 1AKNA 1QIGA 1GNPA 5C4IA 2A58A 4D9CA 3LPLA 5K5EA 3T0FA 2WPDA 4MWDA 4HF7A 1Q1ZA 3ZUGA 2D4AA 4QU9A 4WNAB 5BQPA 3N0TA 4FBLA 3KT0A 4CMBA 4US2R 3H86A 2HIHA 3A36A 2BM8A 4P7KA 1YDGA 4W82A 4BEVA 3PNYA 1OA1A 1OWOA 3C6MA 4C0AC 4JNKA 2ZUSA 1RYFA 4A15A 3KHUA 5JUWA 4EG8A 3KXKA 1T8WA 5HCNA 5FKJA 1CY8A 1NTRA 2ZT5A 1TCBA 3MHTA 1HDGO 4LWOA 3DCYA 3PCTA 2Q3EA 5DYWA 5GAJA 5H82A 1T8UA 3MUNA 1Z2OX 4ALMA 721PA 4HAZA 3EH2A 1MJHA 4MA4A 3NWPA 4AWAA 4RVCA 4CCSA 2EZ8A 4YCSA 2WM9B 2DIPA 2XNSA 4OMUA 3N86A 5EKXA 4E09A 1PV4A 5F76A 2VSXA 3K5PA 3EQ9A 1OVGA 1Q16A 3K72B 5TQVA 4ZANA 3V4SA 1QPZA 3DKKA 1PGOA 2ZXEA 1MG0A 4MPJA 4E1AA 1QYRA 4U63A 1T36B 3CJRA 3ZZUA 4IFTA 1MJ5A 2JFFA 4DYVA 4W5RA 4UC0A 1HYEA 2FF7A 3OCWA 3LC7O 4RKWA 1GFSA 3PGMA 1QPBA 2FP3A 1QANA 3GCXA 2GK3A 3UY4A 3K0AA 1IOWA 3RKSA 3O31A 5E6SB 1PDVA 2Z4SA 2OD1A 2NG1A 5TB5A 3ZD8A 2YFYA 2EFEB 4LGVA 3TK1A 1MB9A 3R44A 5E4TA 5JDIA 5BNZA 4BO1A 1E89A 3VI4B 1CVLA 2DJ5A 4QE3A 1P4JA 1OWMA 3KL4A 3Q2KA 3WV5A 2C4NA