5FUVA

Catalytic domain of thymidine kinase from trypanosoma brucei with dthd
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
181
structure length
173
Chain Sequence
HGRIELIIGPMFAGKTTELMRRVQRHKHAQRSCYIIKYTGDTRHDQRALTANVSVSNLHDVGDEWRKYDVIAVDEGQFFPDVAAFCSKAADSGKVVIVSALDADYLQEPFEEICLLVSRADSVVKLSAVCMECHNRKASFTYRTVKSDERKLVGGSDMYMSVCRSCYETKRNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords THYMDINE KINASE
publication title Cell Cycle Regulation and Novel Structural Features of Thymidine Kinase, an Essential Enzyme in Trypanosoma Brucei.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transferase
total genus 55
structure length 173
sequence length 181
chains with identical sequence B
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2016-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 5fuvA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fuvA01
1I2DA 4NP6A 2PBRA 5DSZA 5EUQB 3H84A 4OQXA 4W9MC 1P2UA 2F9MA 4JLBA 2ZIAA 1MT0A 3SJZA 1G21E 2ODNA 4YMUA 1XTJA 2ZE8A 2GILA 2Q3HA 2ECKA 3T06B 4UNSA 1HQCA 1P2TA 1RRPA 3SYNA 1GKYA 2IYVA 2RGXA 4PQRA 4TQAA 3A1UA 2P5TB 2Z83A 4XWAA 5SZIA 4NYIR 3VKWA 5IHPA 4LHYA 1W7AA 1OXTA 3OHMA 4DEYA 3W3AA 1FTNA 1DAEA 2A9KA 4LY6A 5FOWA 4AG6A 1CRQA 4BWYA 1RYHA 3W34A 1Z06A 3R8FA 5AUOB 4G5GA 2O8EB 1BYUA 2VA8A 1XPOA 3P26A 2J87A 3W8NA 3KJIA 3TLXA 4DDTA 1JI0A 1GRRA 1JPJA 4NH0A 4WVFA 2J0VA 1Z0KA 2WPDD 3SJBA 1AN0A 1VG0B 4Q18A 2HT6A 4EFLA 1U94A 4JLDA 5K8IA 2CLDX 3LV8A 3O8CA 3VKGA 3U6BA 1N6LA 3KKQA 3RRZA 1G3MA 4FD2A 1OFTA 3GP8A 2Q3FA 3VFDA 3MRSA 4II7A 3B2EA 721PA 2H1LA 1W0KA 1XZQA 4TYWA 2NO0A 3LLMA 4S2EA 4YLGA 3ZIAD 1U9IC 1ZIPA 3T5GA 1FFHA 4S35A 4N1AA 5CK5A 2ZXUA 5DI9A 3IHWA 2B8TA 4FCWA 2ZRJA 3HR7A 4AIIA 4L5BA 3OEHD 3HYRA 1KI7A 2AD1A 3LNCA 1U99A 2Y8EA 1WP9A 1WBDA 3SQWA 3QPWA 3UGIA 1QHXA 5SZHB 2CE7A 2J7PD 2AXPA 4TTPA 2P2LA 3EARA 2A5JA 1ZM3A 2F1IA 3T61A 2JJ8A 4URXR 2NMVA 4LYHA 2IT1A 4Y0VA 2VH5R 1MR3F 2X19A 2V8OA 3KL4A 2GRJA 4PX9A 3B7GA 4TQUS 3RWOA 4P3YA 1N6RA 2IL1A 2W0MA 3T1VA 1SHZA 3IIMA 1NIJA 2KSQA 3ZVNA 3QI2A 3Q7QA 1ZMXA 2XB4A 1DEKA 3GLGE 1E2GA 1SXJC 2G6BA 3UFFA 3EWAA 1TL7C 2YWHA 1IN5A 2QRZA 2IS2A 4PFSA 1SVLA 1IY0A 4LHXA 2EFDB 1W4RA 1M2OB 1ZU4A 2FN4A 1HTWA 2NQ2C 2ZR7A 5KPJA 5JSZA 2RHDA 2ZR0A 3X1YA 2GXUA 5FBLB 1CJMA 1G19A 3LH5A 3N2IA 1Q1QA 4G5OA 1G41A 4DIDA 5LD2C 2IYSA 3HU3A 4L15A 5HTKA 1VCNA 3UG6A 4CGZA 1YR6A 4G5RA 2V4ZA 3TR0A 3QIAA 3ND8A 3SYKA 2XXAB 4D4MA 1A5TA 1Q20A 1A7JA 1AK2A 4RZ2A 3TSZA 4O2LA 1QVRA 1KI1A 2JAQA 4LBZA 1X1RA 2ELIA 2AWNA 1RRCA 4FMDF 3OIVA 4M22A 3U4QB 1OLOA 1OJLA 1P62B 1O3YA 4MRSA 3WP0A 4C0SA 2XSZA 3THXA 1KDTA 2CE2X 2DFTA 4Q1EA 1E94E 5E7MA 5L3RA 1YHNA 4L4UA 1I4DD 4TYPA 2BMEA 2O52A 4D4KA 4F4IA 2JLRA 1XCPA 2IBMA 3HWSA 4TT3A 2LKCA 2VHUA 1UBFA 5JWHA 3E70C 1MH1A 1XJQA 3EW9A 4IFEA 5KDLA 2IWRA 1T6NA 4C7OB 1Z83A 3VNUA 1OXXK 5HR5A 4FCTA 2N42A 1N5LA 5J4VA 2AWOA 1FPMA 1OHHD 1NIPA 4ERNA 4LRWA 2AD5A 3Q9LA 3B1ZA 5DHAA 1SHKA 3AB3A 4TZ0A 2QY9A 1X8LA 2FPMA 4IVRA 1JR3A 1XZPA 1AZSC 3U3MA 4JL8A 1PJRA 1COWA 3SJAA 1FZQA 1QHSA 1SGWA 1CKEA 421PA 2FMXA 3K9GA 4KBFA 4C2TA 4A2PA 5GADl 4NU0A 4BEBA 2HCJB 5EP3A 2EFEB 1OFIA 2FF7A 3VR2A 4WAUA 2ZU6A 3NDPA 4RVCA 5BQ5A 4XTCS 1ELOA 2GBLA 4V0MA 4M1YA 2DHRA 4C2UA 2BCJQ 2OT3B 4RD4A 5G3YA 4PPFA 3TK1A 4EPYA 3V4RA 2KB0A 2QMOA 1YRBA 1UKEA 2VO1A 1G20E 3DDCA 1KBEA 4HUQB 3QF7A 2O8BB 2B21A 2W2XA 3FWYA 4RZUA 3C5CA 3NKVA 4V0KA 2JGNA 1PUJA 4DHEA 5J47A 3EAQA 1TX4B 1OW3B 1VECA 4OK3A 2C03A 4BQSA 4DLVA 2FJUA 4QM6A 1CTQA 3IHLA 4GRAA 5FL7A 2DWOA 1F3OA 4M9QA 3W6NA 4UNPA 3DEFA 2ERYA 3X2SA 5HKKA 1IN7A 1E96A 4IOJA 2XITA 1CR1A 5DGXA 5EE0A 4C0LA 2AFIE 2REXB 4B76A 4HLQB 5DHFA 6Q21A 1W48A 3HDTA 1I4LD 2A5GA 4DCTA 3CKLA 2F3TA 5KSOA 4NYIQ 4C0QC 2TMKA 4OBEA 3KQNA 4CEJB 1E2MA 4FMBB 5KDOA 4DLXA 4LCBA 3ADDA 1N25A 2XNSA 4BRWA 1G8PA 3WP1B 4AC9A 3DKPA 3EG5A 4IOLA 4BLTA 5FI1B 3BGWA 3E5HA 4JLMA 3MD0A 3HJNA 4XVUA 1U8AA 4UNQA 4LSGA 3AKEA 3CX8A 3LVQE 5CJPA 1MO6A 2CLSA 2ATVA 1DOAA 3A4NA 1ZNWA 5DYIA 5CLLA 4I1VA 4ZCMA 4QXAA 4L9SA 4Z8YA 4B43A 3C4JA 4BFVA 4OK6A 2DYKA 4KAXA 1Z0AA 4HAVA 3SN6A 3BOSA 3SOPA 4U5XA 2V3CC 4TLBA 1T8UA 2V6JA 4DSUA 1KGDA 4IRUB 3AVYA 3TIFA 2QMEA 4N0EA 2FU5C 1R4AA 4I1SA 3IQWA 3KJGA 1CULC 1E2IA 3TAHA 3I5XA 2ZS8A 4C0BA 1UKVY 2JLSA 3U3OA 2IEZA 2OFOA 1SXJD 3QEOA 3THWA 2G88A 521PA 4L9MA 4C4PA 1E2EA 1DO0A 5FOVA 3CRRA 4GZMA 4M1WA 3B9QA 2B7CA 1DE0A 3MWKA 4QBIA 1GFIA 4C0KA 4LC0A 4DSOA 3ZD6A 3M4YA 2GVIA 1YZKA 3EASA 3CNLA 1CR0A 1G6HA 1YZGA 2PJZA 2XOKA 4LV6A 4D81A 3UEYA 2CK3D 1N5JA 2UZIR 1KTVA 2VTKA 4QJ3A 2H57A 4YQFA 3FFBA 4TYQA 1ZCBA 4D0NA 1MRNA 2ZJAA 3RS7A 1HUQA 1AKEA 4JL6A 1E9SA 4AKEA 3LW8A 2IHBA 3ZH9B 4YXWD 2B92A 1HEIA 3HPQA 1GTVA 1GRNA 3QKSB 1GRQA 4YONB 2I4IA 5CYOA 5G40A 4CEHA 1KKMA 4HAYA 5JECA 1EGAA 4BFYA 2J0QA 5FOSA 4B2IA 1RZ3A 3CF0A 3LD9A 4HYYA 3D31A 5KNDA 4BECA 4R2HA 4DDWA 221PA 1VYTA 2ZJ8A 3BJIC 3QF4B 4TMTA 1AA9A 1BOFA 1JJVA 2HLDD 1TEXA 3B1WA 1NJFA 1NKTA 4LK2A 3KKPA 4MRVA 1IN8A 3UATA 2D62A 4DRZA 5BW8A 3O8RA 2JLZA 2KBFA 5JFGA 3LQRA 2ZSEA 2YINC 3EPKA 5AUQA 3EZ7A 4EFMA 2ZUDA 1GL6A 3X1ZA 4URYR 1Z0DA 2IA5A 2O0HA 1M1YE 1FOEB 3I92A 2RGBA 2EYQA 5K8LA 5KO2A 2Z6VA 3THXB 1KDOA 5TXGA 3K0CA 2R6AA 3QBVA 2I1VB 1KI3A 1G8YA 4RY2A 1NP6A 1RE0A 1KJWA 1NLFA 3R9XA 1GSIA 1G4UR 3AUXA 2VP4A 1PLLA 1TU4A 4FW9A 1Q44A 3SZRA 3TMKA 2ZYVX 1W36C 4E22A 3KDSE 4I99A 3KXIA 3U3RA 3U7HB 3NBYC 1HYQA 4OHZA 3A1WA 2PCJA 3SNHA 5LBIA 4TMXA 4TTRA 3VR5A 2ZU0C 2ZRKA 5C46F 2ZEJA 4QRHA 1HT2E 4O25A 3PUXA 4M1MA 5F2EA 4DCNA 4MDFA 2WZQA 1NJGA 2ASEA 2PCLA 3AP1A 3ZQ6A 2O8CB 3FKSD 4PSKA 4O3MA 1VIYA 3H0KA 5FTNA 1JQLB 1SXJE 1U0HC 2GNOA 3TVTA 3IUYA 1WCV1 4Q4AB 4B3GA 1W0KD 4LHWA 4LV8B 4PC1A 5H8WA 3V00A 4MUAA 4OI1A 2QBYA 2VP0A 3WBJA 1BH2A 5JWRA 3GLIE 5EE9A 4HZIA 2IEYA 2MSDB 4PC6A 4KFSA 4ZDKA 2PZEA 3ASYA 4NTZA 2GVDC 2JJ2D 4F93B 4QJ5A 3AVOA 5KSZA 1GKIA 1D2MA 4RD2A 3RS2A 2AR7A 2XJ9A 4HI0E 2ZRPA 4KVGA 5SZKB 3PG5A 4DDVA 4ACAA 1M7HA 4Z1MA 1TEVA 4B35A 4ZI2A 4BGDA 2PT5A 4MA4A 3RS0A 2CL7X 5KYKA 2F43A 2FE4A 4I81A 1W49A 1W46A 4G0NA 1WA5A 4URWR 5DN6A 3D3QA 4P4UA 4M1KA 3VR4A 2ZRIA 1S9HA 4AK9A 2BOVA 1AGRA 4XJXA 2R6CA 1O87A 5CDFE 5F3WB 3ZZTA 3GJ0A 3UWKA 4OHVA 1XMVA 2RGAA 1AKYA 3N5CA 5G53C 1E9CA 1QRAA 4KODA 5E3HA 1A2KC 1DG3A 2VHQA 5KNCA 4XSGA 1DAGA 2NG1A 1HE8B 3PUZA 2ZROA 1S3SA 4IHQA 3MAAC 2ZJ5A 3BFXA 2D74A 1XTIA 2X2EA 1UKZA 2V55B 2OCBA 1FW6A 3FHCB 3GJXC 3OIYA 2ZI4A 2OBNA 3VR1A 1D2NA 2N46A 1FP6A 3FMFA 2BDTA 2G77B 5FL3A 2IYTA 1QHHB 3WHLA 2DR3A 2WJIA 5AUPB 3U2QA 4A0GA 1CEEA 4JSTA 3CRQA 1QDEA 1UBEA 1C1YA 4RD1A 1E32A 2B8WA 5BN4A 4AURA 3FPAA 4BLSA 4M9SA 2GAOA 3QG5A 1JALA 2NTYC 1N6OA 2VSXA 4KSBA 1DG1G 5C2JB 2DBYA 4QNMA 3QENA 1FARA 4BLPA 2C9CA 3ZVMA 3TR5A 1IY2A 3H86A 4Q47A 4YMWA 1N3BA 3AVTA 5FUYA 5A4JA 4MRRA 3LBHA 3U7GA 2CJWB 1EG7A 3EA0A 3T15A 3K70B 3B1YA 1F5NA 3B6EA 3D7MA 3CW2A 3DOFA 2ZJYA 2WHXA 3IIKA 3RRMA 3KQKA 2XSZD 5FPSA 1UADA 3W5JA 3B82A 1X86B 3C5HA 4JVNA 4GL2A 5EE3A 1II0A 4NCNA 3O8DA 3LRPA 3THWB 2BBWA 3BIFA 1W4BA 2W6JD 5DI3B 3Q8XB 4LHVA 2EFCB 4TT3D 4HDCA 4X8MA 1FNNA 2W00A 1G3UA 1DBSA 2VIIA 4NDZA 1ZM2A 4GP7A 1D9ZA 2V7QA 3T1TA 1OKKA 1Z0JA 3NIBA 1DPFA 1G5PA 4Q5IA 2D3WA 4YDSA 1OXVA 4A2QA 2IYZA 1FUUA 3HP1A 3BH6A 2CCGA 3CZPA 3SS8A 5JI3E 1JR3D 1LTQA 2ZUBA 4AD8A 1TQ6A 1COWD 2OCPA 4CEHB 2VHCA 2WJVA 1P3JA 2C98A 3QXXA 4A9AA 4IDOA 2ZI3A 4JSYA 3QUSA 3V4FA 1E1RA 3ICEA 2C96A 2PX0A 3L0SA 2XXAA 3GLHE 2WWHA 1XMSA 3FTQA 2XTMA 4U7DA 3C15C 1SQ5A 2OBLA 1E9RA 2HXSA 2ZITA 3B78A 3VQTA 3B1XA 3OE7A 1QF9A 2FOLA 4JYCA 4LOAA 2P6NA 4PR0A 5CB6A 4KYUA 1KI8A 3I1FA 4P32A 1E2PA 1E2KA 1OSNA 2F1RA 4Q21A 3EZ6A 3U4QA 4ON9A 3B8HA 3RYTC 1KI4A 3EZ9A 3LWNA 1P75A 4E03A 1HURA 1ZW6A 1YE8A 1RPZA 3BWDD 2I1QA 5FL7D 5FPYA 1U0LA 2FZLA 4ZI3A 3FHTA 4YC7A 4XOIA 1YR7A 3DKVA 2C2HA 3PJRA 5HKKD 2D4HA 3MFYA 2Q9CA 1GM5A 1ZD9A 4G01B 4DCVA 3F0TA 4DLTA 2IX3A 2BKEA 3UMFA 4HB4A 2QP4A 4IEIA 5EZ5A 4PTLA 5FTJA 4M4SA 4B3CA 2X77A 4Q19A 3LFUA 2B7BA 1B0UA 2O8BA 4LI0A 4FINA 4BZQA 4QC2A 3AEZA 2RGNA 1XXHA 2AN9A 5JHGB 4UXJA 3KJHA 3TW8B 4F92B 4WXPA 2QBYB 1NG1A 2GZAA 1J7KA 3CIOA 1E99A 1A4RA 2QSZA 1N0VC 3B13B 2F1JA 4PAOA 3MJHA 1ZUIA 1MO4A 5AJZA 3REGA 1N0UA 4QHTA 1LFDB 3SEAA 3C16C 3RDPA 1R79A 2H5EA 1FP7A 2IW3A 2ZQ5A 2BM0A 5HE9A 4AI6A 4LV5B 1Z0IA 2R44A 3IBGA 3P27A 2GDJA 3GCGA 4IKEA 1BO6A 1QHGA 2ZJ2A 2F43B 2WAXA 3BE4A 2H18A 1LVGA 1E9DA 1JR3E 4HUQA 3CF6R 1JB1A 4M53A 4PXAA 5CIQA 5GVSA 1E1QD 3SHFA 2BJVA 2W6ID 5HZKA 1J70A 2IYRA 4RD6A 5GJVC 5GJWC 3T12A 5JS7A 4IXMA 2C78A 1KJYA 1Z6AA 1ZNXA 4Z51A 5JCPA 1QZXA 1E2LA 4DBLC 1TBOA 4URZR 2JLXA 3L82B 4MYHA 3GLFB 1EFTA 4ILEA 4JL5A 5JJIA 4ITRC 4GP6A 3A36A 1G8HA 4V0ME 5GJCA 4C0AC 2XX3A 2D2EA 1NY5A 3I4LA 3MJRA 2SHKA 2OHFA 1VPLA 2XOKD 1LV7A 2J41A 2Q9AA 3U44A 2R2AA 5DNYB 3QKUA 4PQYA 5JJLA 4CEJA 3RHFA 2P0EA 3OESA 1NBMD 3QKRB 3QXHA 4ZCLA 2G83A 4HLCA 4TLDA 1QHYA 1VYVA 3H2YA 3ZZ0A 2F3RA 2A2ZA 1XB2A 2HDNB 2ORIA 1EX6A 3CH5A 4ZDWA 1XU4A 2FEMA 4BASA 3RC8A 4HB2A 2QE7D 1KK0A 3UG7A 1VMAA 2QAJA 1ZUHA 4JT4A 2MSCB 2WM9B 4WZAE 2OUKA 2EFHB 2VHJA 1KY2A 2ZI9A 3NBFA 3IIJA 1KO4A 1GVNB 1GP2A 1MKYA 2YOGA 4EQ6B 4AKGA 1Z0FA 2GK7A 1IAQA 5FBQB 1OH7A 2IYXA 2ZPTX 3AUYA 2OLKA 4DWJA 3TUJC 2JEOA 1CRPA 4KHZA 1Q3TA 3MWLA 4IOKA 2ZS9A 5AJYA 1XMJA 4OJQA 2QPTA 1NF3A 1NMYA 2NZJA 4LJ6A 4U00A 2X1VA 3ZS9A 3KQHA 1TUEA 5EP2A 1ESMA 2B6HA 3VR6A 4B34A 4QHYA 1HA3A 5TVKA 1U8YA 4QGFA 2WKQA 2BCGY 4OI4A 2ZSAA 3TGPA 1XPRA 3AGPA 1SVWA 4MYCA 2QMUA 1J2JA 5G41A 3F8TA 5KSPA 3RAPR 3MCAA 4OI2A 3WHKA 1W2GA 2OO7A 4Q00A 4XIGS 2BJWA 2NZ8A 3P4YA 1J99A 1H8ED 4PO8A 1E9BA 2YOFA 5CM9C 1KO7A 4PSVA 1P61B 3H4MA 3PEYA 4AYWA 1OB5A 1GG2A 4KJZA 3BRWD 4XVRA 1P4SA 4V03A 1S2MA 3MUFA 4JVMA 1BYIA 4BFSA 3RSLA 4CVNA 4DB2A 3S1AB 5FR1A 3KY9A 2WWYA 2YHSA 3ZS8A 4JYBA 5JRZA 3QKSA 4D4JA 1ONBA 2C9YA 2QAGA 2BM1A 5TARA 4ZPXA 1KI2A 2OESA 2RGNC 1Z6GA 3BH7A 4KYIB 1UAAA 3OEEA 4LJ9A 3VTKA 3QF4A 4FWTA 4DUGA 1DVRA 1PLKA 3IBYA 5TB5A 2E9SA 4ASUD 1EK0A 3ADBA 1GUAA 1N2CE 4Z1MD 2UKDA 4QGGA 4US1R 1NBME 5A0FA 1L8QA 4A92A 2YOHA 4NZYA 1ZM7A 2WJHA 3IEUA 3WRYC 5DN6D 1TNDA 4PO1A 2OSBA 1E98A 5TV2A 2QG6A 3OF5A 4YMSA 3TQCA 2KBEA 3RRNA 4BZXA 2JLVA 3PR1A 3TSOA 2PZGA 3GJ4A 4LPSA 2W83A 5JBQA 3C7KA 3PENA 3PUYA 5B64A 3NH9A 4UNRA 4DT1B 1F6BA 2CXXA 1VIAA 2H7VA 2OLJA 5BN3A 2F6RA 3VR3A 1WQ1R 3LY5A 4M1TA 4A36A 1ZNYA 2KE5A 3CRVA 4FN5A 2A5DA 2JIZA 4C0HA 4I1OA 2PLFA 621PA 4IEEA 2J0SA 1OFHA 4XVQA 1G17A 1PLJA 2O8CA 1KY3A 4Q9HA 5EXPA 3PV0A 1CU1A 3ICQB 1W4AA 1IXSB 4Q4AA 1XXHB 4DVGA 1E6CA 1W0JA 3CPHA 3RSOA 2WIAA 2ZSFA 1GOTA 4DCUA 2C8VA 4WOPA 3GEIA 4EAQA 1ZIOA 2WTUA 3QG1A 4V02A 1CP2A 3GFOA 3L0IB 1VTKA 2O0JA 1Q3HA 2ZS7A 5KHOC 3QNUA 4BFWA 1KO1A 3TH5A 1H8HA 5J4LA 1S4QA 2QQEA 3W8RA 2AK2A 3IGFA 3WNBA 5J4HA 3VU9B 3U7FB 4BLRA 5SZJA 4MKIA 5EXTA 4NCKA 2WICA 2CMKA 3GLGA 5F98A 2RAPA 3WNDA 4ZDIA 1R5OA 3SFZA 2GF0A 1SKYB 2P65A 1UBGA 1XP8A 3PITA 2W2VA 2XNDD 3R9WA 1FL9A 2O5VA 2XAUA 2QZ4A 3CO5A 2EQBA 3NTUA 4TMVA 3BD9A 4KCGA 1BIFA 2ANBA 3KXLA 2W58A 2R8RA 1MOZA 2V7QD 5L3QB 2Z4RA 2ZYUX 1OKKD 2MSEB 5JCZA 1GL7A 1ZD1A 3U44B 5IDVA 4KI0A 4W5HA 3R7WA 2GHIA 3K09A 3T1OA 4EPVA 1KK2A 3ZVLA 5ELXA 5EJEA 1RIFA 1R5BA 1XCGB 2V6IA 4E5UA 1S9DA 2J0UB 3AVVA 1ZYUA 2E1RA 2ZAMA 4LC1A 3UGLA 4TLCA 1QHHA 3I72A 3HU1A 4DCSA 4PZLA 4TWZA 3TW4A 4A4DA 1OFUX 4A8JA 3M6AA 3MWYW 2XTZA 4PHHA 4Q1FA 1E1RD 4KBGA 1YZUA 3VX3A 1NMXA 1R0WA 1BMFA 2DWPA 2VHTA 4V0OA 5D3MA 1D5CA 5DO9A 2X2FA 5KSYA 2NO7A 2IXEA 1TQ2A 2CHGA 1KZ7B 1OB2A 3NH6A 1TTTA 4O0MA 3LX8A 4MGIR 1C9KA 5HCNA 1K5GA 4US0R 4PHTA 2CJWA 3SQXA 4D2IA 5HPYB 2XJ4A 2WV9A 1RFLA 3P4XA 1PZNA 4PC7A 4KFUA 4JLNA 3F3YA 4IVQA 4LBVA 1UJ2A 3C8UA 1LF0A 4EPXA 3C41J 4C3ZA 3BFVA 3LO5A 1AS3A 1NG9A 3VX4A 2GEVA 2J46A 3WNCA 1G16A 3K0SA 2VYFA 1FQJA 1NVWQ 3KJEA 5DI3A 5C4GB 3U7EB 3UK6A 4DZZA 3EXAA 5GJBA 3BB3A 3KKNA 4EJSA 2REOA 4AYXA 4PQFA 1L4UA 1XEXB 2IYLD 3EIQA 4Q7MB 2QTHA 4IFBA 4ZV4A 2GAAA 2IYYA 4IJMA 1JR6A 1G291 2RGCA 4XTRA 4X8OA 1N6PA 1LB1B 2JATA 3V9PA 4BFZA 3CR7A 3I8SA 2AFHE 2YUUA 3TUZC 3THOA 1JQJC 2WAYA 1G8FA 1T4GA 1KDRA 1E79A 1NLYA 1XJ0A 4PC2A 2ZRMA 1AS0A 4B3DA 3ZQJA 1U8ZA 1ZU5A 2QAGB 3DMNA 4RKEA 2AKYA 1NVUQ 4BE7B 3MG9A 1GNPA 4PO9A 3SBDA 4ZKEA 2LWIA 4IDHA 1XEWY 1ZNZA 4WIAA 3SDZA 4OQMA 2FGJA 2L0XA 5BWMA 3UPUA 2JJ1A 4URVR 2QP3A 4B6EA 3TQFA 1HT1E 2IXGA 2YWEA 1KO5A 2WKRA 4A0FA 2PX3A 3G82C 2F9LA 3NXSA 4TSFD 5CK4A 4UXHA 4IXNA 2AXNA 2FSHA 2ZRNA 1HV8A 4P4SA 2OM2A 4EPRA 4DLSA 3KUDA 2G9NA 2HJVA 4RKFA 4XWKA 1OV4A 1TMKA 2GBLC 4RJLA 3U3KA 3ZLJA 1K8RA 4GFDA 4GSYA 2IUTA 5JMTA 3MSXA 2EU8A 1UFQA 2BBTA 2ATXA 2J59A 2QT0A 4G5SA 4IDQA 3MGCA 3AF0A 3ZIAA 4ABYA 5KUTA 1JECA 1RFHA 5JEEA 3P32A 5D3QA 2K5UA 2NOAA 2PEYA 3L8YA 3OIWA 4RCZA 2WOJA 5DISB 2BV3A 3RVBA 1KMQA 5F9FA 5CYPA 1R8SA 2PMDA 2WWXA 5J5CA 4ZDJA 4AKHA 4BRUA 3X1WA 4GI7A 1MABB 3PCRB 3Q7PA 4KITB 1MO3A 2HF8A 4NCIA 2GTPA 2GESA 4IW3B 3AVQA 2JLYA 1TAGA 3Q72A 1KO8A 2R9VA 3EZ2A 4DLYA 2IK8A 3CR8A 1XDBA 4TL9A 1I4TD 1PTQA 1NVXQ 3K09C 4MGKR 2HT1A 1XPUA 1E2QA 1BS1A 2ZVQX 2ZE5A 4ZO4A 1E0JA 4OQLA 5ANRB 2JDIA 1FX0B 3GPLA 4KV9A 3FB4A 2DPXA 1NL3A 3L0PA 4X8HA 4Q1BA 4B3XA 4A82A 5JS8A 4B6DA 3DZ8A 1VHLA 4B48A 3UXMA 1YR9A 2NO1A 4XD7A 2GCPA 5EUMA 2WWIA 3W6OA 4RFSB 2JLWA 5EP1A 4FMDB 4GT1A 1JEEA 4JLJA 4BPBA 3PEVA 4BFUA 3NC1C 4AKIA 5FTLA 3AM1A 2H16A 5B58C 3U61B 5JJKA 1G5TA 1XXHE 3FYHA 3LA6A 2ANCA 1SVSA 4CW7A 2ZVPX 1J90A 2G1JA 4KVAA 1OIVA 3K70C 4Q9JA 3L2OB 5B57C 1CJVC 1UF9A 2FNFX 2VPPA 2AK3A 3AF1A 2R6GA 3GLFA 5AK0A 1GZSA 1SULA 3PIRA 2FA9A 4HAZA 2NPFA 4UNNA 1N6NA 3ZYCA 4LJ5A 2VSFA 1KSFX 1RJ9B 3B5JA 3EX7C 2H8KA 2ERXA 5C4MA 5DLQC 3SJCA 1VG1A 1E0AA 4TL8A 1UDWA 3NEYA 3PEWA 1ANKA 3R7WB 2BIFA 3K9LA 4EIWA 1U2RA 1XX6A 4BLQA 1US8B 3QKRA 2FSIA 5DH9A 3BFKA 4JLKA 1JAIA 4B2PA 1SVIA 1XD2A 2FG5A 2IC5A 2WMOB 1IHUA 4C30A 1LS6A 2ORVA 4MH0R 4QGHA 4A8JB 4DDUA 1Z2AA 1HE1C 1XFAA 1N5IA 4C0JA 1E4YA 1XTKA 3BBPA 1TUIA 4B33A 1JEDA 2YC2C 1EFRA 1Z63A 3J81k 2ZYWX 5D3MB 4DUGD 1P60A 3JZAA 4EQ6A 4I1UA 1T9HA 4J0QA 2O8DA 4W5WA 2JASA 1UM8A 3K9HA 4Q7JB 4PHGA 1YRAA 3NG1A 3CM0A 1F2TA 4R98A 2GEDA 3VMFA 2DB3A 3CWZA 1KYIA 3K0AA 2RCNA 3QXSA 3EPLA 2RMKA 2QI9C 1FMLA 2Q21A 2GF9A 2ZE7A 4K8OA 5FR2A 5FPHA 5HE8A 1AZTA 3P20A 3Q5DA 4WBSA 2VP9A 4FCVA 1CJTC 4K81B 1KMHB 1KAOA 4PC3A 1JNYA 1G6OA 3EZFA 3M0EA 5L3SA 2WWFA 4AWXA 5EQTA 1KZGB 3GJ5A 5IK2A 3GLGB 3K0CC 1DAHA 3A8TA 4EJSB 1N6KA 2DFKB 4QBHA 1IBRA 2FDCA 4D26A 1P72A 2G1KA 2J9RA 3IO3A 4D82A 4RD0A 4DEXA 2AX4A 2JIZD 4BUJA 3T34A 4Q9LA 4HZUB 4FKDA 1L2TA 3LX5A 3SYLA 2OEPA 4PANA 3GJ7A 1EESA 4F4JA 2D2FA 2Z0MA 3S1AA 4CRWB 1P9NA 3DZDA 1ZBDA 2XZPA 4PPGA 1NY6A 4E07A 1KNXA 1MV5A 2FWRA 1W47A 5JLJA 1K6MA 3OFNA 3VAAA 4ZCIA 5KOYA 3QVUA 4G3XA 3LDAA 4GMDA 4QBFA 5IF9A 4C9BA 5E95A 1CJUC 4NCJA 3I3SR 1GL9B 2WSMA 4BZPA 2ZRCA 3CUEF 4NONA 1H8HD 5TDHA 4B75A 3TAUA 1IY1A 2YKGA 2HV8A 3JVUA 4G5QA 4P4SB 2BBSA 5KPDA 3QBTA 2ONJA 1AJEA 3TE6A 1F2UA 2XTNA 4HDOB 1KDPA 3LAWA 1IOZA 4CF7A 2EVWX 4GOKA 1W1WA 1OE0A 4HAXA 4NKRA 4TQ9A 3UKDA 1KI9A 4HLUA 1OXSC 2VF7A 4R2IA 4LJ8A 1JAHA 1FMJA 1K5DA 5HCIA 1LW7A 3TSWA 4ESVA 1EWRA 3HPRA 3RS5A 1QG2A 2Q3MA 1CF4A 2OCAA 3HU2A 4DT1A 5LB4A 2WJYA 4ZIRA 1WRBA 1E9EA 3EPHA 2DFNA 1XRJA 2J1LA 1Z3IX 2CVHA 3QY0A 3SHWA 3ZJYA 4GOXA 3ETLA 1KK3A 1FAQA 5FUXA 3T1QA 5EP4A 1R7RA 5LDDC 2J5XA 4PAMA 2HCBA 5FFMA 3THYB 2VP2A 3WYGA 1A82A 5J4KA 4ARZB 3MWJA 2AL7A 1SXJA 1G5RA 3IPXA 2HUPA 3QVVA 4Q01A 3L43A 3QEJA 1PTRA 1R5NA 1TU3A 2QRNA 4FIDA 4MYTA 5L8VA 4MYUA 1R10A 1DELA 1Z08A 2ZSDA 3RRYA 1A1VA 1WMSA 1UEIA 1GIAA 2QNRA 4L8GA 4W7SA 2QU8A 2QQ0A 4X8LA 4CDGA 4QL3A 1BMFD 2VRWB 2GXAA 1NVVR 3I62A 4IDNA 2RB4A 1OT3A 4GMXA 4TL7A 2Z43A 3AP2A 1IXRC 2G0NA 1M8PA 2ZAOA 2QORA 4NHOA 1ESNA 1XWIA 4NYMR 3VU9A 5C18A 3K70D 3A6PC 3E1SA 1X8KA 1AS2A 3GJ3A 3NBXX 4LGMA 5LB2A 1D8TA 2A7QA 2IHYA 2ZUCA 4BFTA 2C9OA 1Q12A 4DSNA 3BK7A 2R65A 4TN1A 4B2LA 3O8BA 1N6HA 4U02A 5FOTA 4DLZA 3CPJB 1T0JB 3R8CA 1P2SA 5KNBA 2WJGA 3LBIA 1Q1EA 3GFTA 2HLDA 4Y0AA 5EXXA 3SC3A 3DHWC 4TTQA 2FFHA 1U81A 3AF3A 4OHWA 1RRGA 5KU1A 1ZM4A 4R9UC 1G1MA 1M7GA 1P2VA 2OZEA 4OHXA 2GCNA 1Y8FA 1QHIA 3AVPA 5JWOA 5L3QA 1P7CA 3D6TB 3B9PA 3DM5A 2Q9BA 1U0JA 1GDDA 2XZOA 3CX7A 3PUWA 4CYMA 1XCMA 2YC4C 1E79D 1KSJA 2J0UA 4FWIB 1XD2B 4KU4A 3R9IA 4NL4H 5H1YA 2D7CA 4B71A 4E09A 2P6RA 4GBMA 2ZSBA 1NSFA 4BEJA 2OBMA 5AWFC 2F55A 2NGRA 2DFLA 1KK1A 1ZC4A 3CF2A 5FUVA 2QPAA 3CZQA 4DSTA 2JJ1D 1B23P 2IUUA 2ZANA 4RSGA 2CCJA 3IQXA 1G3RA 2O0KA 3FHOA 3KFXA 4RZ3A 3KFVA 2NPIA 2O8DB 2OFXA 3NEJA 1F60A 1E2DA 1QVAA 1KSHA 1ZUNB 2HF9A 1XF9A 1VHTA 2BMFA 3FKSA 1G8GA 1F2TB 2BMDA 2ZR9A 5EXSA 5DIFA 5FPKA 3AKDA 3K0AB 4OI0A 1T3SA 3UIEA 5FPTA 4Z54A 1G3QA 1PUIA 1IONA 1S3GA 3FOZA 2OG2A 1EXMA 2HYDA 3HYTA 3DOEA 1XNJA 1E2HA 3K0FB 1Q0UA 1G18A 4QFMA 1R0ZA 4JVSB 1RW4A 5GVRA 2VP5A 2ZRAA 3LW7A 2JJ2A 3IO5A 4HLUC 5M04A 2DCUA 1KI6B 1J8YF 1WE2A 2GCOB 3IKJA 3NVAA 2EWVA 3ZGXA 5L3SB 2G0TA 5CJ2A 3K1JA 1ZD8A 4EDHA 2GKSA 2HEIA 4HLDA 1EX7A 2WIBA 4NMMA 2LCFA 4Q03A 2OCYC 4V0LA 1LNZA 4QBGB 1XEXA 2ZRDA 3SFVA 5FBWB 4MRPA 3QKTA 2QEQA 2YVUA 2AHOA 1E2FA 4H9GA 2WBLC 4MUBA 2QT1A 1ZP6A 1FNMA 2GJAA 1IXZA 4H1VA 4OL0A 3CLVA 2FFQA 3CH4B 1KNQA 4QOSA 3RNLA 2OXRA 3QJYA 2JDID 3TKLA 4A0HA 2CHQA 4GOJA 821PA 3TBKA 4D80A 4DB4A 2FPLA 4DLWA 1IQPA 4QHSA 2VLIA 1OPXA 2IYUA 2ENZA 3GLHA 1P5ZB 3WMGA 4JT2A 1P73A 4LX0A 4XD7D 2JLUA 1E9AA 5CIWA 2ODWA 1UBCA 3KB2A 3G0HA 1IJEA 2FNAA 3ZDQA 3QPVA 4FI3C 3B60A 1YZTA 4Q4HB 2I3BA 3WYFA 5BN5A 4TL6A 1F2UB 3RANA 1JJ7A 5HZHA 2V1UA 3VKHA 1N0WA 4WZBE 1Q57A 3BXZA 3UGDA 5FH9A 2ZYTX 1NMZA 1GKUB 4LDJA 5FTKA 4KXFB 2CLCX 3TNFA 2YYZA 1SZPA 3A1SA 3I73A 3KZ1E 5JZVA 4OKSA 4DIEA 4UKDA 1CS4C 3AF4A 2YJTD 1L7VC 4ZIRB 4MITA 4ACBA 1DS6A 3BB1A 4FXPA 1II8B 4CEIA 3DL0A 1MABA 2Z4SA 4RCYA 5JHHB 2NO9A 1N6IA 2QGNA 3CNNA 2FGKA 4I4LA 4GDFA 4FMCF 4EPWA 1G7SA 4UQOA 4NYJR 4F91B 1D6JA 1OIXA 2CDNA 3OAAA 2LKDA 4JBWA 1Z5ZA 2XEXA 5BYJA 3B85A 1E2JA 4AYTA 2IS4A 2VQSA 1SXJB 1W4CA 1ZVQA 4G1UC 4F7WA 4URUR 3AKYA 1KIMA 4Q1DA 4YMTA 4L16A 1M34E 2W6JA 4NE2A 2ZJOA 4LUCA 2CEAA 1FX0A 1ZRHA 2XGJA 3GLIB 4Q4JA 3QOFA 3DO6A 4PPNA 3WY9A 1W2HA 1EFRD 3I32A 1D9XA 4ZKDA 2BWJA 1CXZA 1DO2A 4M9ZA 1X3SA 2GVZC 5FBVB 4ESHA 4QG7A 1QHNA 1X8JA 2ZI7A 2CNWA 5LD2B 1YR8A 2BC9A 3ND9A 3CRMA 4RFSA 2RGEA 5FTMA 1GITA 1HY3A 2ZETA 4Q02A 4Q1CA 1TQ4A 4JLVA 4HAUA 1YZQA 2RH5A 2KI5A 3BORA 3EA5A 3LLUA 4OJKA 2ENNA 1ZAKA 4EUNA 1VG8A 3RC3A 2HYIC 2C95A 1SKQA 1TADA 4DLRA 3BJIA 3ASZA 1NVVQ 3RABA 3LQQA 1WBBA 121PA 1G7TA 3WMEA 1M74A 4O2RA 3ZD7A 3B1VA 2ZJZA 1N5KA 5JRJA 1T5LA 3IPYA 4NYMQ 3I8XA 4A1FA 1RC8A 4MKFA 4K46A 5IK2D 3E2IA 1WDTA 2N1BA 3WBKA 1NI3A 1G9XA 2GJ8A 1T91A 4RFVA 3IEVA 2IS6A 1RJ9A 2V54A 2H17A 1KSGA 4YMVA 2PJRA 2QTFA 2YWFA 5G3ZA 1ZJ6A 4TZ6A 3CONA 4A15A 4HB3A 1S0UA 3VNVA 2QENA 3TVDA 2VEDA 3FE2A 1LS1A 3DVLA 4M0LA 4QNRA 1YJ5A 1US8A 2FX3A 1NN1A 4DJTA 3KTAA 3TUIC 4EPTA 2DB6A 1VYUA 4KFTA 3GLFE 3CB4A 1Z2CA 3GFPA 4AG5A 5AUNB 1R2QA 1PVOA 3OFND 4OYHA 4PHFA 1D2EA 4KO8A 4B32A 2R6DA 2GA8A 1Q22A 3U60B 3LXRA 4DC9A 5FI0B 2QAGC 5E4FA 4MDEA 2QPOA 2PT7A 3KQLA 4MRNA 4Q4LA 4TYYA 3NC0C 4DLUA 5CM8B 1R0YA 1OIWA 2NIPA 2ZRBA 3SBEA 2RGGA 5JI2E 2HXYA 2J45A 2ZREA 3MMPA 3H1TA 2Q0HA 3OE7D 1JBKA 4Q9IA 2EW1A 3AF2A 2UZ3A 1G3IA 1M7BA 4B44A 3GMTA 2DY1A 4PPQA 3WYAA 5KDDA 4LWZA 1YQTA 1XD9A 2OAQ1 2YV5A 3O47A 4LYAA 3T5DA 3EC1A 5K8TA 3FMOB 1DTSA 1S1CA 5AJWA 1KMHA 2ODEA 4KSCA 1IN4A 2AKAB 2QMHA 3A1VA 4A0RA 2OXCA 2QUZA 2FEOA 1EFUA 3U5ZB 1WXQA 2IWHA 3WXMA 4EKDA 3QSYA 1TQDA 1Z47A 1RRFA 2A78A 1AGPA 1Z8FA 2ONKA 2WKPA 3R20A 5H68A 1GWNA 2WSSA 1KHTA 2ZRHA 4QJ4A 1P9RA 2G3YA 1R0XA 3AP3A 1VCOA 5FUWA 4OK5A 4UXIA 2WWWA 4UJ5A 2O8FA 4M1OA 1Q1BA 4WW0A 2DWQA 2OV2A 2WMNB 1XTQA 1S96A 1E1QA 4HZUA 4A6XA 2W6IA 4JZKA 4GPTA 3M1IA 4PZZA 4B3FX 2OILA 4BFXA 1CR2A 4CT4B 1QG4A 2ODBA 2OAP1 4OQNA 2JLQA 5A5GA 1JPNA 1YZNA 1NN3A 3ECCA 2ORWA 3A4MA 4HAWA 1KOFA 4LYFA 4Q9KA 4R71A 2A3RA 2Q6TA 1IN6A 1G7RA 2BEKA 1W5TA 3RS3A 3WRXC 1CIPA 4P4TA 4JIMA 3Q3JB 5EE1A 3UMSA 1U90A 4JKIA 3GLHB 4B73A 4N3NA 4MKGA 1CLUA 2OE2A 4JKYA 1CR4A 5TY0A 2WPDA 5JSZB 4Q1AA 3W5IA 2GJKA 2IF0A 1NBMA 2C77A 2WVJA 2PEZA 1NLZA 2QM8A 3L8ZA 4NPHA 4LBWA 5KTYA 2GJSA 1V43A 3LBNA 5F9HA 1DAMA 1AQUA 1U98A 4WXRA 4UJ3A 4KFRA 4DXAA 4M1SA 2QE7A 2VF8A 1XTRA 2A5FA 1XA6A 2BVNA 4D0LB 3G5UA 1ZC3A 3QQ5A 3U3JA 2RKOA 1V5WA 3Q5EA 5LPNA 2MMCA 3KQUA 4LYJA 3OEHA 4MGYR 2J7KA 3KB1A 3FKQA 2ZRFA 4CEIB 4V0NA 4JS0A 1KJZA 3A58B 2J7PA 1VG9B 4RZXA 1DARA 1DAFA 1P9WA 2KJQA 3CNOA 3PEUA 2PL3A 2ROWA 1BKDR 2A30A 1HH4A 3ONWA 3AGQA 2ZM5A 3IDQA 2W2TA 3THYA 2VBCA 3N70A 3EC2A 3UEJA 3CWQA 2CVFA 4YDHB 4ARZA 4NBSA 3EIEA 4M9XA 1RVDA 3D8BA 1W5SA 1GNRA 2QM7A 1UDXA 4POAA 5B30A 1AIPA 4M2LA 2GK6A 1UEJA 2R62A 2FH5B 1Q21A 4NYJQ 1SVMA 2E73A 2BHRA 3GJ6A 4HDQB 4Q4JB 4TLAA 3FVQA 2GJ9A 4Z8XA 1H8EA 2FV8A 3FMPB 5EE5B 2FSFA 1NN5A 3L0OA 2VRWA 4A8JC 4XH9B 2QN6A 2IXFA 3W90A 2HJGA 1G7CA 2ZE6A 1J8MF 5E7IA 1T0HB 1GILA 1IM2A 3KUCA 2ZTSA 3K53A 3MLEA 1CJKC 3TRFA 1E3MA 2GXSA 2VSOA 3BB4A 2QGZA 2CL0X 4LBYA 4P33A 2C04A 2GXQA 3TJZA 3DPUA 4IVPA 4JLPA 3VHLB 5CLQA 3Q85A 4GZLA 1FUKA 1LY1A 4TMZA 4XWOA 3NBZC 4L9WA 3IILA 5FOUA 1S8FA 3RS4A 2EYUA 1Z29A 2REBA 2WWGA 3NWJA 3NDBB 2WOOA 2D7DA 1YVDA 2RHMA 2E87A 3FMIA 1SVOA 4PZYA 2FFAA 2ZRLA 1KBFA 4ASUA 2PLRA 4FMCB 3AVXA 3KXKA 2UVQA 4PAQA 3CPEA 2P3SA 2IYQA 1G64A 1Z6YA 2MMGA 3ADKA 3SI7A 3AV0B 3VHXA 4EJSC 2QL6A 5L3VA 3FFAA 3PVSA 3A4LA 4A6PA 1T3HA 4JJKA 5AR1A 2QA5A 4IDPA 5C1BA 1JXMA 1S1MA 1OYWA 2GZHA 2QSYA 1OH6A 2GWHA 5CB8A 2ZI6A 3RLFA 1SKYE 1TF5A 3I61A 1W36B 1LF5A 4MKHA 1F48A 3GQBA 3KTAB 5AJXA 3UMRA 3HR8A 1TF7A 1Y63A 1E2NA 2FSGA 4A2WA 1ZM9A 3BAFA 1NKSA 2F1HA 4D6PA 4CT5A 2YWGA 4D0GA 3OIUA 4TMKA 5TMPA 2O8EA 3OEED 1Z6XA 3RWMB 1EWQA 3U6KA 5J40A 3A1TA 1YKSA 1PV4A 4GNKA 2JA1A 4OQFA 1DAKA 1OHHA 3A37A 4LPKA 2XB2A 4LHZA 1TF2A 3W6PA 3LVRE 3QPUA 4JVLA 2BBOA 1W44A 3F5FA 5E7JA 2C5LA 1AQYA 2PH1A 3JVVA 1E4VA 3QXJA 1NN0A 1UPTA 1Z6TA 1Y3AA 4B6FA 3LXXA 4TYNA 1YU9A 2IF2A 1XD8A 2RGDA 3GEEA 1MO5A 3K0FA 3KKOA 2IYWA 3NHBA 4WZ6A 4XSHA 2CCKA 2R6FA 3NHAA 4JLAA 8OHMA 4JBXA 3SU8A 1FQKA 1KI6A 4LJYA 2GCOA 2Z5FA 2KWIA 1II9A 3T35A 4AY2A 3UWOA 1C4OA 4HEJA 1KAGA 3PQCA 4MGZR 4IOMA 3FGNA 5P21A 2O8FB 4W5JA 1VCIA 1YZLA 2YZ2A 1E69A 4Q48A 1XEFA 2VL7A 4TLEA 2PZFA 4B47A 3OAAD 3GJ8A 3CX6A 2GEUA 1P6XA 1XBTA 3I5YA 4Q7LA 1NSTA 1M6NA 4LJ4A 3OZXA 1T3LA 2XNDA 5AJVB 3AKCA 4B74A 1W0JD 1ZINA 5EZ6B 2CL6X 1KKLA 4B3BA 4US2R 2X8AA 3P1JA 3PUVA 1VCMA 2P67A 5J4YA 1E9FA 5BYKA 1L4YA 2FPKA 1Z22A 1E0KA 5CITA 4P0TA 4RD3A 2EFGA 1JXOA 2CNWD 3ADCA 4F38A 1RKBA 1R8QA 3DMDA 4HSEA 3ZVRA 3AVUA 4D25A 1X1SA 1E0SA 4LJAA 4QGAA 1NRJB 3BC1A 4Q4HA 1U9IA 1TBNA 1DADA 5B2ZA 3EWSA 3REFA 1H65A 3PFIA 1IJFA 3ZZUA 1XTSA 2IS1A 2CBZA 2ZI5A 2BMJA 3QE0A 3K9NA 5BXQC 5H70A 1GAJA 2C99A 4JBYA 3EIHA 4Q7KA 3AH8A 1MRSA 1Q1ZA 3C14C 2F7SA 2A5YB 1Z07A 1RYFA 5DE3A 2J3EA 2D06A 4WA7A 3X1DA 3SE0A 2CHVA 5FOXA 3KKMA 1OH5A 1II8A 2EWWA 2YNMA 4LZZA 4TMWA 4KLNA 1Z28A 3CRW1 4JJZA 2VP6A 1R6BX 3UANA 4M21A 1SVKA 1EFCA 2P5SA 3W3ZB 1DAIA 1WF3A 1TPZA 2W0SA 3GEHA 1W36D 2QROA 1ETUA 1T8TA 2ZRGA 3BS4A 2WJJA 2FZ4A 3CBQA 4HB0A 4M8NE 1I2MA 3FDIA 3KX2A 1OXUA 3AQ4A 5UKDA 4QKQA 1UKYA 4D4LA 3CXLA 3GLIA 4JLOA 2NO6A 4KLZA 2JCSA 4BLOA 4LJ7A 1WB9A 4QM7A 4C7OA 1ZCAA 4N0DA 1G4AE 2PMKA 1AM4D 1X6VA 2ZJBA 2CK3A 3GD7A 3JZMA 3BERA 3K8YA 4R7ZA 1A2BA 4CZ2A 5IT5A 1VKJA 2V9PA 3EPJA 4CIDA 1ODFA 1T5IA 1OH8A 1XMIA 4HATA 4HUTA 1VDZA 4YXWA 2XZLA 2BKUA 1CBUA 2FFBA 4DKXA 2QTVB 3DM9B 4NCHA 1HQYE 2QP9X 2IUSA 3SR0A 3QXCA 1OF1A 3N2EA 3PXGA 5K8UA 1FTSA 3W9YA 4F4CA 4OHYA 1GNQA 5IRCD 1OYYA 4P31A 3AVWA 5CDFA 2H92A 5FBRB 3K0EA 4EFNA 2OFWA 5DYGA 1EFHA 4PSAA 1XEWX 2P6UA 4TSFA 5JEDA 2BEJA 2GZDA 4H1UA 2WSSD 1QBKC 4MQBA 2V1XA 3BH0A 3X1XA 4JMPA 2GETA 1XJCA 4Q66C 3WMFA 1NNEA
chains in the Genus database with same CATH superfamily
2A57A 4RHEA 2EZ8A 2ZIGA 3B2QA 3GN2A 4MS3A 4OIMA 3PFWO 4AZ3A 3HDYA 4R0MA 4NMWA 1EUZA 4JEHA 2ATCA 4ATNA 1GPYA 5M7EA 3DKRA 3GZ4A 2AEFA 2P6MA 4PGFA 3L4EA 1JDVA 4S1TA 4UNSA 3LTEA 1HQCA 1RRPA 4YGXB 3T06B 1CUYA 1QCZA 4OM8A 4GR4A 2RGXA 1L3IA 5KTOA 1VL6A 5E3QA 4J7CA 1U28A 5LZ8A 4UEOA 5SZIA 2TYSB 3X1MA 4JDPA 5DSTA 4LHYA 4UUOA 1Y4ZA 4LNUA 3ZU3A 1V4NA 4V0QA 3QE9Y 1Q9BA 1DZIA 2JZMA 1FTNA 2BISA 3B1FA 2GTHA 4KQ1A 4TTIA 3R8FA 2FK7A 2X15A 4WOCA 4P2GA 2HHHB 1MCZA 1H2FA 3HN6A 4WSOA 4ZU1X 1XPOA 4DWWA 1GLNA 3G8AA 3D8UA 2PQ6A 3I34X 3MERA 1PKEA 1JPJA 1FFAA 1PYGA 1A69A 2DSNA 2J0VA 1Z0KA 3OQIB 4HH3C 1X39A 5GGXA 2J3DA 4Q18A 5E1BA 2HT6A 1WKXA 3UUWA 4FZVA 3LV8A 3O8CA 2UVDA 3A1NA 4BO5A 1NXTA 2IU0A 3RRZA 2H1OA 1QIHA 2V7BA 1L8OA 2VRBA 1ZMTA 4FNGA 1NQUA 3NP9A 2V65A 3B2EA 2H7CA 1OFVA 4ZZ1A 2XE4A 4WINA 3IHKA 1W0KA 2G1AA 1D09A 3MRVA 3PJEA 3LLMA 2Z1MA 4MQFA 3KU4A 4RY9A 4YLGA 5BN4B 3ZIAD 4AY4A 1R50A 3GRFA 1OA0A 5HFNA 4KQMA 1C5KA 2X0KA 1X8XA 1ZEMA 2V8BA 3TRIA 5HTOA 5HZMA 3P2MA 1CEQA 3UAVA 1HSOA 2CEKA 3NXKA 3KPWA 2Y67A 2JGDA 3H3JA 2B8TA 4RQTA 4QUKA 5G0VA 4CXMA 1KQGA 2J3LA 4L5BA 4MJLA 3HYRA 5F4ZA 3EB9A 2XUAA 4YCDA 2IHNA 4LDQA 1S7CA 1WBDA 1NA5A 5LWQA 1ISPA 2D5AA 1E3TA 2CE7A 3OWHA 1EU1A 1I10A 3RJZA 4B31A 4EMTA 1ZOSA 4M7RA 1FXUA 4BO8A 2B82A 1DMSA 3T61A 3MS4A 2ZXFA 3U39A 3E0QA 4LYHA 4YS6A 1DLIA 4M49A 2VH5R 3NVKI 3LKZA 3RJMA 1CJBA 4I2VA 1YASA 4DR6B 2GRJA 4AJOA 5FLKA 3B7GA 4TQUS 4MICA 2IL1A 3WWYA 1D7AA 3T1VA 1AQNA 1V8DA 3PD1A 4IX1A 4CQJA 2KSQA 2VDWA 4Y67A 3NM4A 1ZMXA 5H3LA 3ZDFA 4N40A 1J2UA 1DEKA 2CFTA 3V9PA 3ZXYA 4NU6A 1O97C 2JIPA 4GYJA 1MB2A 4MWGA 4I4NA 1TL7C 5T3YA 4FR5A 5DWQA 2OSVA 2VCEA 3QUCA 4LHXA 1FLAA 5I8ZA 1M2OB 3AXSA 2ERCA 3ECAA 3T54A 1S02A 2NQ2C 2V03A 3FJYA 1FC0A 2NAFA 5KPJA 3PLAE 4XI9A 1U7PA 5TMEA 1C14A 4I5DA 2RHDA 4CKEB 3R4CA 5LQMA 2JHCA 4CG2A 5A5VA 1QYIA 3PRYA 3FF1A 2ZR0A 3STVA 4H0NA 4X3PA 5FBLB 3RLIA 4D9MA 4NCBA 4JMLA 4M0KA 1YZFA 3HL0A 3HU3A 4I9FA 4UARA 1U5BA 2WIDA 1Y5MA 3ABSB 3KU1A 4CKBB 5A0TA 1FP4B 1PJSA 3QTLA 3B8EA 3RSFA 1ZWKA 1ULBA 2FPGA 1V5GA 3MTAA 4OHRA 5AKEA 5FO0A 3T7CA 1A5TA 2X14A 4D4MA 3K8QA 3MT9A 4A7PA 1AMNA 4NWIA 2QSUA 3GP3A 4J2OA 4YRSA 1Z7WA 3S70A 4CLXA 2FLWA 3HUDA 2IKQA 1D0IA 3OXGA 3I9KA 2SKDA 2WF8A 4RVFA 4M8KA 4JKOA 2H0QA 1QVRA 2K7FA 1QIFA 3KBOA 3UNXA 1ABBA 3I9OA 1R6VA 1P7YA 1X1RA 2ODQA 3K73O 2AWNA 2VN8A 5ALIA 4FMDF 5DLYA 1V47A 4NFSA 1HQKA 3WK7A 3WQSB 1OJLA 1P62B 2B99A 1WLYA 4HO1X 4Q1EA 5E7MA 2LEOA 4KTVE 2YVAA 2ZJ0A 4KQXA 4RK4A 1GA6A 1V9CA 2FZEA 2EKPA 1IY5A 4I8DA 3QQPA 4KRYA 1MQAA 3EDQA 3HSSA 2O52A 3K6KA 2BFDA 4AMBA 4D4KA 2OD9A 4EITA 3HCPA 4NZ9A 1L5GB 3N0VA 5CT5A 2M1ZA 2VHUA 3Q3EA 4IDAA 2PUWA 1IQRA 2J48A 1Y4UA 3EW9A 1UKBA 4IGIA 1Y8RB 1GT6A 1Z83A 4IIUA 5HR5A 4FCTA 4PLFA 2N42A 4E13A 4BEWA 2H4YA 4K8RB 4LRWA 2AZMA 3ZV3A 3COWA 3HLTA 1WUYA 3ZLTA 3B1ZA 5DHAA 2W8ZA 4DC1A 3INTA 3KSRA 4I1IA 4NECA 2W6PA 9GPBA 3PEFA 5DEIA 3SVLA 2YXLA 1RKQA 2QE6A 4ZAWA 4IVRA 5B4UA 3AVVA 2FG6C 3KLMX 3ZX4A 3U3MA 4G4GA 5IT9A 1COWA 2PZ8A 4J0FA 3TTVA 4DNFA 2C8KA 2O6LA 3EH1A 3D6VA 3UMCA 2PZAA 2P3OA 1DBRA 4KBFA 4Q3NA 4A2PA 4L3VA 4NU0A 3C5EA 3I1JA 1OFIA 3A2KA 2ZYSA 2BTOA 2ZU6A 1A1SA 3NDPA 3RFFA 4AMYA 1D0SA 4XTCS 2OBFA 1ELOA 2RHGB 2G07A 3NTOA 4M1YA 4DGQA 2CZCA 4IJVA 1Y8AA 2BCJQ 4E5SA 4C2UA 4RD4A 2H48A 3WJ2A 4LE1A 2FN9A 4EPYA 1K68A 2JGAA 4E1RA 2QMOA 1UKEA 3G7NA 4M55A 2R1ZA 1KBEA 1K7CA 2Z09A 5CEEA 2W2XA 4OBBA 2POCA 4MS3B 2C2BA 3VNRA 3NKVA 5CM2Z 3CLHA 3IS3A 2D0OB 3A27A 1D2CA 3KBBA 2Y0MA 4JP8A 1U5CA 3G9TA 2JH3A 3L4SO 1OW3B 1F17A 5HIKA 3ZIUA 1QIIA 5THXA 1LI4A 3GUVA 3R75A 5KJ1A 1C30A 1M83A 1Z75A 3L0YA 2Q41A 5EHGA 3OEYA 4GRAA 5C5DA 3JS5A 3ABRB 4OCZA 2HADA 3CUSA 1F3OA 3ZHUA 3W6NA 2NV2B 5HKKA 1QB8A 3PQEA 3Q5GA 4IOJA 1V1HA 3UK1A 1CR1A 4FEGA 1QR6A 1AUQA 3FUUA 1QTIA 3CE6A 3TNJA 2DTDA 3EDOA 2PLNA 1CYDA 2JEZA 2A5GA 3TSCA 4DCTA 5DNWA 2A94A 4HT3B 1NXVA 4QBTA 2WG1A 4C0QC 2TMKA 4NCAA 5T7BA 1WMDA 3KQNA 4CEJB 4LCBA 3MTBA 5IU6A 1A8PA 3CLUD 4L73A 5LNK6 4MW0A 2F2TA 2G17A 2H2FA 3VKUA 1QOPB 2WTAA 5HW0A 3LHFA 4PXYA 3DKPA 3EG5A 3KZOA 3ERCA 2SGDI 1PJQA 2JFBA 5EN4A 4ZV9A 1Z5VA 2HJWA 2CHFA 3P94A 1KPHA 3HJNA 4NX2A 4PLGA 3Q3CA 4MR9A 4CM4A 4EX6A 3MMZA 1PT8A 5AHOA 1LU9A 3AKEA 1GPJA 2ZBEA 5CJPA 3BN3A 1Z18A 4DFDA 2JNWA 2ATVA 3I76A 3OKAA 4HBGA 1RRMA 4ZC8A 2JGDB 3A4NA 1QPGA 5KYGA 4YACA 4I1VA 4ZCMA 4QXAA 2BAGA 3WC4A 4UVHA 4BOYA 3FNBA 3WGKA 3WL7A 3F1LA 1Z0AA 4FYWA 2VBIA 2D1RA 1RJGA 3BOSA 3SOPA 3KC2A 3SQOA 2ROQA 3EQ8A 2EHDA 4IRUB 1ZGBA 3R40A 5TT0A 4C7KA 4DIOA 4N0EA 5F33A 3AVYA 3OKFA 2Q27A 1AN1I 3QJGA 3AKZA 2C1XA 4J9UE 3EGCA 1ZD5A 4DV2B 3FFWA 4BGIA 2NUAB 3OPVA 3I6YA 1Q95A 1JG7A 1D1TA 3I5XA 1BCSB 4DA7A 3CR3C 4WZZA 3FPBA 4NEQA 4YT5A 4BNIA 2AN1A 3IALA 4XFJA 3T3DA 2AG0A 4RYLA 3M7IA 1Y5NA 3TRHA 4EG3A 1JU3A 5ALEA 4GZMA 4M1WA 5IJZA 2B7CA 1KYTA 4LC0A 4I6GA 4J1TA 4N0MA 4PGAA 1RCFA 1L7PA 1ZS9A 4UBOA 4R51A 3EASA 1L7DA 3BCSA 3MJCA 1TT7A 3G2MA 3NFYA 3WGHA 1LTHR 2UZ1A 5DTIA 3JQAB 4YQFA 4QJ3A 2UZIR 4DB2A 1ZZGA 2VTKA 3OP4A 2FJ0A 2HA2A 4LMPA 3AU9A 4TYQA 1DGQA 3G2KA 3GRVA 2BDEA 4AICA 1GTG1 2VDNB 2YJ6A 3DWGA 1E9SA 5F64A 4RJIA 3EDRA 5KS2A 1CIJA 2CFCA 4FGLA 2IHZA 2IHUA 1T1JA 3F1KA 4K5QA 2ZQZA 3HH8A 3GRRA 2I4IA 5CYOA 2BSXA 3FAKA 5G40A 4C4YA 4QVIA 1KKMA 3M9WA 1EGAA 5LUBA 1BOOA 2W22A 3UTCA 4CDRA 3LD9A 3W79A 5KNDA 4LSZA 4YUWA 1RZRD 3TR6A 4BECA 4M0MA 1PWZA 3EZLA 3EJ6A 2EKDA 3GARA 4X5OA 1VYTA 3V1LA 3QF4B 4B40A 5A06A 2YDYA 3IULA 1AA9A 1AVTA 3D59A 1M72A 3HNPA 3NWPA 4DTIA 1QP7A 3MJFA 4DWOA 3WB0A 1NKTA 1AQLA 2V98A 3JD2A 4LK2A 3LT2A 4L07A 3LYHA 2A0YA 2UYHA 2HOQA 5BW8A 1W581 4H31A 3UM9A 5JFGA 5KOHA 4Q9NA 1P33A 3I04M 4JK3A 3EPKA 3DZJA 2AOWA 3EZ7A 2F3UA 4EFMA 3Q87B 1GL6A 2BGTA 3KS9A 4L50A 4N76A 4F11A 1IDOA 1SUSA 2Q6OA 3GJQA 1Z0DA 1U7UA 3BFPA 3NHWA 1DX9A 1FOEB 4H7KA 4YV7A 1PDVA 2RGBA 2Q8NA 1BROA 2EYQA 3B3FA 1LI7A 3QBDA 2OHXA 3ZWXA 5KO2A 2WT4A 2EDAA 4OV6B 2JC3A 4AUMA 4GGMX 1QCDA 1SBIA 2ODPA 1G8YA 4JGBA 4Q3BA 1KDZA 1V1RB 4TTSA 3R9XA 1GSIA 3FCCA 1ZJ5A 2VG8A 2BFDB 3W3AD 3AUXA 1QFZA 3LUFA 1VMEA 1TU4A 2G5GX 2W2KA 3A6GA 1O4WA 4FW9A 1RCTE 3T3HA 4ML3A 4HQNA 1MJGA 3KXIA 1AOXA 3U3RA 4LVNA 4DV6B 1SBCA 2WJ3A 5WRFA 3UJCA 5JNWA 2VZ8A 2PCJA 3SNHA 2BHNA 5LBIA 4TTRA 1TYCA 2IEIA 1UKAA 4U4AA 2WPNA 3IE0A 5GPBA 4QRHA 2FEWB 3LBYA 3NORA 7YASA 1QV9A 4ZALA 2ZB7A 2PCLA 5FQOA 1A71A 4ZVLA 3FKSD 4PSKA 3H0KA 1XQ6A 3TVTA 1AHIA 2PRSA 2QTVA 4LRYA 1BVRA 2RJNA 4HNQA 4LXYA 4PC1A 3V00A 4MUAA 1RLTA 1ZJYA 4BMOB 4WXHA 3PDIA 5JWRA 2QBYA 5CTJA 2OTCA 4XVCA 3GLIE 2PGOA 1ZHHA 3FOBA 5C3UA 4GQBA 1TKRA 2NN3C 2Q49A 4PC6A 5DOZA 4KFSA 1A9XA 1KJQA 3C7TA 1YC2A 1KOLA 3V34A 2ODAA 3MHPA 3PRKE 5I4CA 2C4WA 1TVMA 2I6QA 3AUKA 2CNLA 4QJ5A 4ASUA 1GKIA 5LN1A 1SD1A 2EHJA 4AJEA 3RS2A 3ZDEA 3L4JA 4WLVA 4TUYF 3RASA 2XJ9A 2G06A 2IP4A 1X1QA 4KVGA 3HADA 3A6KA 3X0DA 5K4HA 5LM3A 4UCFA 4O8ZA 2XNHA 5EWLA 4BGDA 1SUAA 4ZYLA 2X5NA 5AKKA 5GP1A 1W49A 1E3QA 3BIXA 5DN6A 5FBKA 1CHOI 2Y0EA 4M1KA 3VR4A 4RC9A 1PNQA 2PLWA 3L9XA 1TZCA 2G04A 1ISMA 2BOVA 2O2DA 1G8JA 1AGRA 1PL0A 2VPXA 3GGSA 3VPCA 1O87A 2VDPB 4RKYA 2V7EA 2XF2A 4NULA 4EA7A 4EYEA 3ZWMA 3DWFA 4ARBA 2YZ7A 2HB6A 1MDBA 3CUUA 1LDMA 2X1LA 1YB2A 5JTTA 4OF4A 1GLVA 5TF0A 2B4YA 1GYQA 3SAJA 4HDNA 3OCZA 2DPYA 4BHTA 1ETHA 1T9GR 1DAGA 1JU4A 4NABA 3PUZA 1S3SA 3L92A 5I51A 2EZ9A 4Z9YA 1HMYA 2PT6A 3T1HB 5A03A 5A6VA 2ZUTA 2G76A 3DSRA 4FR0A 2ZRQA 3E15A 2VA9A 4Q12A 2ZT7A 2OBNA 3LHSA 4MSUA 3ENZA 3L1UA 2Q5LA 2W98A 4OTZA 5K0TA 2CHUA 2XWJI 3ROFA 4U2GA 4YRPA 3SICE 3W0LB 4B7AA 4FQ7A 4P5PA 2QQCA 3F8WA 2WJIA 4XQ0A 4BNTA 3UJ7A 1NONA 4KXQA 1OI3A 3CRQA 2X3YA 2L19A 3GFRA 3NOVA 3OJEA 3PS9A 1C1YA 3EXHB 1S2GA 1E32A 2B8WA 4QUDA 4AURA 4JI5B 1X0VA 3DLIA 4CR8A 2PGNA 2GAOA 4NESA 4X7RA 1LJLA 1Z5WA 1JALA 1IJKA 4KSBA 4KXXA 3UQZA 5IASA 3D3WA 3RADC 1BDIA 2X41A 3TS1A 3ZIDA 4BLPA 5I9MA 1T1EA 2JFOA 2QDKA 4K2AA 4Q6BA 5KC9A 2XH8A 5AKHA 2XUIA 3OOEA 2Z58A 3TEJA 1N3BA 3HKDA 1KE2A 4MRRA 3W8EA 3ZGVA 5LQAA 3IMGA 1T5SA 1EG7A 2CJWB 5ER6A 3G2QA 3WAJA 3KJNA 2V53A 3HYCA 3B1YA 4D4HA 1RHMA 3H05A 1SIWA 3ZHCA 3D7MA 4S04A 2ZJYA 4ZXFA 4RA9A 5ENVA 1BHQ1 3MNFA 3NP7A 2Y3IA 1C8VB 3HYLA 4ZAFA 3OCWA 3TTXA 3B82A 3C5HA 4CCYB 4DV7B 4NY1A 2RKBA 3AY0A 5JV5A 3LRPA 1RXCA 4QSMA 3ET5A 3QE4A 4KIFA 4RDHA 3RFXA 1UBUS 1B8UA 3TLCA 4RTJA 1PJTA 3H2BA 3P0JA 2D2IA 3TLMA 4TT3D 3DH0A 4HDCA 3R0ZA 3KIPA 1EUCA 1FNNA 1G3UA 1VJGA 1KFCB 3H5NA 4NZPA 3MF4A 1AE1A 1ITZA 1P0FA 1WB6A 1ZM2A 2JHFA 1DTWA 2UZ1B 5GQSA 1NC3A 2BHSA 5EQJB 1PVDA 4GP7A 3ACDA 4D8TA 2V7QA 2O4UX 3HKEA 5TVGA 4KAJA 5C80A 5AVZA 1AK9A 1DPFA 1M5TA 1G5PA 4OSPA 5G4LA 4YDSA 1OXVA 1L4GA 4AVYA 2MT9A 1W4LA 4OVKA 2GNPA 3AHCA 2FHSA 3GZTB 1GTJ1 3BH6A 1F4VA 3G85A 1FW8A 2CCGA 4I4TA 3SS8A 1JR3D 3FYSA 3BT7A 3BDVA 1EP3B 1T24A 3EUEA 4BV9A 4BBJA 3COZA 5C7YA 4L8WB 4OJTA 4Y6LA 1YJBA 4EF6A 3NNNA 1MC1A 4HH0A 4GOLD 2F17A 3E53A 3PFCA 3CXUA 4IV5A 5DZSA 3BJMA 3IP6A 2V0GA 3QUSA 4HVCA 1SBYA 2P6OA 3VJLA 4BVFA 2XXAA 4BKUA 4IBOA 4NDAA 1PR1A 4RFLA 4YHHB 4DIBA 4KQJA 1LRKA 3KQYA 3DAGA 3OUTA 4XXHA 1XZGA 5ITZB 3ER9A 4Y1EA 3AFNA 4EJ6A 4MIOA 5KOHB 2OBLA 4NBUA 3OZTA 3D0QA 4FYMA 4XYGA 3UWPA 7AT1A 2P6NA 1Q1GA 3LQFA 4E1BA 5D85A 1GDHA 4CCWA 1AXEA 4Q21A 3RSZA 3E27A 1EX1A 3OJXA 5IW8A 3C6ZA 3ANNA 2YV1A 5F9HA 3B36A 2WHQA 3IP3A 2PKXA 1J0CA 3BHIA 1OZGA 5BW4A 1FJHA 4O63O 5A5FA 3DMYA 2P9TA 4XDZA 1NI4A 2RD2A 1SKBA 2HYIC 1M34B 4C87A 1WXFA 3SBXA 3KPVA 4V2UA 2YTZA 2D4HA 4XPIA 2W2KB 1QOZA 2Q9CA 2XUJA 3UHPA 4F3CA 1GM5A 1VIMA 1I5RA 2M98A 4DCVA 3F0TA 4DLTA 2BKEA 2CXPA 1QCYA 1DBWA 4UTOA 2OYSA 5LYYA 4OSEA 3MWEB 1H4VB 1FFYA 2AZTA 4Q19A 4CNQA 4W6QA 4MZXA 1Q1NA 4TKVA 4YH1A 1B0UA 2O57A 4RE5A 1YIDA 1ZJJA 1O95A 4FHGA 4WK2B 3R5BA 2Q7XA 1M54A 2HY7A 4GZ6A 3TFOA 1KJJA 5I7RA 4EL0A 3PPWA 1GU0A 3ZEAA 1XXHA 1OPRA 3IXMA 1E1LA 5AVSA 4WTOA 5IYZF 2QBYB 1NG1A 3OOJA 3UK2A 1J7KA 3IQHX 3KSZO 3OJ0A 3QUAA 1A9XB 1DT3A 1USKA 4Y1GA 5BWBA 1VKNA 4QHTA 3TAXA 3RTEA 1LFDB 2W0TA 1B76A 2HDWA 1IW4A 1D03A 1WZEA 3C16C 1FP7A 1XHLA 2ZT5A 2GN4A 2ZQ5A 3DZHA 1AY0A 1RTKA 1T4CB 2YH2A 5LZ5A 1NXWA 2IZ7A 1Z0IA 1JEQA 2PRKA 5IJWA 3SP1A 4KR2A 1PQPA 1NW4A 3JASA 4WEQA 3F3KA 3WWDA 3PNLA 1MORA 4RACA 2OHGA 3CRNA 5EWLB 3KETA 3FSEA 3H1GA 1J6UA 5AJUA 2E2WA 5EIAA 4XIIA 3TOBA 1E9DA 1NX9A 3CUVA 3CF6R 4M53A 1GTSA 3JQQA 4HQRA 5EIEA 2BJVA 1XDZA 2W6ID 1ONPA 4GI3A 1SPBS 3T7TA 2PGIA 2DKNA 2GARA 3AUJB 4C03A 2IYRA 2NU7A 3KLBA 3WFZA 4V1CI 5JS7A 4JEIA 1Z6AA 3MN1A 3STUA 2UZ4A 1E2LA 1TBOA 2JGJA 1N1MA 3COVA 1M1NA 3OZUA 4MYHA 1EFTA 3JVDA 4ILEA 3IJ5A 2R87A 3L1HA 4WK6A 1WIWA 1B0PA 4ZFNA 2JKZA 1G8HA 4HN4B 4P4NA 2AFRA 2C42A 4JI1B 5TQ0B 3WLMA 4HDNB 4G24A 5AVTA 5HJ2A 3ESAA 2NWQA 2XRYA 3PD7A 1Q5PA 1VPLA 4IDBA 1LV7A 4W63A 4ZQBA 1R6AA 3H13A 5IS2A 1FLNA 4EHKA 4N9WA 3OPYB 3MJVA 3Q0IA 4XJSA 1XF1A 4ALIA 2P77A 5JJLA 4LN1A 1RI5A 1JR4A 1V9LA 4L6CA 4CV2A 5AW7A 5COAA 3CVWA 1YDHA 2DQKA 4Q3OA 5TEWA 3GOHA 4E32A 4ZCLA 2G83A 1EAMA 5F76A 2HREA 3EVEA 3K7EA 4J7UA 1XB2A 3EBPA 1ZSYA 2HDNB 3CH5A 4GUAA 2OOKA 4IF4A 2I5PO 3TIXB 1P2FA 5EZSA 2QE7D 1MW9X 3K2IA 4OBWA 1VA5A 1ZUHA 1ZQ1A 2OUKA 2B1RA 2WUFA 4PTZA 2ZI9A 3NBFA 3WK4A 1P19A 4ONEA 2OCGA 3KJFA 3WYCA 4EQ6B 4AKGA 3L7NA 4UTXA 2W4IA 1A8IA 2VEOA 3I4CA 1SWWA 4P58A 4DUYB 4KFCA 4OB8A 3AUYA 2IQIA 2Q46A 1JH8A 4DWJA 1PG5A 3HKDB 4E0BA 4YAUA 1CRPA 3LK6A 5AJYA 3EDCA 3QFSA 4LZOA 1H69A 5BSTA 4B4OA 1XMJA 2BLLA 4OJQA 1NF3A 2P6PA 2VSNA 3QVLA 3QA9A 1BMOA 3IERA 1RDFA 1ZVKA 5TVKA 4RA9B 3ZV6A 1TGVA 4OI4A 1XZEA 3TGPA 4L51A 2WUWE 3AGPA 2FSVA 2PZBA 3NTLA 4P9NA 4KQHA 5FHRA 1W88A 2SBTA 4K03A 2QMUA 1W1UA 4TZTA 2NSLA 2EGHA 4DV0B 4G63A 3M83A 3W1VA 2G9UA 2ZYAA 4Q00A 3I39X 1SH7A 2BJWA 4BEVA 5HCUA 1J99A 5K1ZA 5HZGA 3GNLA 1K6IA 1MJFA 3CRZA 1ICEA 4LMBA 4PSVA 2WSBA 1P61B 2V96A 1SR8A 1VHJA 2XNKA 4HF7A 4OP1A 4DZRA 5C7OO 3PEYA 1TAUA 5CFQA 1Y3BE 2ISCA 2XE6A 3BRWD 3HKEB 4I6JA 1P4SA 2HEGA 1LVHA 4MA0A 2X0FA 5F5NA 1GCAA 2WD9A 4V03A 1F1JA 1K4KA 2V9ZA 3CWCA 5DHQA 2Z9CA 1IRXA 4AS1A 5DYYA 5CP8A 1TAQA 3LKBA 2YHSA 3WB1A 3ZS8A 5JRZA 2RAVA 1GFWA 3QKSA 2C9YA 4C6RA 3SM9A 1ADJA 2BE7A 3UB2A 1W8IA 5TARA 2D2VA 3HWX1 1G0NA 1WXXA 2X4IA 4KQGA 4UEQA 2J3MA 4X7MA 4ZVUA 4OXKA 4R1LA 2LCQA 2XCTB 2RGNC 4EYOA 3NHYA 3PX3A 4V3CA 1F51E 3HI6A 3FYUA 4LJ9A 3VTKA 2YFHA 3A2MA 5TLSA 2H3EA 1PLKA 4DYHA 2WFLA 4HRAA 1GUAA 3HO8A 4L7VA 5HMLA 3GGOA 2VAWA 4PLVA 3GXOA 3FOCA 3NM6B 5CBKA 4BCDA 4Q0MA 1HRDA 1M66A 2I2BA 5JAZA 3IBFA 1ZM7A 3PF8A 1YSCA 2WJHA 3IEUA 1KIFA 3JQGA 3MBIA 1YJQA 3OCUA 1NZJA 3PC6A 4RNDB 5J5AA 4BEJA 1TNDA 3CLRD 3G5TA 1CVIA 4IJ6A 3S8EA 4RTSA 3A3PA 3OF5A 1S3FA 2FFRA 3SZUA 1Z6QA 2AC4A 4I3FA 3TQCA 3WIOA 1Y82A 3OPQA 3C6XA 1XQWA 1JFFA 4C2BA 3PR1A 3TSOA 1NI4B 4JJ6A 4LPSA 5DGCA 3TRJA 3PUYA 3KEMA 3NH9A 2Y1OA 1F6BA 2R8OA 4KPYA 2VT3A 5I3ZA 5IM5A 3TZHA 3VR3A 1U28C 5DFAA 3W77A 5HF5A 5TJ9A 1KR2A 4MPRA 4RTOA 4TKUA 1U8TA 2XLCA 1J2EA 3L6EA 2WSIA 4IKOA 4Y6GB 2IVFA 3CRVA 3V33A 3D64A 1QKKA 1R0RE 3F96A 1LC3A 4D8YA 2CF6A 1X9GA 1CY8A 2VF2A 3V1UA 3VR5H 4TKVB 5J5VA 2J0SA 5CNMA 3HM9A 1OFHA 2XGMA 3IDZA 3OQ1A 3S2EA 2CNDA 1A9QA 3FAZA 3E9NA 4MV5A 1PLJA 1KY3A 4Q9HA 2JIMA 1DIOB 1K3TA 1P6UA 1YOVB 4BX9A 1Y8ZA 4NEHB 3JRWA 4X9XA 2RSLA 1XXHB 3INNA 3NC4A 1E6CA 3HKCA 3P2KA 2WGCA 1M2NA 1GOTA 1MFPA 4WOPA 1BE1A 3GEIA 1UMDA 3CLTC 5JSQA 4RF5A 1ZJWA 5I7EA 1GDTA 1IPHA 2P30A 2QTGA 3C7DB 5K3OA 3LG2A 1ZGJA 1GPKA 1QIJA 2A9PA 2ZS7A 4BPRA 3QNUA 5KHOC 3VU8A 4RK0A 5J4LA 3OOHA 5AKGA 4LCEA 2ZXEA 3IGFA 2OD2A 1C0IA 5B6IA 2WB2A 4G4JA 3VU9B 5BWOA 4C08A 3U7FB 1NQOA 1GT91 1VDMA 5SZJA 1EHCA 4EB6A 1VKHA 3O82A 4YUVA 3L93A 5LQCA 2B61A 2O4CA 4NCKA 4AMZA 1P1HA 1QO7A 2AI3A 3Q0EA 1UM9B 2QHXA 4PGHA 4EJMA 3LCVB 3HA3A 4OLBA 1MOSA 5F98A 1MLDA 3WNDA 2QS9A 4HGNA 3GA7A 2E0IA 4QWWA 1FZTA 3N8DA 2OV4A 4AQDA 1PFKA 2IHVA 2I1LA 1IAVA 3ZTTA 1XP8A 2OAEA 3GMIA 3FETA 3LVFO 1JSXA 3R9WA 2VNIA 1GU7A 3ZYZA 3L06A 4LRSB 2XMGA 5A9RA 3ORYA 4N65A 1XRQA 2HWKA 1CPYA 2NTEA 3KEFA 4P7FA 5CFOA 3OX2A 2BGJA 3NM5A 4TS3A 4OAPA 1MOZA 1RD4A 3IPAA 4X97A 3O3MB 1JRLA 1OILA 2Z4RA 4RLSA 1SCNE 5L4LA 5LSAA 1XLUA 2PKEA 1J5EB 3PFGA 2OHJA 3R7WA 2GHIA 2RAUA 3AHIA 3K09A 1U9CA 1KK2A 1YI0A 3RPEA 3T1OA 4EPVA 2D1SA 2ZTHA 3T6KA 1PCXA 4RGVA 2OV6A 1R5BA 4JUFA 3NGMA 4QGBA 4E5UA 5BURA 3RTBA 2LVBA 1BEEA 3WBBA 1ZYUA 3OOWA 3IAAA 4COOA 3FNFA 3UGLA 5HKOA 1Z8HA 4DCSA 2XKKA 4A4DA 1NW8A 1V0JA 2VUHB 3A1FA 3T7DA 3ZXSA 1BJRE 4E3WA 4FX2A 2XTZA 1GPDG 2JCBA 3R6LA 3KKLA 3M9LA 2W70A 1FNCA 1YZUA 2YX1A 2Y1GA 2PA0A 3DTVA 2PJDA 3OLWA 4NV0A 2L42A 2A86A 1D5CA 2BSAA 2XODA 4DJEC 3RAFC 1T5BA 5KSYA 5JJBA 3TEMA 4F12A 1KZ7B 3FNRA 3VHRA 1OB2A 1BVUA 1TIPA 1E64A 3BD7A 4EZEA 4MGIR 4IYRA 2BUSA 4F4HA 4MUMA 5IFKA 1U2QA 4CM3A 1M8FA 1JZTA 1QO0A 2A9FA 2WV9A 1PNRA 4DM3A 2RJOA 4MQUA 4JU9A 1FNSA 4Z9FA 5NULA 3R3VA 2EKQA 1WPQA 4EGQA 4JLNA 4LQCA 3F3YA 4PGGA 1PK8A 1LF0A 2VH2A 1X42A 3LO5A 2G8NA 4QARA 5DNCA 3KYIB 4IQ0A 4J2TA 2J5RA 1Z7KB 2GEVA 2WVAA 4H0CA 4IXTA 1T1IA 4CL2A 1EFAA 2D5LA 1NVWQ 2IRWA 2C0QA 1IZYA 4IJKA 5D6OA 5DI3A 3VGPA 3ZQ4A 3BJEA 3C6QA 3W78A 2LXNA 5JJ5A 3BB3A 3Q8KA 5GJBA 5EMJA 1K7XB 1YD7A 2ZIFA 1X0XA 4RW0A 4KTTE 5G4KB 2V6FA 4AY6A 3MLBA 4RKWA 1L4UA 1XEXB 2P68A 3QWFA 3RM3A 3FKJA 4JFAA 1GXSB 4CF3A 5GTDA 3NBMA 1U8XX 4G1EB 2NVWA 3ADPA 3AMVA 5KJCA 1XCOA 3CF4A 4E6EA 2RGCA 2XV1A 3ESRA 3N28A 2BY4A 3FB1A 1CDOA 4BFZA 3N0RA 1CJCA 2W6QA 3DEKA 5SV2A 5A3VA 1VBKA 4RK1A 1WR8A 2XA9A 1L9KA 3CZAA 1JQJC 1UFKA 4UHHA 5DYWA 1X80B 2GAFA 3TTTA 4D3YA 2P7IA 2XXBA 3KOUA 4TRNA 1U8ZA 3EVZA 1YCFA 3NIFB 3V1YA 3MGKA 2YW9A 1C1DA 3E03A 4K6MA 3MG9A 1GNPA 4PO9A 2P4HX 3H97A 2M6LA 4IDHA 1UFVA 3SBDA 3FOEC 5F9MA 3HXLA 4WNAB 4D5EA 4RNCA 1NT4A 3UPUA 3RVRA 1XMXA 3TQFA 1ZUWA 2IXGA 1J00A 2NTVA 2P2SA 2YWEA 3FYUB 2XI4A 4A0FA 1KMCA 2F9LA 5JH7A 2PD4A 4HJRA 5HP4A 2W2LA 4R8SA 1SVNA 4EI2A 5JPCA 1BRMA 3F6RA 3GT7A 2ZRNA 1EX9A 1AB5A 2IOQA 3C3WA 3PQ7A 4RA6B 4EPRA 2GPNA 2ID7A 1E1MA 1S2DA 2XECA 1ZDMA 3AUSA 1H2WA 3WL4A 5BN5B 1OV4A 1TMKA 4H6VA 3Q4GA 3IPCA 3MTJA 4GFDA 1UQUA 1PYDA 1CE8B 4GGOA 2EU8A 3O8QA 5DXJA 5BRJA 5JMTA 3AM3A 4QEDA 4UOZA 2QT0A 3SJ7A 1XRSB 2JLAA 3KP1A 5ERXA 1JSRA 2AB0A 3UJ3X 5HM8A 5BUSA 4FFMA 4MV9A 2K5UA 2NOAA 2XXJA 3L8YA 3UBMA 3EQ2A 3V7FA 1I7DA 2GCIA 2HHAA 2BKVA 3O0DA 3ZW7A 3T3OA 1KMQA 5F9FA 1Q1AA 5CYPA 2I7DA 4XLTA 5IEBA 4ZOBA 2E6UX 4PINA 3DZBA 4BRUA 3ZWPA 1FNBA 4B3IA 2XCOA 3RAGA 4TKUB 4F9FA 1ESCA 2DHDA 4IW3B 3AVQA 3C3KA 3PC4A 2J3HA 1KQOA 3LWDA 3MJSA 1AGYA 2F8LA 1D6MA 3UICA 2JLYA 4F71A 3DE4X 2IYNA 3Q72A 4P7KA 3SLRA 3SEQA 4QFCA 4RHTA 4BNVA 5D87A 3JU3A 1PTQA 4DPKA 1XPUA 4WRRA 1VA4A 1WJGA 5EEHA 5TPZA 2ZVQX 1AKVA 4WKCA 1WHTB 4YLYA 5BNTA 2QXTA 1B0ZA 4JQOA 1JKFA 5LQJA 3HKCB 1OJ7A 1UXOA 4INOA 4DF3A 3VYSB 5H80A 1T2CA 1UMDB 5J2UA 2PM8A 2I9PA 2I3ZA 4ZT4A 2VBFA 2WMDA 3CZ9A 3NAZA 4GS5A 3ZXIA 3EXHC 4B48A 3UXMA 2JGKA 1H0RA 2ZVJA 3QJ5A 1A7UA 4FNAA 3M2TA 1QIKA 2MDTA 1ZIXA 2R7MA 3V1MA 4QYSA 5FA5A 1I1HA 1N3LA 2WWIA 3CTMA 1Y89A 3W6OA 3QEMB 1MGPA 1BA2A 4L3OA 2YIMA 3R5JA 4U2DA 1JEEA 2XQGA 3DVAA 3OHSX 2O06A 5I7FA 3AL0C 3CUWA 4BFUA 3NC1C 1VGQA 2OXFA 4AKIA 4CWAA 1J0DA 4AJ9A 1HYBA 3JARA 1XTUA 2PQ8A 3U5TA 5A1TA 3WO1A 3FYHA 2Q0QA 2X2PA 2ANCA 1SVSA 1RQLA 3IBSA 4JZYA 4FM9A 1IK4A 1Z4QA 4KVAA 3LBAA 1NMSA 3L2OB 1LLDA 3N9IA 3P0EA 1AXGA 5B57C 1CJVC 4CBVA 3E9MA 3DLHA 3QNWA 2QJFA 2AK3A 5EQDA 5BUCA 4FFBB 1G6KA 3MEKA 2NU6B 5AK0A 1SULA 1KOJA 5IFLA 2R6JA 1G5IA 1BWQA 4RHYA 3U4IA 1FA9A 3OPMA 4H2DA 3KHKA 4FX5A 3R8XA 4TWBA 4A24A 3O1IC 3ZYCA 2VSFA 3F5DA 3HJFA 1SURA 2CNNA 1KSFX 1RJ9B 1V6AA 2QD1A 5C4MA 1D4OA 4N5IX 2VJKA 1TAHA 2H2WA 4YCMA 1V16A 4Z0TA 4QASA 3TZ6A 1RNLA 1VG1A 4HEA6 1ZHOA 3QYFA 1KDVA 3ZC3A 1E0AA 1UDWA 3NEYA 4G0ZA 9ATCA 3PEWA 3WDKA 3HUUA 1ANKA 3R7WB 5BQPA 3KUXA 3OPXA 2O1EA 5EUCA 2C1ZA 1X94A 3IOYA 1Y1TA 5K0FA 2AMJA 3VYUB 4G1FA 1WUJS 1Y3HA 1US8B 1KMMA 2AOVA 2QLMA 3CJTA 3MCUA 3QKRA 3I9JA 2Y1EA 4HGQA 4JLKA 1JAIA 5FNVA 2FPXA 2FG5A 2IC5A 3Q88A 3FW1A 3EQ9A 2C7BA 2FWMX 4C30A 2PYIA 3NW9A