3TO7A

Crystal structure of yeast esa1 hat domain bound to coenzyme a with active site lysine acetylated
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
276
structure length
275
Chain Sequence
EVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone acetyltransferase ESA1
publication title MYST protein acetyltransferase activity requires active site lysine autoacetylation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 79
structure length 275
sequence length 276
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2011-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3to7A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 3to7A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3to7A02
2GAUA 5F64A 4HLXA 4CS0B 5FFZA 4AVAA 1U6MA 2JTVA 4L9JA 2HQRA 2W84A 5ISVA 4CHUA 5ILSA 2QBYA 2E1NA 4P55A 4YGOA 2FU4A 1YX0A 1LEBA 2BEIA 2GA2A 1B9NA 4JWPA 2Q7BA 1H0MA 2BBYA 2PMHA 1ZLKA 5HMNA 2B3UA 1ZN2A 2IL4A 3WTZA 2FRHA 2WPWA 2L02A 1QPMA 3TKYA 2Q8KA 3VEPA 1KUVA 2C27A 2HEOA 4G7HF 3REOA 1R36A 5D8KB 2PR8A 4HDVA 2DT5A 3VFZA 3RJPA 2Q4VA 1MDMB 2P6FA 4E0AA 4HBLA 3TT2A 4EGZA 4XSZF 1FYLA 3FHZA 1ZLJA 3CO7C 2NMTA 4CRYB 4OADA 1SAXA 2FA5A 4HA8A 3K1PA 5JFRA 4OIPF 1SD6A 3D0SA 3LA3A 5IV0A 2WV0A 1JHHA 2Q44A 4HX4A 3KKWA 2K4BA 4K30A 2XAQA 1DPUA 5ICFA 1DPRA 5EBVA 2QM3A 2XRNA 3F23A 4OIRF 1WI9A 3GYHX 1ZH5A 3I53A 1JXSA 3GFIA 5JR3A 1S7OA 5H84A 4GGGA 1KYWA 3RI4A 2XAHA 1XGOA 5BPDA 1RNLA 2V1DA 1PU9A 4AVPA 1IXRC 4IVNA 3F8NA 4EQQA 5KTAA 2GANA 4DNCA 1IXCA 2VBYA 3I59A 1FC3A 2A61A 2LF7A 2HFHA 1RUNA 4FD5A 1VHSA 2CQKA 4FHTA 1S7AA 4HW0A 4IPAA 4KLWA 1FX7A 4KUAA 1LDDA 3LAJA 5E20A 1M4GA 3K1MA 3WTWC 3JVNA 4QBJA 3WR7A 5ICCA 3GF2A 3LD2A 3DR8A 1WSUA 1D8KA 5J8FA 2Q0YA 5BPIA 4ZZLA 3EETA 4A6EA 1QNTA 4B5PB 2R1IA 4HV6A 1UHWA 1LDJA 4Q4ZF 2A6HF 4F7ZA 3ABTA 2QBYB 2A69F 2VONA 3BY6A 3EC4A 3HRTA 4B09A 4YIFA 1J59A 4RAYA 2OZ6A 1G3SA 4ESFA 1XE4A 2R7HA 2ZW5A 3GVAA 1T38A 5F46A 3FRMA 2GZWA 1ZGAA 3KP4A 4KMUX 2RVCA 1ON0A 2BUEA 3VWEA 4BYYA 5F6FA 4O5VA 1L0CA 2OAZA 4XLNF 1USSA 1W7PD 1OMIA 2V1UA 1BOBA 4MY3A 4ENNA 3GLXA 3ZMDA 2JPCA 3JAMK 3GFJA 4G94A 4L0ZB 5L3CA 3WGGA 3TTHA 3D2PA 5CVRA 4ZZDA 3RKXA 5EC4A 5J6XA 3DQVC 1P0HA 1O3SA 5D6EA 2CY2A 3IRRA 2W85A 4PZJA 5L3BA 2B4BA 4RGUA 4AB7A 3S2WA 3WODF 3FXTA 3ELKA 5FB2A 1MK4A 2FBKA 1KQ9A 4CYDA 1NSLA 3MWMA 3P9KA 4ORFA 1M44A 2HZTA 2HTSA 2BV6A 2KIFA 4PGHA 1T0FA 4P5OA 2A6EF 3BJ8A 2YSRA 1GXQA 2VOOA 4EVIA 5E8GA 3P9CA 4BH9A 4I0BA 1Z9UA 1M4IA 2PN6A 1LEAA 1O57A 3ECHA 2JEVA 3P2HA 3ISPA 1WWZA 3FIXA 4Z2YA 1BI0A 4OIOF 1XMTA 3CXSA 1MJAA 3J80K 1I6XA 3SHFA 2ISYA 2FIAA 1SMTA 2O03A 5JPHA 3WE2A 1S3ZA 3QRFF 4UVBA 2RGVA 4M74A 2B58A 2RV8A 2QYOA 1KA8A 1OYIA 3GO5A 4PCQA 4L18B 2LDUA 3I71A 1QSNA 3I54A 2HYFA 4BAYA 4Y49B 1SD5A 1USTA 4LB5A 1NE9A 3GUDA 4MI4A 3KLOA 2V1XA 2KJBA 3VODA 1RIOH 3HTSB 2ACJA 1FBUA 1ON1A 2OA4A 1U3EM 4Q47A 1QZZA 1HSJA 5FD5A 3KLNA 3KETA 1JGSA 1YFHA 1BI1A 1J4JA 2MH2A 1IYKA 4HYEA 3LQRA 1K79A 4AVBA 2ZBKA 2FCKA 5D5WB 1P6RA 3JSPA 2WC2A 4I0AA 4OINF 2IP2A 5K5QA 4KORA 5HVQC 3WTVC 3BPVA 2MA3A 3FX3A 2B3VA 1BO4A 1Y7RA 1FNNA 3DFGA 3HTUA 5L3FA 2I00A 1IW7F 1SD7A 4XNHC 1YO5C 1CJWA 2FIWA 3SFZA 5CVIA 3R60A 1NHAA 2VQYA 4Q48A 2FE3A 4HNXB 4NB5A 4JJXA 2VI7A 3H92A 5JVTA 3FYNA 1U5TB 1W7PA 2YX4A 2CNMA 5LBQA 3D8PA 1YQAA 1ZRDA 5E96A 1FYKA 4RB3C 4XPDB 1XDUA 2A3SA 2MD5A 5CVVA 1RZ4A 3KCCA 2AS5F 4MNUA 1ZG3A 2M5WA 4ASNA 3QU6A 4BXUA 2C6YA 1KU9A 2FBIA 2EK5A 4A2UA 2PDOA 3L09A 4U5YA 3BJOA 3OWCA 4JD6A 3PQKA 5K5RA 4M6XA 3R6SA 5DCFA 1BIBA 4U9YA 5C88A 3F21A 2M1BA 1YLEA 4PV6A 5KVRA 4R3LA 2VBZA 2OBPA 2P6SA 4YFKF 2JLMA 1TNTA 1U8RA 2Z10A 4B5OA 1A04A 2P0WA 1BOAA 2G3AA 2VEZA 1IN5A 3J81K 4HLYA 4M9XA 4L8AA 2XAGA 2YPRA 3KP6A 4YFXF 1B59A 1G4DA 4LB6B 3I4PA 3V8IA 4LGWA 1AWCA 1ON2A 1OR7A 4L5IA 4A0XA 3PFIA 3KZYA 3BJ6A 3M9AA 3FMQA 3F22A 1DUXC 2J8MA 3VWDA 3DDDA 1G3WA 2DQLA 1T39A 2BEOA 1RUOA 2KCWA 2HUZA 2TDXA 4UWJA 1FP2A 3QOPA 4KYWA 4IRGA 4HX7A 1ZAOA 1CGPA 4GCVA 4ENMA 4KVME 2XV4S 3C26A 2VZYA 2Z11A 2O0YA 2L01A 4GO1A 5A2QZ 4N9HA 1N71A 1MGTA 4KVXA 1IN8A 4ZBGA 2DO7A 4RGRA 2Z9OA 5D8LB 3NRVA 2G3TA 3GFLA 1IXSB 4KMFA 4I01A 1M4DA 4XLPF 3NE7A 2A07F 3M8EA 4UV8A 4M73A 3RTRA 5GCNA 3K9UA 2RN7A 3JTHA 2CNSA 4QUSA 4HOBA 1XCVA 3CO6C 4JBAA 3M1EA 2H6BA 4KN4X 1BI2A 3SXNA 4WF2A 4WWCA 2PRBA 1W4MA 4HX8A 1S3JA 2FEZA 5F1RA 2Y48A 1YR0A 3PZJA 4BHPA 1YREA 4FX4A 2MH9A 2REFA 5AIPA 1TTYA 3P7NA 4KOVA 4KLVA 5BS6A 1Z7UA 4LLGF 2P6EA 3HIFA 1YK3A 4LG0A 1IRFA 5FLXZ 1B6AA 3LQQA 1CF7B 2M45A 1KU7A 1NMTA 3HRMA 2EA2A 2DPDA 3MZYA 1ONVA 3I0TA 2X7BA 3TO9A 1WWXA 4YRHA 1O7LA 2F5CA 2FQ3A 3G3SA 1SD4A 1Q2DA 3HRUA 4EV0A 3S6KA 5LEKA 3UY5A 3MCZA 4IUSA 5LLQA 1LJ9A 4R79A 3O3KA 2STTA 3V7CA 3QPHA 3C7JA 4KICA 4CRZB 2DBBA 4NHJA 1YTYA 4CAVA 2PG4A 1OPCA 3FM5A 3O6BB 1S8NA 4PGGA 3GZ5A 4WXDA 3CUQC 1YW7A 4FD4A 2PJPA 2JT1A 3R1KA 1QGPA 4RI1A 3DEUA 4EJOA 4JQFA 5DUIA 1TBXA 3HHHA 5LEJA 2VBXA 3GX4X 1MD0A 2OH1A 2QQ9A 1Z91A 2ELHA 2VN2A 1YGHA 3WTTC 4LK1F 1FWZA 1XIXA 4AIKA 1XGSA 3GYAA 5AONA 2HWVA 1G3TA 3VB2A 4LX9A 4I2OA 1FSEA 5HDGA 4ZYDA 2XASA 2OU2A 2XKPA 4FX0A 4CZZA 3HSFA 1ZARA 5LGNA 2G7HA 1I27A 2W24A 1R7JA 2FNAA 3TFYA 4NSQA 1KUXA 2UZKA 2DXQA 2P8TA 3J81Z 2PFBA 3OV8A 1JE8A 2Z99A 1B87A 2PBIA 1HKSA 3KP2A 2R8VA 2O28A 2R98A 2GXGA 4XPLA 3F3XA 4II9A 2E1CA 2DTRA 3R96A 3I58A 2FOKA 3F5BA 5E1ZB 2ETHA 1R57A 2BYVE 2ZXJA 5IT3A 3M7GA 1OZPA 1S5KA 2M30A 2FSWA 2QIRA 1W5TA 4FD7A 1QZYA 5FVJA 3BLNA 4L0YB 3ZPLA 2JDCA 5ICEA 2LNBA 4MHDA 1HQCA 2XAFA 1PP7U 1KQ0A 4E70A 2VBQA 4U7DA 2PEXA 1Z05A 2KIUA 3TQNA 4GXOA 2J5PA 4ESBA 3F8BA 4XSXF 2GE3A 3E3VA 1KQ8A 5DYMA 2P5VA 4AWXB 1JHFA 5HDKA 5D5UB 1TNSA 3V8LA 3G3ZA 3IGRA 1I12A 2GIVA 2VXZA 4CXFA 2IW5A 3FXQA 2JDDA 3U2RA 3GXOA 3GZ6A 1S7NA 5F49A 1V4RA 3OOPA 4WCGA 4AIJA 3E6DA 3EDPA 3K0LA 1V0CA 3W6KB 2PQ8A 2PR1A 1YVKA 4EJUA 1EH6A 3WTYC 2H27A 2QECA 2VBWA 3TOBA 5HOOA 3MFKA 4UV9A 5IX3A 3KP3A 1TLHB 1O3QA 3L9FA 4EJWA 2L54A 3GWZA 2A4NA 4U0VA 1KZFA 1XGMA 2OZHA 3LSTA 4XNHB 3R61A 4XPKA 1U2WA 3EYYA 2P6GA 1FBSA 4LMYA 1R00A 2J5OA 2ESHA 2Q4YA 1S60A 3R0JA 4B8XA 5JQ4A 1FP1D 2IJLA 4R8HA 4N0BA 2H5MA 2EFOA 1CM0A 4TV7A 2QENA 4IHSA 3K9TA 1Z4RA 4M71A 5ERIA 5H6RA 5HLGA 1GXPA 1YG2A 3I59B 5KTDA 2A68F 4MQVA 5LHIA 1TQMA 3ZZIA 3LODA 1IUYA 2DW4A 1BC8C 4AIHA 5DD8A 4KOWA 3T5XA 4NEXA 1IIDA 1F5TA 2YR2A 3KP5A 2DU9A 4IXAA 3WG9A 5A2QK 2OZGA 2GWRA 5LHGA 2HGCA 4O3MA 4MJ8A 3ECOA 2J8RA 4NF1A 4M9ZA 4UHTA 4KZTA 4AG7A 1SFUA 1K78A 2MC3A 2B0LA 1BC7C 3GEZA 1YVOA 2X0LA 3V8KA 3SQNA 3ZMZA 2B4DA 1F4KA 5EEHA 2L4AA 5TRDA 3CUQA 4YIIA 3CLOA 4QC6A 1L0OC 3CJNA 2BL1A 1XMAA 1FSHA 2Z33A 4KIFA 2D1VA 5EEGA 4K2EA 1GVJA 1S7KA 2AE6A 1UHMA 4F6AA 4RGXA 2OQRA 3H4QA 3E5XA 1FLIA 3AAFA 1BN5A 1U78A 1Z6RA 1PUAA 4H89A 4HQMA 3COAC 3DPLC 2QMLA 3RYOA 1B1BA 1HKTA 1XF8A 2EA4A 1XSVA 5E18F 4IJAA 2XKOA 5FLXK 2YU3A 3W91A 3EUHA 4S04A 5JI6A 4Y17A 4WXCA 4G6QA 4L9TA 2F5FA 1B6BA 3ZN1A 5DWMA 2D1HA 1D8JA 3QP6A 3ABUA 1ODDA 4A0ZA 1TQPA 2FL4A 3BROA 3ML6A 4KFCA 2PSWA 1ZREA 5D4SA 3RIRA 2VOPA 2CSOA 1XGNA 2QUFA 2EVNA 4CAXA 2MLGA 3H3UA 4L9NA 3MAJA 3LA7A 2WTEA 3TGNA 2ZW6A 2ZJ2A 3T8TA 3QP5A 3RPUA 4PSXA 2LKPA 1ZGJA 1FT9A 2RNJA 2EB7A 3FNCA 2J8NA 1QO0D 1IB1E 2P7CB 4PK3A 4OMZA 4HNYB 5HDNA 5DWNA 3B8GA 2DAOA 3JW4A 1WK4A 3FMRA 4NCZA 2HR3A 2V9VA 4H0EA 1FBQA 4D0PA 1HW1A 4KIBA 1G3YA 4G7ZF 2HS5A 5LRSA 3HOSA 4L89A 3DP7A 2UWMA 2QLZA 3IWGA 4I02A 2EV6A 4ESJA 3L2CA 1I1GA 5AIQA 2EV5A 1K78B 5IB0A 2XVCA 1Y9WA 4ENKA 2FT0A 5FGMA 2ARHA 1I1SA 4F0YA 2EFQA 2WPXA 5CLSA 4RS8A 1YLFA 5LGUA 2MBFA 4X5KA 2DI3A 2CO5A 1VTNC 2ESNA 2X4HA 4LLNA 1KUYA 1IN7A 3N97A 1L3LA 2BE5F 4P96A 4KA4A 1DP7P 1J0RA 1EV7A 3S6HA 4I49A 2I79A 2P6TA 1R58A 3KP7A 2L3DA 2HYGD 4A6DA 1BI3A 2Y75A 1P92A 1FPQA 3ERED 4Y49C 3DKWA 1MDMA 1J2XA 4JK1X 1FZPB 2KIMA 3C18A 1T6SA 3LWFA 4L5JA 4AVCA 4H6ZA 3T90A 4G9YA 3FF5A 4E2AA 3R0AA 1J7KA 5H86A 2K5TA 3SXYA 3I9SA 2H09A 2IT0A 2CFXA 4CGZA 5CJ9A 2NYXA 5FO5A 4J3GA 5C82A 1YYVA 1OYYA 5HS7A 1YW9A 2OZUA 2EWNA 4I09A 1SQHA 4ONUA 4PK2A 1LRZA 1P4XA 3B02A 4XBFA 3FZVA 3HYIA 1TIQA 3G8WA 3MGDA 4R1HA 1IZ1A 1R23A 1XCBA 1HKQA 1W7PB 3RKWA 2HV2A 3TE4A 5DV5A 4OMYA 2XHKA 2B5GA 1KGSA 2UXXA 4HKFA 1S6LA 4RB2C 4I98B 1Z6TA 1MJ9A 3BJ7A 3E6CC 4UVCA 2KRFA 2G7UA 2RC4A 3L00A 2UXNA 3F8FA 3R9EA 5ICGA 2W25A 4GYIA 3M8FA 2XROA 3F8CA 2NRAC 2EUIA 1P2FA 4JXQA 4ZYGA 5BQTA 1U5TC 5LGTA 2BSWA 3DF8A 4RAZA 2K4JA 2HOEA 3WE3A 4XPDC 3TOAA 4YFJA 1R1VA 3T9YA 1XSDA 2DQRA 2D45A 3P2FA 1S7FA 2Y0MA 3CXQA 4BMHA 2LF8A 1ZG5A 1GHEA 4B5PA 2XIGA 1XB4A 3ZJ0A 4A5NA 1Y9KA 4FT8A 5LHHA 2ZXVA 2PC1A 4EM2A 2XUBA 2P7VB 5H6QA 5LRRA 4YFNF 1BIAA 3IWFA 4A0YA 5DUKA 3C3WA 2QQBA 2FXFA 3I3GA 3N7ZA 2ISZA 3QAHA 4IHTA 1ZYRF 3SZTA 1UFHA 1HBXG 2ZPAA 4QB9A 1M1DA 3EXNA 4LUAA 3ZN0A 1P4NA 5CYVA 5DCMA 5ED4A 4BHBA 1HSTA 4MBUA 4UXNA 2FNPA 1H9GA 3ZMUA 3KZZA 3RPQA 4H6UA 5K1YA 3ZP5A 5J8CA 1K7AA 4R87A 2O61A 4UA3A 2K02A 2H94A 4WXHA 2XGXA 3GKRA 2FSRA 1STZA 1K4JA 1T2KA 1LB2A 3ULQB 4KOUA 2Z3YA 1R1TA 1EH7A 2Q0OA 2JSCA 1UFMA 2P4WA 3TO7A 2FBHA 3FBUA 4S05A 2R7FA 3FM3A 2DFIA 3RYPA 2OQGA 4EVYA 3KE2A 4IF5A 5IT9K 4M85A 2B5GB 2E7XA 4Y13A 4KUMA 3BJAA 2VT3A 1SMYF 3ZMVA 1Q1HA 3WU1B 3ZMTA 3F8MA 1J5YA 2Q04A 1H9TA 2VT2A 1QQIA 4PSWA 2K27A 4LG0B 2RDPA 1Q2YA 4NQWA 2O6GE 2FS5A 1B4AA 2ZFWA 3T0YA 4M6YA 2ZCWA 4KDPA 4OIQF 5HH1A 2JPBA 3KFWX 2CG4A 1OKRA 3T8RA 1IN6A 4KOXA 1P4AA 2BGCA 2VE9A 3EY5A 3QB8A 1TW2A 2FMLA 1LNWA 2W57A 4U0WA 3PP9A 4EMSA 3S6GA 2F5DA 1AOYA 5L3DA 3FMSA 3EQLF 3E6BA 3E0KA 2VODA 4CICA 3E5QA 3WGIA 1EH8A 2M8EA 2ZW7A 3FXRA 1FYMA 2LSOA 5L3EA 4R9MA 2XAJA 1IAWA 3BP8A 3V8JA 2FE7A 2CGPA 2JRTA 3GW2A 3T1BA 3SHPA 1PDNC 2D4PA 2ATRA 1VKCA 3ROUA 4WX9A 5DCMB 5TJJA 4MQ9F 3PGPA 1V3FA 4MEYF 2D2WA 2ADUA 5FFXA 1RXTA 4MHGA 3HUGA 2HDCA 3HHGA 1RI7A 4EM0B 5BOXA 4U9ZA 4KT5C 2MLKA 2DPUA 1MJBA 3I64A 5ILUA 4A5MA 3K69A 3BDDA 3HSRA 3RDIA 3BPXA 1J9IA 4QVTA 1F9NA 5E1XA 5HS8A 3ZQ7A 4LJZF 1SFXA 4ZYHA 3JTGA 1C0WA 2CNTA 2QZ8A 1IICA 4LD5A 1ZG1A 3R4KA 2EFWA 2QVOA 2PMUA 4HNWB 1XN7A 3JUWA 3SZPA 2O8XA 5KTCA 5KK1A 2VZZA 4ETSA 5F47A 1X3UA 4MTDA 4BHCA 1IRGA 5D4RA 1U5TA 1Y0UA 3F0AA 4HF1A 1QSRA 4JXRA 5CNPA 2NAZA 2ZMEA 1XDSA 3N4MA 1F1ZA 4NXYA 2GXBA 3CTAA 2COMA 2ZNYA 2GQQA 1S29A 2STWA 4JLYA 3D2MA 5HLIA 1O7FA 4P9UA 4ZH4F 1D3YA 1YS7A 2ZNZA 1QBJA 2H6CA 2ZO4A 3K1NA 4UWIA 3FXUA 2PI0A 2NNYA 4CAWA 4KIGA 3WTXC 3NEUA 3CUOA 3P9IA 4RB0A 3TO6A 1SFEA 3HRSA 4Y15A 3DV8A 3IRQA 3FB3A 4Q5SF 2FXAA 3O2PE 2ZW4A 3LAPA 3JSOA 1GHCA 3EO4A 5ILVA 5F48A 4U7BA 2NNNA 4G8XA 4CDGA 3EYIA 4I7HA 1ZHFA 3DR6A 3W6SA 4QLCU 1KYZA 1IN4A 5IT9Z 2F5EA 1I21A 3TCVA 4KVOE 3ZMSA 2Z0ZA 2D4OA 4RGSA 1XEBA 1WRJA 1YIOA 2YX7A 1R22A 1KU2A 1XSXA 3HSEA 3W6JB 4RB1A 5D5XB 1PP8F 1HW2A 1Z4EA 4ENJA 3D3SA 1QSTA 3IKVA 4GYGA 2IA0A 3GY9A 3EFAA 4N9IA 3E6MA 3MZHA 1O3RA 4P9FA 4RS2A 4KNYA 1QSOA 4CO8A 1DDNA 5D5VB 4HV5A 1Z1DA 2O3FA 4M72A 3DPTA 1E17A 3RKYA 2P5LC 6PAXA 4LLLA 2PLYA 2F2EA 4OLLA 5D6FA 3F8KA 4IRIA 2WWYA 4MEXF 3MEXA 2NS0A 1OYWA 4HQEA 1I5ZA 1LVAA 3GFMA 5BMZA 3E5UA 1UCRA 1U6GA 3U1DA 3R95A 4G6DA 3BZ6A 4LFUA 3QPTA 1REPC 1ULYA 1LQ1A 1BJAA 2EFNA 1HW5A 2HQNA 2CWEA 4IF4A 4AG9A 1BM9A 2G9WA 4DQ2A 1S7LA 1WQ2A 4OOIA 3V4GA 2QWWA 2K86A 4HF2A 3LFKA 3IHUA 2VC1A 4G7OF 4GS4A 2ZMEB 1Q2CA 4KOSA 4WK8F 2VE8A 3F6VA 3Q5FA 2DK8A 2IPQX 2IRFG 3I5UA 2IA1A 4OU0A 1RO5A 5DD4A 3U9GA 4ON0A 2K7LA 1E2XA 4OAEA 3Q9VA 3WU0A 1ZRFA 2G0BA 4M3SA 1CF7A 2CYYA 2M87A 4O6JA 3K2ZA 3DSBA 3JAMZ 2QQAA 1MZBA 4A12A 1T98A 1IYLA 3CXPA 1LDKB 3BOQA 4BQAA 1XD7A 3LA2A 4R3KA 1O3TA 4PDKA 2DK5A 2GA1A 2B4DB 1R5GA 2HTJA 3KEOA 3CUQB 3J7AO 3QU3A 3G73A 4HAMA 4KN7X 3IKTA 1B9MA 3SXOA 4HDUA 3PQJA 3BWGA 4HF0A 4UUVA 3E97A 4E8OA 1ZRCA 4U0YA 3TDZC 3RYRA 2HQYA 3FWEA 5H20A 3WGHA 1QSMA 2EFPA 2REEA 2RQPA 2FF4A 3CDHA 2JZYA 3IL2A 3S6FA 2DLLA 3HOTA 1UB9A 4MY0A 3R9GA 4EM1A 4FD6A 5CVJA 2VXKA 5FD6A 3DXJF 3H3ZA 3NQOA 2OD5A 5I0CA 4UNOA 4IRHA 4EJTA 3TDUC 1TW3A 4L9VA 4XRFA 4LK0F 4ZYEA 4AD9A 2HKOA 1MKMA 5K5OA 3D5LA 2Z5UA 4QWQA 3DNSA 2V6CA 3L7WA 1IF1A 1BBYA 3V7SA 5DDGA 4HZFA 2A5YB 2VC0A 2AXLA 3J80Z 1TQIA 4UBRA 2IA2A 5L3GA 1YS6A 5E8IA 3W6XA 2EV0A 3C1DA 2RKHA 1PUEE 3Q9SA 2IVMA 1WKMA 5DEQA 1FOKA 5HS9A 1R5HA 1KU3A 2F5IA 4MGRA 2FMYA 1FY7A 3KEQA 4KOYA 5CVUA 4MTEA 4UVAA 1YW8A 4U88A 3F72A 2CW0F 4EJVA 2L4MA 4EGYA 1K6OA 2E7WA 1XMKA 1G6NA 2Q2EA 3IWZA 2R3SA 2R7DA 3F6OA 4KUBA 3MQ0A 5E1WA 1R1UA 2KKOA 5HLHA 3WTUC 1D5VA 1Z9CA 2EJRA 2P5KA 1W5SA 2AJ6A 2OB0A 3B73A 1J75A 4BNCA 3R9FA 4YG2F 4KOTA 3V7RA 1P4WA 4R57A 3VOEA 4M9SA 2KJCA 3WTSC 1I1DA 3IC7A 2HKXA 2V79A 2ZKZA 1HXDA 5E17F 5JHUA
chains in the Genus database with same CATH superfamily
2GAUA 2ECBA 3G2BA 2KHMA 3CPAA 5F64A 4MO7A 3CCLI 4HLXA 2DT7B 1K7UA 4CS0B 5FFZA 2WBMA 4AVAA 2N1AB 4A3IJ 1U6MA 2GBYA 2Z3PA 2JTVA 4L9JA 2R5ZB 2HQRA 2W84A 5EX3A 5ISVA 4H2KA 1NK3P 4CHUA 5ILSA 2QBYA 2E1NA 4P55A 4E7HA 4MCSA 4YGOA 2FU4A 1ENHA 1YX0A 2JBKA 1LEBA 3RQIA 2DKVA 3K4MA 2BEIA 2GA2A 3A9LA 1B9NA 3RBUA 4JWPA 2Q7BA 2E36A 1H0MA 4DZJA 1GLNA 2BBYA 3Q3SA 2ZJPF 2PMHA 2EH3A 1ZLKA 4NGSA 5HMNA 2B3UA 4JYWA 1ZN2A 5AG6A 4D9JA 2IL4A 4CCNA 3WTZA 4E1PA 2FRHA 2WPWA 2L02A 1QPMA 2ZEOA 3TKYA 2Q8KA 3VEPA 1KUVA 3VYRB 2C27A 2L9VA 2HEOA 4G7HF 2PJ9A 5IPAA 3REOA 1WJDA 3CDXA 1R36A 5D8KB 2PR8A 4HDVA 2DT5A 3P5JA 1A6IA 5GPCA 1AKHB 3VFZA 5EMIA 3RJPA 2Q4VA 1MDMB 2P6FA 1SAUA 4E0AA 3KR4A 2VKEA 4HBLA 3TT2A 3NARA 3DLJA 4EGZA 1IU8A 2XB5A 4XSZF 3DBRB 3IH4A 3FHZA 1FYLA 3CQZJ 1ZLJA 1BAVA 3IWEA 3CO7C 1ARMA 1YJWI 2COBA 2NMTA 4CRYB 4OADA 2ELIA 2PRQA 3LACA 3RZDJ 1SAXA 1CT0I 2FA5A 1DTDA 4HA8A 3K1PA 4KS9A 5J3LA 5JFRA 1XMBA 4OIPF 4ZTJA 1SD6A 3BT9A 3BR6A 3D0SA 3LA3A 5IV0A 2WV0A 1JHHA 1SGRI 3DGVA 3M3YJ 2Q44A 3H8FA 4HX4A 3SJFA 2LD5A 3KKWA 2K4BA 4K30A 4XN3A 2XAQA 1DPUA 5ICFA 1NUBA 5A28A 4IEJA 1HDUA 2AXTC 3ZOBA 1DPRA 2CWHA 5BWAB 2WVJA 3E2IA 1JT0A 5EBVA 1U5KA 4HG2A 2QM3A 2XRNA 3F23A 4OIRF 1WI9A 4I76A 3ZQFA 3GYHX 1T08B 1ZH5A 3I53A 1JXSA 3GFIA 4UCPA 5JR3A 2ARPF 3CP2A 1GYTA 1S7OA 5H84A 4GGGA 2ODFA 1KYWA 1X4OA 3RI4A 2XAHA 4A3FJ 1XGOA 3OYKA 5BPDA 3NH8A 2NVYJ 3WG7H 1RNLA 2I5UA 2V1DA 2L7ZA 1PU9A 4AVPA 1IXRC 4IVNA 1PPFI 3F8NA 4EQQA 5KTAA 1Z3YA 2GANA 4DNCA 1IXCA 4A94A 2JMWA 2VBYA 3PL8A 2B9SA 3I59A 4MHNA 1TC3C 4MFQA 1FC3A 4GDFA 3HOYJ 2DCEA 2A61A 2LF7A 2HFHA 2NU2I 1RUNA 4OP4A 2DMNA 1W3SA 3PFEA 4FWUA 4CGMA 3TEDA 4FD5A 3M4OJ 1R71A 2ZB9A 4F55A 2AFSA 2V26A 1UVGA 1VHSA 1ETXA 2CQKA 4IOAF 4FHTA 2G3TA 3PDNA 2X1EA 1S7AA 5M5YJ 1T8IA 3IFEA 3G1LA 4HW0A 4IPAA 2LC2A 3UR3C 4KLWA 3K4KA 4D7NA 5FROA 1FX7A 1PTRA 4CGPA 4KUAA 5I4MA 4BU2A 1LDDA 3LAJA 4PJNA 1P9ZA 5E20A 2LP0A 1D1AA 2X3TA 1M4GA 3K1MA 3WTWC 3JVNA 2HQ5A 3WR7A 5ICCA 2WAQN 1KBEA 3GF2A 3LD2A 3DR8A 4QBJA 1IV6A 1BPMA 1WSUA 1D8KA 5J8FA 2Q0YA 4IHVA 3BHXA 1LPQA 2IGMA 1D0YA 5BPIA 4ZZLA 4IKFA 1YW4A 3EETA 2XSJC 1QU3A 4A6EA 1AN1I 4TNUA 3CF2A 1QNTA 2E35A 1IGBA 4B5PB 2C1CA 4LITA 2R1IA 4BY7J 2XAUA 3SYTA 1VHOA 4HV6A 1UHWA 1LDJA 1PCEA 2GKRI 5G21A 1HEEA 1CP6A 4I99C 4Q4ZF 4A3CJ 2A6HF 3VE5A 4F7ZA 5JLWA 2B0UC 4C2TA 3ZQCA 1V1HA 3HL2A 3ABTA 3CMMA 2JA2A 1BR4A 4D5CA 2N71A 5M3MJ 2QBYB 1V5EA 4J19A 2A69F 4G12A 3BY6A 2VONA 2LEOA 1T56A 2DOAA 2NS8A 4ZYAA 2VL1A 3B6CA 1ETQA 3EC4A 1LKXA 3F0CA 3HRTA 4B09A 1BW6A 4YIFA 4KITB 4RAYA 1J59A 2VUMJ 1TWFJ 2OZ6A 1G3SA 2F7VA 1FOYA 4ESFA 2LBFB 1XE4A 4NNJA 2R7HA 1QA6A 2ZW5A 3FC3A 3GVAA 4MHPA 5LRJA 2H8WA 2X6WA 4B10A 4CCJA 1X1CA 4E4HA 1T38A 5F46A 3FRMA 4PUSA 3R5AA 1RKWA 2GZWA 2PJ1A 1ZGAA 2BHYA 3KP4A 2HPMA 4KMUX 2EZLA 2RVCA 4M6VA 4P45A 1TF8A 2EINH 1I50J 3PRTA 2BY0A 2GOMA 1ON0A 2BUEA 3PSIA 2MW8A 3VWEA 3S9NA 4CCLA 4BYYA 2WAQA 1TBNA 5F6FA 2N52A 4O5VA 1L0CA 2OAZA 3BG5A 4XLNF 1USSA 4DYCA 1W7PD 1OMIA 2V1UA 1BOBA 1B8IA 4MY3A 3FMCA 4BY1J 4CGLA 4ENNA 1OR7C 2E2JJ 3GLXA 4CCOA 3ZMDA 4AUXA 2BHZA 1CT4I 2M4KA 1R79A 3OL0A 2JPCA 3D67A 3L2UA 4E7ZA 4X3RA 1IRXA 3JAMK 3GFJA 4BL0B 4G94A 3CC4I 4L0ZB 4CAFA 4A3BJ 2YGWA 4WP4A 5L3CA 3RPUD 3WGGA 2ZSIB 2JRMA 1X19A 3MD2A 2NVTJ 3TTHA 3EUKL 3QYEA 3D2PA 1MMNA 2QSGX 1X2NA 5CVRA 1X1BA 4ZZDA 3RKXA 5EC4A 5J6XA 2GKVA 3ZCOA 3DQVC 1P0HA 4A3LJ 1O3SA 5D6EA 2CY2A 3IRRA 2W85A 4PZJA 5L3BA 2B4BA 4RGUA 1W5CC 4OWRB 1HA8A 4AB7A 1U0JA 3HOUJ 3W6VA 3S2WA 3CXLA 3WODF 3FXTA 1TKHA 1OFCX 3BG7A 4LG3A 3ELKA 5FB2A 1EJ9A 3NA6A 3DWLE 1CHOI 2RB7A 3FBNB 1MK4A 2FBKA 2ABZA 4IHWA 1KQ9A 4CYDA 5IOYA 1NSLA 3MWMA 3P9KA 1TUSA 4ORFA 2LVSA 3PFYA 1M44A 3BLYA 3ABLH 2HZTA 4MHZA 2ZXHA 2HTSA 2BV6A 4XLAA 2KIFA 5KCMA 4MFLA 2OV7A 3OYEA 4PGHA 1T0FA 2AHQA 4P5OA 2H1KA 4BJTA 3KR5A 2A6EF 4CCMA 3BJ8A 3F9KA 1NG7A 3CMEI 3S14J 1LR9A 1ETKA 2YSRA 3KYDB 4OVOA 1Z67A 4E7IA 1GXQA 2DEAA 2EQRA 2VOOA 2Z1DA 4EVIA 3IAS2 1K4SA 3W2WA 5E8GA 3H9JA 3P9CA 4E7JA 3IP4B 3QNVA 3N5FA 4BH9A 4I0BA 1Z9UA 1M4IA 1TKJA 2PN6A 4NQWB 1LEAA 1LUJB 1O57A 2AFOA 3ECHA 3WU2C 3GIUA 3BTJA 2JEVA 3P2HA 3ISPA 2BY3A 1KONA 3BG3A 2LB7A 1RR8C 1WWZA 3FIXA 4Z2YA 1BI0A 3H0DA 4OIOF 1XMTA 2WYRA 1W0UA 3CXSA 1MJAA 3J80K 1I6XA 1SGPI 1F2OA 3SHFA 2W4SA 2ISYA 2FIAA 2NU1I 3A2KA 1M4LA 2DDAA 1SMTA 4LOCA 2HZDA 2X9DA 1ZO0A 3IIBA 4XM3A 2O03A 5JPHA 4ZX9A 4YELA 2NS7A 3WE2A 3LFUA 1AU7A 4DGWB 1F43A 3QRFF 1S3ZA 2JEWA 4UVBA 2RGVA 4M74A 2B58A 2LREA 2MGQA 2RV8A 3QQAA 2R93J 3NWTA 2QYOA 1UZCA 2V4JC 2HYJA 3BR3A 3IH2A 1KA8A 1OYIA 2NU3I 4IHXA 3DBHB 4HPSA 1Q9BA 3GO5A 4A3JJ 4PCQA 3CCMI 4L18B 2LDUA 2PMZN 4P4DA 3TL4X 3I71A 2R7ZJ 3I54A 1QSNA 2HYFA 2IS6A 1YIJI 4BAYA 4LQGA 3I1UA 4Y49B 2WV1A 3QWLA 1UHAA 3OYDA 1SD5A 1USTA 4LB5A 4UCMA 3PB7X 5M3FJ 3SI0A 1NE9A 3GUDA 2HI3A 2ZJRF 3KLOA 2A5WA 2V1XA 3CC2I 3DBLB 4MI4A 2KJBA 3VODA 2ROWA 1RIOH 2E2IJ 3HTSB 1ORKA 1MBEA 5EG0A 4NC7A 4PJLA 2ACJA 3BTIA 3MZ8A 1FBUA 1UELB 1QHGA 1ON1A 4IQJA 2OA4A 2R7RA 1U3EM 1G2HA 5K8OA 4Q47A 1QZZA 1WJEA 4LIVA 5FLVA 5C4XJ 1HSJA 1CT2I 5FD5A 1EKEA 3KLNA 3KETA 3SDBA 3OXLA 1JGSA 1YFHA 2QJ8A 4EFDA 4OAYA 2R7SA 1BI1A 4XQFA 1Z21A 3HUGB 2MH2A 4PJMA 4X1EA 1J4JA 1IYKA 4ZY1A 2ZEFA 3BCBA 4HYEA 2EK8A 4CYCB 3LQRA 4J00A 2PJCA 1V5GA 5IOZA 5KNLA 1K79A 2ZXIA 2ZBKA 2DMPA 2LLKA 2BY2A 5E3LA 2FCKA 2OJED 4FISA 4AYBN 2LKSA 5D5WB 4IO9F 1P6RA 2LY9A 4IK2A 3JSPA 3L2WA 2CV0A 1UG2A 3MMYB 1V1IA 2WC2A 3WABA 4I0AA 4OINF 1HDDC 3OIPA 1MH4A 2IP2A 5KAFC 5K5QA 3CCUI 4KORA 4B43A 2PMZA 2L5QA 5HVQC 3WTVC 3KZWA 5FKLA 3BPVA 2MA3A 2HVSA 3FX3A 2B3VA 1BO4A 1Y7RA 1FNNA 3DFGA 3HTUA 5L3FA 3OL4A 3WT4A 4BE1A 2ME0A 2I00A 3QAYA 1IW7F 3Q0WA 4LIUA 2JW6A 5GAGJ 3D66A 4P4JA 1SD7A 4XNHC 2O7OA 3DKXA 1YO5C 3DCFA 1CJWA 2FIWA 3KY9A 3SFZA 5CVIA 4B1RA 3R60A 4XN0A 1NHAA 2VQYA 4R6TA 4Q48A 2FE3A 4HNXB 2XPVA 4NB5A 1BR1A 1H89C 4JJXA 5LYIA 5K7FA 3CCJI 4F9UA 4BBSJ 3FVLA 2VI7A 3HKZN 5GPAA 3PEIA 1QVTA 3H92A 3W2VA 5JVTA 3FYNA 1U5TB 2F6CA 1W7PA 2YX4A 4DYQA 4RLFA 2CNMA 5LBQA 3D8PA 3U21A 1RETA 3CMAI 2PJRA 1YQAA 4M3BA 1ZRDA 2B63J 5E96A 1LFWA 4C2XA 1N25A 1FYKA 1JTYA 4RB3C 3BI1A 4XPDB 1XDUA 2A3SA 2KDZA 4BEHB 2MD5A 5CVVA 5E3PA 4NBQA 1RZ4A 1FTZA 3KCCA 1VQMI 4CUGA 2LMDA 4MNUA 2AS5F 4YEJA 1ZG3A 4BD9A 1XBTA 3AKZA 1D5YA 4HEA2 3KQZA 1Y8QB 2AQEA 2M5WA 4ASNA 3QU6A 4AYBA 3JRFA 2WSAA 2YS9A 1JKOC 4BXUA 2DMQA 3MEKA 1FMWA 2C6YA 1MH3A 2VKDA 3SEZA 1KU9A 2FBIA 3JRCA 2EK5A 4A2UA 2PDOA 3L09A 2ZOGA 3FXLA 4U5YA 5AG7A 4ZGYB 3BJOA 3OWCA 3KYCB 3HPGA 4JD6A 1MMGA 1MNDA 3PQKA 2ZEHA 3OR1C 5K5RA 2HVRA 4B3AA 1NSAA 4M6XA 2L7FP 3R6SA 5DCFA 1HPTA 1BIBA 2PJBA 4U9YA 5C88A 2DN0A 4HSRA 3F21A 3QPLA 2M1BA 3S9LA 4BXXJ 1YLEA 1VGYA 4XORA 2Y0SN 3ZRGA 4Z6YA 5KVRA 4PV6A 4R3LA 2VBZA 5EX0A 2VQCA 4DYOA 2OBPA 2P6SA 1AUGA 3HZJA 4YFKF 2YNDA 4E7KA 2JLMA 3SZGA 2IQ6A 2RNGA 1TNTA 1U8RA 3OYIA 3PJRA 1JTXA 2F5VA 3HKZA 1IUFA 1DS2I 5FUWA 2Z10A 1A04A 4B5OA 2P0WA 1ZG8A 1BOAA 2G3AA 2VEZA 1E3PA 1IN5A 3J81K 4F92B 4HLYA 4JX4A 4M9XA 3FJUA 4IOCF 4L8AA 2XAGA 4V2FA 3BJIA 1WJAA 1EE3P 2YPRA 4MFEA 5TISC 3B3VA 3KP6A 3DEWA 4YFXF 1UVFA 3BG9A 1B59A 1G4DA 4OC3A 4GM5A 4LB6B 3KYLA 3I4PA 3V8IA 4LGWA 2K3FA 1AWCA 1ON2A 5CCLA 2CRGA 3B4VC 1OR7A 1WJCA 4L5IA 4XRSG 4MMOA 4GI3C 1XX5A 4A0XA 2DIPA 2Z16A 2V1NA 2HDWA 3PFIA 5EDNA 2BOLA 4OKOA 4UF4A 4AIDA 2R7WA 3KZYA 3BJ6A 2O9LA 1FMVA 3M9AA 1LE8B 3PB9X 3FMQA 3F22A 1DUXC 2J8MA 3VWDA 3DDDA 3SEKC 4ZY0A 1G3WA 2BVLA 2DQLA 2BEOA 2R7OA 1X3WB 3DLLF 1T39A 1RUOA 2HUZA 2KCWA 3H5ZA 2TDXA 3ISXA 5CQEA 1K7VA 1OCRH 1FP2A 4UWJA 2QGUA 4C3IJ 3QOPA 1E0EA 2GIZA 5HNHA 4KYWA 3IU2A 3OYBA 4IRGA 2K85A 2DODA 4HX7A 1ZAOA 1CGPA 4PFPA 5FKMA 5H2FC 4GCVA 3LSPA 2WY7Q 4UY8I 3CJRB 4ENMA 4KVME 2V7FA 2XV4S 1R5ID 2HXIA 4W97A 3OS0A 2ORWA 4V2GA 3C26A 3TP3A 2VZYA 2VKVA 2O0YA 4XRSA 2Z11A 1OLTA 2L01A 2E1MC 1RKTA 4GO1A 5A2QZ 1CP7A 2Y0SA 2AFUA 1YE9A 4N9HA 1MSFC 3LL7A 2PJ0A 1N71A 2BW3A 2GU2A 4G1PA 3B3CA 2PJ3A 1MGTA 4XIDA 1I6HJ 3UGLA 4KVXA 1IN8A 3R5CA 4ZBGA 2DO7A 4ZTFA 3K10A 5D8NA 3PB4X 1Y1VJ 4RGRA 2Z9OA 3OSFA 4M3GA 5D8LB 3NRVA 4XOTA 1A36A 3GFLA 1CGJI 1IXSB 1Q7LA 2KZVA 4BACA 4HGUA 3D7DA 3TBIA 1P7JA 2KPMA 4KMFA 3ZGKA 2CQQA 4UEZA 3CCYA 3HEFA 4I01A 4XLPF 1M4DA 3NE7A 2A07F 3M8EA 4UV8A 1OYVI 4FUUA 2ENZA 4IHMA 1I39A 4M73A 1Z0XA 1D0ZA 3RTRA 4OC4A 4TWEA 1ZQ3P 5GCNA 4MPIA 1P9QC 3K9UA 2RN7A 3JTHA 2EBIA 1IV8A 5F0CA 2CNSA 2NYQA 4QUSA 2OUMA 4HOBA 2O5RA 1XCVA 3CO6C 1VQ4I 4IX7A 4JBAA 5F0HA 2KISA 1WGTA 3S32A 3M1EA 5G1ZA 2H6BA 1K6YA 3GCMA 4KN4X 1BI2A 3MVPA 3SXNA 2XRLA 3BG6A 4WF2A 4WWCA 1MT1A 2OTLI 2AO9A 2VB6A 4BGDA 2PRBA 5E3NA 4CGOA 1W4MA 4HX8A 1S3JA 2FEZA 5F1RA 2YNEA 2Y48A 1YR0A 4PQAA 4XRMA 3PZJA 3CT9A 4BHPA 1YREA 2CH0A 1YRNB 3UEJA 4FX4A 3N05A 3J7YJ 2X48A 3SJGA 2MH9A 2REFA 5AIPA 2N8GA 3VPRA 3FSYA 1TTYA 3P7NA 1QRYA 4KOVA 4MHYA 4KLVA 5BS6A 4E6KG 1Z7UA 4LLGF 3HOZJ 4NUBA 3H5RA 2P6EA 1VQ8I 3HIFA 1YK3A 4LG0A 1IRFA 5FLXZ 1B6AA 3LQQA 1CF7B 2M45A 3HXLA 1KU7A 1NMTA 3HRMA 2EA2A 2DPDA 1HF0A 3A01B 1W0TA 2YU9J 3MZYA 3LSKA 1JUMA 1ONVA 2CWFA 2X52A 3I0TA 2BXZA 2JVHA 4XK4A 1CPXA 2X7BA 9WGAA 2B8TA 3BQYA 3TO9A 1WWXA 2GOXB 4C9YA 4YRHA 1O7LA 4C2UA 4R7MA 2F5CA 2FQ3A 4B12A 2QQ8A 3G3SA 1Y8FA 3HOXJ 1SD4A 1Q2DA 2ZELA 3HRUA 4EV0A 3S6KA 5GAEJ 5LEKA 3UY5A 3MCZA 4IUSA 5LLQA 4UXHA 1LJ9A 3KIOA 2QQCA 4R79A 3QOEA 1ZR2A 2JA1A 5F49A 3O3KA 3MKWB 3E0JB 2STTA 3LNQA 3V7CA 5E3QA 2QA4I 3FXKA 3QPHA 4A2ZA 3C7JA 3QYBA 4KICA 5LFAA 2DBBA 4UB8C 2GLOA 4CRZB 4NHJA 1YTYA 4CAVA 1X4SA 2SGPI 5LRGA 3WC7A 2JN6A 4RAGA 1Y7EA 2PG4A 3K4CA 3IH3A 1N77A 1OPCA 3FM5A 4OAZA 3O6BB 1B72B 3H3VK 4M6GA 1S8NA 1E3OC 4PGGA 2VLAA 3B7IA 2XEGA 3VARA 3GZ5A 4WXDA 3CUQC 1YW7A 5B5EC 4FD4A 1IDZA 2PJPA 5E3MA 2JT1A 3OYGA 3R1KA 1QGPA 4RI1A 3DEUA 4EJOA 4JQFA 5DUIA 1TBXA 3HHHA 5LEJA 2VBXA 5DTDA 1SVLA 2CUZA 1AHDP 2KMPA 3GX4X 4CYNA 1MD0A 2XGDA 4D1QA 4XLFA 1Z8LA 2OH1A 2QQ9A 2SGDI 1D0XA 1Z91A 2CFOA 2NU0I 1VF9A 1ZG9A 3QWPA 5J4VA 2ELHA 3PB8X 2L2OA 2VN2A 2E2HJ 1YGHA 4GXHA 1OJLA 3WTTC 3HB9A 2HOAA 4LK1F 4N4OB 2DJNA 1FWZA 2P6AC 1XIXA 4AIKA 3HGYA 1CE3A 3BR1A 1XGSA 4DYRA 1VQ6I 4IL6C 3GYAA 4MCRA 5AONA 2HWVA 2PJ2A 1G3TA 3VB2A 4LX9A 4A95A 2BW3B 4PXEA 5JHFA 2CV2A 4C2ZA 2R7UA 3ZQIA 4I2OA 3OXFA 1FSEA 5HDGA 4ZYDA 2XASA 1QZEA 2OPTA 1VZ0A 2OU2A 2XKPA 1CBXA 1X58A 2LTPA 4FX0A 2DF5A 1W36C 2LG4A 4CZZA 3EUHC 3HSFA 1ZARA 1R6RA 5LGNA 2G7HA 1FIPA 1I27A 2W24A 4A3EJ 1R7JA 2FNAA 3TFYA 4NSQA 1KUXA 2UZKA 2DXQA 2P8TA 1R4MB 4NC8A 3J81Z 2PFBA 3OV8A 1JE8A 2Z99A 1B87A 2PBIA 1IY7A 3CD6I 2AFWA 1HKSA 4C3HJ 3LSJA 3KP2A 2R8VA 1GUUA 2O28A 2Q2EB 2R98A 2GXGA 4ZI6A 1U9NA 4XPLA 4RM2A 3F3XA 4II9A 3HG9A 2DTRA 2E1CA 2CMPA 3I58A 2FOKA 3ZQLA 2A05A 3D4UA 1VQOI 4WJBA 3R96A 3F5BA 1JJ8C 5E1ZB 4CZCA 2FUG2 3HJEA 1F2PA 2ETHA 4FKDA 5B1BH 2NOJB 1BA5A 1KBFA 1XPXA 1X1DA 1R57A 4P6YA 3TW7A 3BTLA 2IAIA 1F36A 1TL8A 2BYVE 2ZXJA 5IT3A 2PVVA 2JA6J 1XJOA 3M7GA 4BDZA 2JA8J 1FAQA 1OZPA 1Z77A 4QPOA 3W2AA 1S5KA 4R8FA 2M30A 2FSWA 3IEHA 2QIRA 1W5TA 2CW7A 4DBRA 4FD7A 2KLOA 2GFQA 1QZYA 5FVJA 2F4MB 1IY5A 2L7KA 3BLNA 2VQHA 2FX0A 1HLVA 4L0YB 3ZPLA 3BI0A 2JDCA 1RRJA 5ICEA 1O4XA 3ONQA 2LNBA 2I10A 2M7AA 3RO0A 2KP6A 4MHDA 3GTGJ 1HQCA 2XAFA 1PP7U 2JYYA 1VIXA 1KQ0A 4E70A 2J9RA 1LANA 2QSFX 5LD2C 4BQQA 2VBQA 4U7DA 2PEXA 1Z05A 2KIUA 3TQNA 1YJNI 3R5DA 4GXOA 4PJJA 1W36D 2J5PA 3R5BA 4ESBA 3F8BA 4XSXF 2GE3A 3E3VA 3JRGA 4NFRA 3B3TA 3BQZA 1KQ8A 5DYMA 4P44A 2P5VA 3LSHA 4AWXB 1JHFA 5HDKA 2QSHX 3TC8A 5D5UB 1TNSA 4NGQA 5C3EJ 5EF6A 4A30A 4DUKA 3V8LA 2OR4A 3G3ZA 2W7NA 3IGRA 3L2NA 1I12A 2GIVA 2VPLA 2HOSA 2VXZA 5DS0A 4CXFA 2IW5A 2DYRH 3FXQA 4B48A 4PPZA 2JDDA 4E7SA 4B44A 4O23A 2VASA 2EK9A 3DPUA 1XC5A 1JJ6C 3U2RA 1WJBA 2M3AA 2XF7A 3GXOA 4BBRJ 3GZ6A 1V4RA 2DA7A 1S7NA 3OOPA 4WCGA 5B3SH 4AIJA 3E6DA 1OMUA 2UUZA 3EDPA 3K0LA 1V0CA 3L1PA 3W6KB 1MBGA 3ASNH 3RQ4A 2E19A 1IG7A 2QYVA 1JGGA 2K3PA 4UCNA 2PQ8A 1YI2I 2PR1A 3W3CA 3BZKA 1YVKA 1Z8WA 4Y7NJ 2FJ1A 4EJUA 1EH6A 4HNTA 3LOCA 3FXOA 3GMEA 3WTYC 2EO8A 2H27A 2QECA 4ABZA 5KHDA 2NVUB 2VBWA 3TOBA 5HOOA 3MFKA 2LUYA 4UV9A 4A33A 2EPFA 1TLHB 3KP3A 2F4OB 5IX3A 4XLEA 1O3QA 3L9FA 4EJWA 2L54A 3OYAA 3D00A 3GWZA 1TP4A 2A4NA 5GAHJ 1EF4A 4U0VA 1FTTA 1KZFA 3ZQHA 3FEEA 2M0MA 1MBHA 4CYOA 1XGMA 2OZHA 2R5YA 3LSTA 4XNHB 2CWGA 3KX2A 3R61A 4XPKA 3LSIA 1U2WA 4HSTA 2LK2A 3EYYA 2P6GA 3JTKA 1FBSA 2DMUA 4L89A 4LMYA 1R00A 2J5OA 2GKTI 2ESHA 2Q4YA 1S60A 4XMYA 2ZEPA 4HRIA 1UHSA 2ID6A 4NC6A 2DMTA 3R0JA 4R76A 2IGKA 1K4TA 5HNFA 1ELMP 4II3A 4B8XA 4FAIA 5JQ4A 1E3HA 2QEXI 1FP1D 4FBEA 3HH2C 4MFDA 3DTKA 2IJLA 2K9SA 4N0BA 4R8HA 2EFOA 4QTRA 2H5MA 4X8IA 3L2RA 1CM0A 1WPKA 4TV7A 2QENA 3HOWJ 5J4YA 3K9TA 3JRBA 4IHSA 3BR0A 1CPSA 1GDTA 2K5CA 1Z4RA 4PXDA 3LSGA 4B14A 2DTZA 2PJ7A 1IO2A 1ULMA 4M71A 2M7BA 5ERIA 5H6RA 5HLGA 3OL3A 2DT6A 3L2VA 1GXPA 3HOVJ 3S2HJ 1KWMA 3ISZA 1YG2A 4HPQA 3I59B 4UEFA 1IGNA 2F8HA 3PNTA 5KTDA 1WTJA 3OS2A 2XGCA 2A68F 4MQVA 2V8DA 2YUSA 1VDDA 5LHIA 1TQMA 2G9DA 3ZZIA 3LODA 1ZLHA 1YU6C 4XICA 2LOOA 2ZJQF 4UIAA 3TMOA 3RNZA 1IUYA 2DW4A 1BC8C 1MBKA 2KCXA 3VDPA 3MN8A 4ZYQA 2ZOFA 3OIQA 4ZDPA 4KSAA 2QQEA 4AIHA 5DD8A 4KOWA 3T5XA 5K7HA 4NEXA 4CPAA 2W48A 1IIDA 1F5TA 3KQXA 5E3RA 3RZAA 2VJ4A 4X0GA 2YR2A 4A32A 3KP5A 2DU9A 4IXAA 3WG9A 5A2QK 1JWQA 2OZGA 3E7LA 5G20A 2GWRA 3CCRI 3ESWB 3M07A 5LHGA 2CU7A 2HGCA 4NJQA 4XOPA 2VXDA 2DFHA 4O3MA 3FH4A 4MCQA 4MJ8A 3ECOA 1J09A 2J8RA 4PFOA 3B2YA 4NF1A 5AGEA 4M9ZA 5E79C 4UHTA 4KZTA 4AG7A 3UKGA 1R9TJ 1K83J 3OYFA 1A5JA 1SFUA 1MBFA 1K78A 2MC3A 2B0LA 1BC7C 2PIYA 4RA2A 3RAMA 3GEZA 1YVOA 2X0LA 5LRKA 3V8KA 1PJUA 2HQAA 2JWTA 3CCEI 1Z8XA 2M8GX 3HDDA 3SQNA 5IY5H 3ZMZA 4F3QA 2B4DA 1F4KA 5EEHA 2L4AA 1JT6A 3ASOH 5IP7J 3AL0B 5TRDA 3CUQA 4YIIA 4BQNA 3CLOA 5IYCJ 4QC6A 5F08A 1L0OC 1X10A 3CJNA 5CBMA 2BL1A 2IS1A 1XMAA 1FSHA 2PJAA 2Z33A 4M3FA 4KIFA 2D1VA 5D29A 1WCMJ 5EEGA 3FX6A 4K2EA 4M6HA 3E59A 1UMQA 3KGQA 1Y0YA 2GVIA 1VQNI 1TWCJ 2K40A 1GVJA 3GB0A 5JH9A 1S7KA 2NSMA 4V19K 2HNHA 1AMPA 3PO2J 4P1WA 1UHMA 2AE6A 4W9YA 3BCAA 2VRWB 4W1UA 4F6AA 4RGXA 4MFPA 3SGBI 2OQRA 3H4QA 3E5XA 4YU9A 1FLIA 3AAFA 1BN5A 1HC8A 2DJIA 3BC8A 1FIAA 1U78A 1Z6RA 2RIJA 1PUAA 1HDLA 4F9VA 4H89A 2Y9ZA 4HQMA 2ERWA 3COAC 2M2EA 3DPLC 2QMLA 3RYOA 4XKWA 1PUFA 1B1BA 1SFOJ 1B8IB 1HKTA 3CZXA 1XF8A 1LOKA 2EA4A 3V7ZA 1XSVA 5E18F 4IJAA 1HJAI 1OCCH 2XKOA 2NVXJ 5FLXK 1D1BA 2KMOA 4UFWA 3J7ZI 2YU3A 3D7GA 3W91A 3EUHA 1ZG7A 3GTPJ 3NH4A 3OYMA 4S04A 4BXFA 5JI6A 1XRYA 1ETVA 1SANA 4Y17A 2X51A 3A4CA 4WXCA 1WGXA 1UAAA 5EGOA 3VYTB 2R7XA 3H9GA 4G6QA 4L9TA 2F5FA 3CXPA 4ZC3A 3ZN1A 1B6BA 5DWMA 5G22A 1H8AC 2DXIA 2WA0A 1MNEA 2D1HA 1D8JA 4AM3A 1QQ9A 5JVGF 1N13A 2CQ7A 3QP6A 3ABUA 2DOFA 4HNVA 1ODDA 4FQGA 4A0ZA 1WGCA 5ELYA 3K7AJ 1GVDA 1TQPA 2FL4A 2E5ZA 3BROA 1SVMA 1WKXA 3ML6A 3BR2A 4KFCA 2PSWA 1ZREA 3OXGA 2NVQJ 4FETA 2K9LA 1WHUA 2ELJA 2JA5J 5D4SA 2CF4A 3RIRA 3G1MA 1W1WE 2HOTA 3L2QA 2VOPA 1R3NA 4CYPA 1HCRA 2CSOA 1XGNA 2QUFA 2EVNA 4CAXA 1Y1WJ 2KIQA 1LAMA 2MLGA 4CH7A 2HDDA 4UFXA 3H3UA 1OCZH 4L9NA 1TWGJ 2X85A 3MAJA 5THWA 2PVWA 3S1RJ 2JVGA 5F04A 2ZEEA 3LA7A 2OOTA 3V42A 3RKQA 2LH9A 1VI0A 2WTEA 3TGNA 1Y39A 1DS3I 4Q38A 3H9QA 3GTKJ 1YQEA 1YW6A 1Z3XA 1ZLIA 2ZW6A 2ZJ2A 3EPZA 2BUSA 4KSIA 3CJQB 4EWTA 2ORVA 3T8TA 2PJ8A 3QP5A 3RPUA 1NH3A 3LMMA 2W82A 3GBGA 4PSXA 3VSLA 2ODDA 1MMDA 2LKPA 1ZGJA 3FHNA 4S0HB 1FT9A 1MSEC 1YMEA 5A27A 3ABKH 3CF5F 2EZIA 4MLOA 1P9GA 3O8GA 2RNJA 2EB7A 5EEAA 3FNCA 2J8NA 1QO0D 4OIDA 1IB1E 2RREA 2P7CB 4PK3A 4OMZA 1R0RI 2M5XA 5HDNA 4HNYB 1Y0RA 5DWNA 3B8GA 2DAOA 3A1YA 3MKYB 2KT0A 1WVRA 3JW4A 2Q4ZA 1WK4A 3IJ3A 5K8MA 5K8NA 3FMRA 2BXYA 4NCZA 2HR3A 4UIBA 2V9VA 3ABMH 3DTIA 4H0EA 4NGTA 1FBQA 4D0PA 3IO1A 5JLXA 3VATA 1HW1A 4KIBA 2XF5A 1G3YA 2VQGA 3GTMJ 4G7ZF 2R7VA 2HS5A 5F27A 3D5SC 5LRSA 3DU6A 3HOSA 2Z2SB 3DP7A 4XKCA 2UWMA 1FOXA 2L8EA 2QLZA 3IWGA 4I02A 2EV6A 4ESJA 9ANTA 3L2CA 1I1GA 5AIQA 2EV5A 1K78B 2EZKA 5IB0A 2XVCA 1Y9WA 4BJ6C 4ENKA 3CPXA 4QIWN 3PIOF 2FT0A 5FGMA 3I4MJ 1I1SA 1IY6A 2ARHA 4F0YA 1OISA 2EFQA 2WPXA 2Z3LA 1Y56A 5CLSA 2JUGA 3AG2H 3OOUA 4BQOA 1VQ9I 1DE4C 3UEYA 3HUVA 4RS8A 4MFKA 3PSFA 3CCQI 2Q43A 1YLFA 5LGUA 2R5ZA 5IP9J 2DFEA 1WZ2A 3GTJJ 2MBFA 4ZJZA 4X5KA 3S1NJ 5JGFA 5HXDA 3IWWA 2DI3A 2CO5A 1VTNC 2DA1A 1QPIA 2V6EA 2V77A 2ESNA 3JRIA 2X4HA 4LLNA 1VQKI 1KUYA 3GTLJ 2K9NA 2WY8Q 1IN7A 3CESA 5EG0B 1OCTC 4KJZA 3N97A 1L3LA 2BE5F 2Y69H 2AFXA 4P96A 4KA4A 4A38A 1DP7P 1J0RA 2Y30A 1EV7A 1UG0A 4WWVA 3S6HA 1BUSA 2I79A 2F48A 4I49A 2P6TA 1R58A 3KP7A 5JM6A 1IC8A 2L3DA 3RU0A 4BE0A 2HYGD 1BPNA 1TZLA 4M3EA 4A6DA 1BI3A 2VIXA 3BR5A 2KMRA 2Y75A 2DPSA 1P92A 1FPQA 1KZHA 3ERED 1AKHA 3BZCA 2Q7SA 4Y49C 3DKWA 1MDMA 2MFZA 1J2XA 4JK1X 1FZPB 4B3XA 2JA7J 2KIMA 6CPAA 1Y0NA 5FJ8J 2DPTA 4NGRA 3C18A 1T6SA 2HPIA 2XPUA 3LWFA 4L5JA 4AVCA 1D1CA 1S20A 1X4PA 1MW7A 3G1OA 4H6ZA 3S93A 3I9V2 3T90A 3H35A 2PX9A 4G9YA 3VYUB 3FF5A 4G6TB 2WAEA 4E2AA 3R0AA 3AG1H 5EGOB 4YWYA 1ZGWA 1J7KA 2UVOA 3A0BC 4L9MA 1TBQR 2K5TA 5H86A 1V54H 2IS4A 3SXYA 1LCPA 3I9SA 3OMYA 1FEXA 3OVOA 2H09A 3BTCA 2IT0A 1YSJA 1RC9A 4NJRA 2CFXA 2FD5A 2ZSHB 3H8GA 4CGZA 2Y9YA 3H1CA 2NYXA 5CJ9A 5J1RA 2HC9A 1R43A 5FO5A 2AFMA 4J3GA 5C82A 1YYVA 1OYYA 2I8DA 5HS7A 1NK2P 1YW9A 2OZUA 2VJIA 4E7LA 3CMYA 1V5FA 2EWNA 4I09A 3K2KA 3JRAA 1ACIA 4C2YA 1AYEA 1SQHA 5LYFA 4ONUA 2CS3A 4PK2A 2Q1ZB 2X1CA 1LRZA 2C6CA 2V8GA 3D68A 3GLJA 1P4XA 3B02A 4XBFA 1OBRA 3FZVA 3HYIA 1TIQA 4MFZA 3G8WA 4AVBA 3MGDA 4R1HA 1IZ1A 1ZR4A 2QQ0A 1R23A 3B3SA 1XCBA 1HKQA 1JQGA 1IDYA 1W7PB 3RKWA 5J47A 4OC2A 5F09A 3D7FA 3FISA 2PJRB 1ULKA 4C30A 1A35A 2B7EA 5DV5A 2HV2A 1POGA 3TE4A 4P4FA 4XKBA 4OMYA 2XHKA 4X2TA 4Y52J 2B5GA 1N75A 1I3QJ 2Z3OA 4DIQA 1KGSA 1YOVB 2UXXA 4AXVA 3PUFA 3PNVA 3PBEA 4HKFA 4PXBA 1S6LA 4AC0A 3Q0UA 4RB2C 2V9KA 4I98B 1Z6TA 1MJ9A 2E60A 1ULNA 3BJ7A 5EZHA 2XEJA 2L0KA 3E6CC 4UVCA 2KRFA 4ZDLA 1N78A 4FE4A 2G7UA 3ZR8X 1ZKGA 2RC4A 3L00A 3H36A 2UXNA 1LFBA 3F8FA 3R9EA 4Y33A 1S72I 5ICGA 2W25A 2PE3A 4GYIA 3M8FA 2IBDA 2XROA 3F8CA 4E1RA 1MNMC 2NRAC 2CTBA 2EUIA 1P2FA 4JXQA 4DOZA 5HI7A 4JX5A 4ZYGA 5BQTA 4A3GJ 2DB6A 2QPOA 2O4HA 4KISA 1U5TC 2DA6A 4OC1A 4I6ZA 5LYLA 1T0FC 3PO3J 3T8WA 5LGTA 2BSWA 3J7AY 2PIZA 2QKLB 3DF8A 1JKPC 2ZMEC 4RMNA 4RAZA 2CQXA 2K4JA 2HOEA 2DFFA 3WE3A 3TOAA 4XPDC 4YFJA 1R1VA 1W4RA 1XOVA 1H88C 3T9YA 1XSDA 1ERDA 2DQRA 2D45A 3P2FA 4JYKA 1S7FA 2Y0MA 3CXQA 3A03A 7CPAA 2QCOA 4BMHA 2OTJI 2I3CA 4FCYA 3CLQA 2XEIA 3FF3A 2LF8A 3OYJA 1ZG5A 1CGII 1GHEA 4B5PA 2XIGA 1XB4A 3I55I 1ITYA 1IOFA 4KT6A 1BLLE 3ZJ0A 4A5NA 2J9AA 2DA3A 4A69C 4FT8A 5LHHA 2LRDA 1Y9KA 2ZXVA 1TXRA 2PC1A 3PUBA 4EM2A 2XUBA 5M5XJ 2OCCH 2P7VB 5H6QA 5LRRA 4YFNF 5IP6A 1BIAA 2FNFX 3IWFA 2C6PA 4A0YA 2AQFA 5DUKA 3C3WA 4UXJA 2QQBA 2X6YA 4OMEA 4C3JJ 2LYCA 2FXFA 3I3GA 4NGNA 2LBFA 3N7ZA 3FBIB 2GM4A 2ISZA 3PNYA 1LFPA 3QAHA 4IHTA 2CTCA 2VL8A 4F8ZA 4BINA 1ZYRF 3SZTA 1UFHA 4XKVA 1HBXG 3G4SI 3VWBA 5JHWC 2ZPAA 4QB9A 2XC7A 5J1QA 5HODA 1M1DA 1XG1A 3UGIA 3EXNA 4LUAA 3ZN0A 1SGQI 1P4NA 5CYVA 3S1QJ 5DCMA 4HNUA 5ED4A 4OC0A 4BHBA 1HSTA 1ARLA 1CSOI 4MBUA 4UXNA 3H8EA 3S3NA 2FNPA 4Q7AA 3FECA 2KMUA 2LY1A 3C2BA 1RR7A 3QYFA 1MIJA 1H9GA 3QTLD 3PM1A 2R7QA 1Z8TA 3ZMUA 3KZZA 3RPQA 1F57A 2IMOA 4H6UA 2EIJH 2PJ5A 1LFUP 5K1YA 3UGDA 3ZP5A 2ECCA 3E1SA 5J8CA 1K7AA 4R87A 2CW8A 2O61A 2MC4A 4MRIA 4UA3A 4DJLA 1M8BA 3S16J 2K02A 2H94A 3RSNA 4WXHA 3MKLA 2XGXA 3X2QH 3DEEA 2TRTA 1WI3A 4YRVA 4F52A 5B66C 4CSWA 2L9NA 3GKRA 2FSRA 1STZA 1K4JA 8CPAA 1T2KA 2VKHA 4UXIA 1LB2A 1MMAA 2XRCA 3ULQB 1K61A 4KOUA 2Z3YA 1R1TA 1LR8A 2CJSC 1EH7A 5DM7F 2Q0OA 2JSCA 1XBUA 3LWUA 2L9SA 1UFMA 2KRHA 2P4WA 1H8LA 1PTQA 3TO7A 3DKYA 3GTOJ 4BBHA 2FBHA 2EBJA 3FBUA 4S05A 2R7FA 1RESA 4LQ6A 3FM3A 2DFIA 3RYPA 1ZK8A 1YLOA 2OQGA 4A3DJ 4P4IA 3CDIA 4EVYA 5EJCA 2E5NA 3KE2A 4IF5A 5IT9K 4M85A 2B5GB 2E7XA 2W1OA 3RCOA 4Y13A 2V8HA 4KUMA 2GLFA 3BJAA 2VT3A 1SMYF 2IS2A 3ZMVA 1Q1HA 3WU1B 3ZMTA 4EATA 3F8MA 1J5YA 2Q04A 1TBRR 3UNGC 1H9TA 2XEFA 3VDXA 2VT2A 1QQIA 1GV2A 3JRHA 4PSWA 3S15J 3H5NA 2K27A 3MKZA 2KZGA 4LG0B 2TCTA 2RDPA 3OR2C 1Q2YA 5E3OA 4NQWA 2POKA 5DAEA 1JI8A 2O6GE 3JR9A 2CIJA 2FS5A 1NTCA 4XL9A 3VH9A 1B4AA 2ZFWA 1LVKA 3T0YA 4M6YA 2ZCWA 2V9PA 4KDPA 1Z2IA 1TIHA 5FKKA 4OIQF 1CQTA 5HH1A 2JPBA 3WHCA 5HLTA 3KFWX 1FYBA 2CG4A 1OKRA 2QKMB 4BKXA 2UZ3A 3T8RA 1ZTRA 5AG4A 1IN6A 4KOXA 4ZDOA 1P4AA 1UJ8A 2BGCA 2VE9A 3EY5A 3QB8A 1TW2A 4XLCA 3FEDA 2FMLA 1VQ7I 4MCPA 3C2HA 1VNDA 4UUSA 3D7HA 2KL4A 1XMXA 1LNWA 2H1LA 2W57A 1YJ9I 4U0WA 3PP9A 5CPRB 4EMSA 3S6GA 3WC5A 2F5DA 3VYSB 4CGNA 2R4GA 1AOYA 4YIRX 1PVEA 2ZC2A 5L3DA 4EMEA 1Q1VA 3HBLA 3SFIA 3B3WA 5HVFA 3FMSA 1BMOA 2JZMA 3EQLF 3E6BA 4C7HA 3E0KA 2E1OA 2Y31A 2VODA 4ITVA 3DU5A 1KMAA 4CICA 3E5QA 3VSKA 3WGIA 1EH8A 5J1UA 2M8EA 2FQ4A 1UWYA 1WFXA 4PJ0C 2SGEI 2ZW7A 3FXRA 3M8JA 1FYMA 2JUCA 2LSOA 1DQUA 5L3EA 4R9MA 4M3DA 2CUJA 1ETYA 2XAJA 3ERMA 5KAIC 3BP8A 1IAWA 3SGQI 2C6GA 4PXCA 3V8JA 2FE7A 1X1PA 2CGPA 3K4LA 1Z5RA 2JRTA 3GW2A 3T1BA 3SHPA 5CPAA 4FASD 2NU4I 2ELKA 2CUEA 3S8PA 5FUYA 3HPHA 2K9HA 1Z7LA 4RLQA 4JCVE 1PDNC 1FT7A 2ATRA 2D4PA 1XFOA 1VKCA 2KMQA 2Z3KA 3ROUA 4OIWA 3HLPA 4WX9A 1YITI 3G6EI 3WC6A 2W00A 2IGOA 5DCMB 5TJJA 4MQ9F 5M5WJ 2EIMH 2EIKH 3GTQJ 1V3FA 3PGPA 4OC5A 4IHYA 2KDOA 1T33A 4MEYF 1MMSA 2IGNA 3CP8A 2D2WA 3PIPF 3RZOJ 2V1CC 2ADUA 5FFXA 1RXTA 4MHGA 3HUGA 4J01A 5GADJ 2WADA 2HDCA 3HHGA 2R7TA 3TX8A 1RI7A 4EM0B 2SGQI 3K6GA 2ANPA 5BOXA 4CYCA 1S9HA 2RAEA 4U9ZA 4KT5C 4RM3A 4QPQA 2MLKA 1XS9A 3NFZA 1MBJA 1SVOA 1ZELA 2DPUA 1MJBA 3I64A 4EEFG 3CCSI 4BDYA 5ILUA 4A5MA 2SGFI 3K69A 1T95A 3LSRA 3BDDA 3HSRA 2GREA 3RDIA 4C7IA 2JBJA 1TT0A 1VHEA 3MRUA 4DBQA 3I4NJ 3BPXA 1J9IA 3S3OA 4QVTA 1F9NA 2RQQA 5E1XA 5HS8A 3ZQ7A 4LJZF 1SFXA 4ZYHA 2KRCA 3JTGA 1G8XA 2LFBA 1C0WA 4D5FA 2L7XA 2QZ8A 2CNTA 1P7IA 1IICA 1TF9A 4LD5A 5IB9A 4B4CA 1ZG1A 3R4KA 5CQGA 3GOXA 2V8VA 1OCOH 1I3AA 2EFWA 2QVOA 4BUPA 2PMUA 3OS1A 4MXUA 4HNWB 4IQ4A 1WH5A 5TGTA 2WCYA 1DU0A 4UFVA 1XN7A 4Y3OA 3SZPA 2O8XA 5J1YA 3JUWA 1GV5A 5KK1A 4C68A 5KTCA 2QF7A 3IV5A 2VZZA 4ETSA 2HU9A 5F47A 1X3UA 1PYTB 1Y6IA 4MTDA 4BHCA 1IRGA 4K3NA 5HVGA 5D4RA 1HDQA 1U5TA 3SI2A 1Y0UA 3OIOA 2OC6A 3F0AA 4HF1A 4GFBA 4C2MJ 1QSRA 4JXRA 1YX3A 5CNPA 2NAZA 2ZEDA 2E5RA 2ZMEA 5B1AH 3NAUA 2P81A 1XDSA 1X74A 2CXAA 5FRMA 4BEHA 1Z7KB 3N4MA 1F1ZA 3FXJA 1U9OA 4Y4RA 1X3ZB 2GXBA 4NXYA 3CTAA 2V53A 3JREA 3H5AA 2CJJA 1QMUA 3VDUA 2COMA 5LYDA 2ZNYA 2GQQA 1S29A 2STWA 2XB0X 2VJ5A 2D5VA 4JLYA 5GP9A 4NGMA 1SC7A 3D2MA 5HLIA 1O7FA 1JKQC 4P9UA 1TWAJ 1QHHD 3K4BA 4ZH4F 2GXAA 4X6AJ 1XA6A 1D3YA 1YS7A 2XPWA 2ZNZA 1QBJA 2H6CA 2ZO4A 3K1NA 4UWIA 1JUSA 3FXUA 2PI0A 2NNYA 2E73A 2MABA 4CAWA 2J87A 5FUXA 2XDVA 4IZZA 4KIGA 3WTXC 2MSYA 3NEUA 3CUOA 3B6AA 4XONA 5DM6F 3P9IA 2YQPA 3TW6A 4RB0A 2ME6A 4B13A 1DP3A 1SEUA 2LY2A 3TO6A 2XF6A 2A6TA 1SFEA 3HRSA 4Y15A 2YNCC 4P10A 3KL9A 4A37A 3GLLA 4BS9A 2MG4A 3DV8A 3IRQA 3FB3A 4Q5SF 3OY9A 2M4GA 2FXAA 3O2PE 4UUSB 2ZW4A 2O8KA 3LAPA 3JSOA 1GHCA 3FIWA 1OQYA 3UFFA 1TT5B 4A3MJ 5ILVA 3EO4A 5F48A 4U7BA 2CV1A 2NNNA 4G8XA 4CDGA 1LAPA 2AFZA 2BOAA 2EILH 4I7HA 3EYIA 2PJ4A 1FARA 1ZHFA 3V38A 3DR6A 3W6SA 4QLCU 1KYZA 2DDBA 1IN4A 1YHQI 2HVQA 2BZTA 5IYBJ 5IT9Z 5FKNA 2F5EA 2OF7A 2E1MB 3K2AA 1I21A 3ZXSA 2JQ7A 1OVOA 3TCVA 4KVOE 1BR2A 3ZMSA 1ELLP 2Z0ZA 2D4OA 4RGSA 4DW6A 3OYNA 3KPHA 4FE7A 4CCKA 3HM5A 4ANJA 1XEBA 1WRJA 1YIOA 3CJTB 2YX7A 1SGNI 1R22A 1KU2A 3A0HC 1XSXA 3HSEA 1RPWA 2ZEGA 4RAFA 3W6JB 1FNOA 4B6DA 4U87A 2JK3A 4RB1A 5D5XB 5FUVA 5CCMA 1PP8F 4SGBI 1X12A 1HW2A 1Z4EA 3S2DJ 1LE8A 4ENJA 3D3SA 2X6OA 1QSTA 2IXSA 3IKVA 4GYGA 2IA0A 3G71I 5GTIC 2L7MP 1RTQA 3S1MJ 3GY9A 3EFAA 3NH5A 3CCVI 3K4JA 3SI1A 4N9IA 2W0TA 2ICWG 3S9MA 1XTAA 3E6MA 3MZHA 1O3RA 2R5YB 4P9FA 2GLJA 1JUPA 4KNYA 4RS2A 2BVMA 1QSOA 3Q0VA 4CO8A 4NGPA 1DDNA 4L5EA 4ZY2A 2NOGA 5D5VB 4A3KJ 4HV5A 1IOIA 1Z1DA 2O3FA 2JSPA 5F1JA 2K9MA 1TGSI 4M72A 3DPTA 1E17A 2PJ6A 3I3LA 2DYSH 3RKYA 1R4NB 2P5LC 2QVPA 6PAXA 4LLLA 3ZQGA 4FTHA 3NWSA 2PLYA 3AG3H 1Y8RB 3IU1A 2F2EA 4OLLA 3HGGA 4XNFA 1TKFA 5D6FA 3F8KA 4P4EA 4CAEA 4IRIA 3KZIC 2WWYA 4RDUA 2VI6A 3OWTA 1TBOA 1Y1CA 4MEXF 7WGAA 2Z3MA 3MEXA 2NS0A 3PBBA 2YUUA 1OYWA 4HQEA 3PFOA 4B11A 1K7TA 1I5ZA 1LVAA 4RUHA 4BE2A 2OD1A 3KHZA 3GFMA 5BMZA 3E5UA 4XLHA 1UCRA 1U6GA 3U1DA 4QSHA 3R95A 4G6DA 2WB1N 2CQNA 3BZ6A 4LFUA 4F93B 1IW4A 3QPTA 4JP0A 1REPC 3H0GJ 1ULYA 1WJ5A 1LQ1A 1CG2A 1NXUA 1BJAA 2EFNA 1HW5A 2HQNA 2CWEA 4JZ0A 4IF4A 2L9RA 4AG9A 1BM9A 2G9WA 4DQ2A 3QODA 3O8HA 3C2GA 2JJ7A 3OSGA 1S7LA 1WQ2A 4OOIA 1ETOA 1DGRM 3V4GA 3KASA 4ZX8A 5HQ8A 5GTHC 2QWWA 3SJXA 4II2A 2K86A 1IRZA 3K70C 4HF2A 1DU6A 3LFKA 3IHUA 2VC1A 2R0QC 1A31A 4G7OF 4GS4A 2ZMEB 1BL0A 1SGDI 1Q2CA 3I56I 4KOSA 1HDPA 4WK8F 2VE8A 3F6VA 3U1KA 3IAM2 3Q5FA 1A2ZA 4MFJA 2KFDA 2DK8A 2IPQX 5J40A 5EZGA 3I5UA 5FLMJ 2KQRA 2IRFG 3D1NI 5FRNA 1YRNA 2IA1A 4OU0A 2WZNA 1RO5A 4AU7A 5DD4A 4M6IA 3U9GA 2H8RA 1OMTA 4ON0A 2K7LA 4A31A 1YTPA 2M34A 1VQPI 1E2XA 3KI9A 3Q9VA 3WU0A 1ZRFA 4OAEA 1TOTA 3NE8A 3LMSA 3M1CA 2G0BA 4M3SA 1CF7A 2CYYA 1CX8A 1UUCA 2M87A 4O6JA 3K2ZA 5FKOA 3DSBA 2F4IA 3K4NA 3HC7A 3JAMZ 1GT0C 4AMLA 3A01A 2QQAA 2FOWA 1MZBA 3B35A 1X2MA 4UB6C 4A12A 1T98A 3OYLA 1FJLA 1LDKB 1HEVA 3JRDA 1IYLA 3BOQA 4DZPA 2ZEMA 4BQAA 1XD7A 3CZ6A 3LA2A 4R3KA 1O3TA 1YX5A 4PDKA 2DK5A 2GA1A 2ZENA 2MD0A 2G0EA 2B4DB 1R5GA 2HTJA 5DS9A 4A24A 1NG6A 2E34A 3KEOA 1V55H 1IJWC 2WB1A 3CUQB 3J7AO 3QU3A 3CDLA 3G73A 1VFCA 2PCUA 4HAMA 4H4KC 4KN7X 3IKTA 3TJQA 2BCOA 1B9MA 3SXOA 2M0CA 4HDUA 2VQLA 2WAFA 3PQJA 1M8CA 3BWGA 4HF0A 3SDGA 4DJAA 2XSDC 3JCUC 2DA5A 4UUVA 2ENNA 3E97A 5C4JJ 1ZRCA 4E8OA 4U0YA 1H0ZA 3TDZC 3RYRA 2HQYA 3JRUA 2MYSA 3FWEA 5H20A 3WGHA 3GUXA 1QSMA 4BJ5C 4JOMA 2LKXA 5C44J 1AA7A 5EYRA 3GZNB 2V1CA 3SJMA 2EFPA 2REEA 2RQPA 2FF4A 3SEQA 3CDHA 2JZYA 2CUFA 3IL2A 5IYDJ 4Z65A 1B72A 1TURA 1PJRA 2DLLA 4UUTA 3OYHA 4RN7A 3S6FA 3K70D 3QPSA 3KEYA 3HOTA 1UB9A 4MY0A 3R9GA 4EM1A 1PUFB 3AL0C 4FD6A 5CVJA 4B6ZA 2BO9A 2VXKA 5BNGA 3FKJA 3DXJF 3H3ZA 3NQOA 5FD6A 1U8BA 2EWBA 2OD5A 2UV1A 4AVZA 5I0CA 4UNOA 4IRHA 4EJTA 1DGWY 3TDUC 1TW3A 4L9VA 2E71A 4XRFA 5F0FA 4LK0F 3CC7I 3UOEA 4ZYEA 4AD9A 2HKOA 4NDLA 2N17A 1MKMA 5K5OA 3D5LA 3IUOA 2Z5UA 1Z2LA 4QWQA 3AG4H 2V6CA 3L7WA 3DTEA 1IF1A 2JXDA 2DA2A 4N4NB 3DNSA 3FDYA 4ONWA 1BBYA 1BJZA 2DOEA 2ZFUA 4KSFA 1PCAA 2LR8A 3V7SA 5DDGA 5AG5A 4HZFA 2EZHA 4PK4A 3MN2A 1Y1BA 5K8PA 2A5YB 2VC0A 2AXLA 3J80Z 1TQIA 4CA0A 4B47A 1JKRC 3BXMA 4UBRA 2WUUA 1S5LC 1EA3A 2IA2A 1X1AA 2ID3A 5L3GA 1TWHJ 3AFHA 1YS6A 1SGYI 5E8IA 4P4BA 3D5RC 3W6XA 2HB6A 4CYQA 3PB6X 2EV0A 3C1DA 2RKHA 3FKIJ 3Q9SA 1PUEE 2IVMA 1BW5A 3FSXA 1WKMA 5DEQA 3ZQQA 5K7ZA 2Q51A 3OYCA 1FOKA 1WH7A 5HS9A 1R5HA 1APLC 1FOWA 3IC1A 3DLAA 1KU3A 2F5IA 2ZXWH 1PYVA 2NXNB 2XGEA 4MGRA 2FMYA 2X1DA 4GRIA 2QQDA 1FY7A 2M9HA 3S17J 3KEQA 4Q36A 3LSMA 4KOYA 5CVUA 3FXMA 4MTEA 3WHBA 4UVAA 4RBOA 1YW8A 1LR7A 4U88A 3F72A 1QVUA 1WJFA 2CW0F 4EJVA 2R92J 2L4MA 4EGYA 1XX6A 1K6OA 2E7WA 1XMKA 2X6XA 1G6NA 4XR6A 2Q2EA 3IWZA 1HOMA 2R3SA 2IEKA 2R7DA 3SJEA 2HXOA 2VPRA 2WGCA 2DA4A 3F6OA 2OCEA 5HVHA 4F91B 4KUBA 2A20A 3MQ0A 2RFHA 1OCPA 5E1WA 2OVOA 4F0XA 1S7EA 1VQLI 1R1UA 2KKOA 5HLHA 3WTUC 3S3MA 1G59A 2FVGA 4A39A 4UEEA 1D5VA 1Z9CA 1SFKA 2F3CI 4D7MA 1VQ5I 2EJRA 2P5KA 1ETWA 1W5SA 2VJJA 2AJ6A 2BY1A 2OB0A 3B73A 1RFHA 1J75A 4JX6A 5CKTA 1SGEI 2YNCA 4BNCA 1A6QA 2O53A 2Z3NA 3FK7A 2Y2ZA 3A02A 3R9FA 4YG2F 4KOTA 3TP0A 3V7RA 1R49A 1P4WA 3FK6A 3EUAA 4R57A 4IAVA 3VOEA 4M9SA 2KJCA 3WTSC 2IJZA 1I1DA 1M1EB 3IC7A 4MIMA 2HKXA 2V79A 2ZKZA 4A93J 1HXDA 5E17F 5JHUA 3KHXA 2K9QA
chains in the Genus database with same CATH topology
2GAUA 5F64A 4HLXA 4CS0B 5FFZA 4AVAA 1U6MA 2Z3PA 2JTVA 4L9JA 2HQRA 2W84A 5ISVA 4CHUA 5ILSA 2QBYA 2E1NA 4P55A 4YGOA 2FU4A 1YX0A 1LEBA 2BEIA 2GA2A 3A9LA 1B9NA 4JWPA 2Q7BA 1H0MA 2BBYA 2PMHA 1ZLKA 5HMNA 2B3UA 1ZN2A 5AG6A 2IL4A 3WTZA 2FRHA 2WPWA 2L02A 1QPMA 3TKYA 2Q8KA 3VEPA 1KUVA 2C27A 2HEOA 4G7HF 3REOA 1R36A 5D8KB 2PR8A 4HDVA 2DT5A 3VFZA 3RJPA 2Q4VA 1MDMB 2P6FA 4E0AA 4HBLA 3TT2A 4EGZA 4XSZF 1FYLA 3FHZA 1ZLJA 3IWEA 3CO7C 2NMTA 4CRYB 4OADA 1SAXA 2FA5A 4HA8A 3K1PA 4KS9A 5JFRA 4OIPF 1SD6A 3D0SA 3LA3A 5IV0A 2WV0A 1JHHA 2Q44A 4HX4A 3KKWA 2K4BA 4K30A 2XAQA 1DPUA 5ICFA 5A28A 5BWAB 1DPRA 5EBVA 2QM3A 2XRNA 3F23A 4OIRF 1WI9A 3GYHX 1ZH5A 3I53A 1JXSA 3GFIA 4UCPA 5JR3A 1S7OA 5H84A 4GGGA 1KYWA 3RI4A 2XAHA 1XGOA 5BPDA 1RNLA 2V1DA 1PU9A 4AVPA 1IXRC 4IVNA 3F8NA 4EQQA 5KTAA 2GANA 4DNCA 1IXCA 2VBYA 3I59A 4MFQA 1FC3A 2A61A 2LF7A 2HFHA 1RUNA 4CGMA 4FD5A 1VHSA 2CQKA 4FHTA 1S7AA 4HW0A 4IPAA 4KLWA 1FX7A 4CGPA 4KUAA 1LDDA 3LAJA 5E20A 1M4GA 3K1MA 3WTWC 3JVNA 4QBJA 3WR7A 5ICCA 3GF2A 3LD2A 3DR8A 1WSUA 1D8KA 5J8FA 2Q0YA 5BPIA 4ZZLA 3EETA 4A6EA 1QNTA 4B5PB 2R1IA 4HV6A 1UHWA 1LDJA 5G21A 4Q4ZF 2A6HF 4F7ZA 3ABTA 2QBYB 2A69F 2VONA 3BY6A 3EC4A 3HRTA 4B09A 4YIFA 1J59A 4RAYA 2OZ6A 1G3SA 4ESFA 1XE4A 2R7HA 2ZW5A 3GVAA 4B10A 1T38A 5F46A 3FRMA 2GZWA 1ZGAA 3KP4A 4KMUX 2RVCA 1ON0A 2BUEA 3VWEA 4BYYA 5F6FA 4O5VA 1L0CA 2OAZA 4XLNF 1USSA 1W7PD 1OMIA 2V1UA 1BOBA 4MY3A 4CGLA 4ENNA 3GLXA