3TO7A

Crystal structure of yeast esa1 hat domain bound to coenzyme a with active site lysine acetylated
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
276
structure length
275
Chain Sequence
b'EVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone acetyltransferase ESA1
publication title MYST protein acetyltransferase activity requires active site lysine autoacetylation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 79
structure length 275
sequence length 276
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2011-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3to7A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 3to7A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3to7A02
3QPTA 2DK8A 5D4SA 1I21A 1V3FA 5H6RA 5ICEA 3IWGA 2ZXVA 3TKYA 3SHFA 2M45A 3E3VA 4ZZLA 2PC1A 3JVNA 1Q2DA 3RYPA 2RDPA 3COAC 3IWZA 1OYYA 4O3MA 4EVYA 1ZN2A 4KZTA 2Y0MA 2Q7BA 3P9KA 4IJAA 4IRHA 5HDGA 2L4MA 1B4AA 1JHHA 4JBAA 3ULQB 4JXRA 2FXAA 5EC4A 2BYVE 4CRZB 3I59A 5HOOA 3HTSB 2STTA 1UCRA 4OADA 1H9TA 1CF7A 1NE9A 5LGNA 4WCGA 3KCCA 2EJRA 2VT2A 4KUBA 1V0CA 4KN4X 3EC4A 4GS4A 1LVAA 4HOBA 4F0YA 1OYWA 2B58A 3BDDA 4S05A 2A07F 5D4RA 1Y9WA 2L4AA 1YGHA 4EGYA 1JHFA 3TDZC 1MK4A 4U9YA 3R1KA 3J7AO 2JSCA 2GIVA 1BI2A 3F8MA 1FOKA 1W7PD 1J7KA 2ESNA 1DDNA 4LB6B 2L54A 2WC2A 3VOEA 2G7HA 2Q2EA 4UA3A 1KUVA 2G0BA 1TQIA 3TGNA 2QVOA 3ZMSA 2VZYA 3RYOA 1U5TC 3WGIA 4RB0A 5ED4A 2QECA 3MCZA 4L9VA 2FS5A 3TO9A 5KK1A 4UXNA 1Z7UA 4HX7A 3FB3A 4HLXA 3GY9A 2R1IA 1O3QA 2AS5F 5H86A 2JPBA 5JR3A 1GVJA 1P2FA 1PP8F 4CYDA 2V79A 3C26A 1W5SA 1FNNA 2BL1A 3DP7A 2D4PA 4N0BA 2YPRA 3RKYA 1IXCA 3HSEA 4FX4A 3IHUA 4PSXA 5C88A 5FD5A 2YX7A 3RDIA 2Z33A 4EGZA 2P7CB 1FT9A 5DWNA 4M73A 2RGVA 4XRFA 4KOVA 1FY7A 1F4KA 5IT9Z 1SQHA 3V7CA 1EV7A 3BROA 3R60A 4EQQA 4Z2YA 4MNUA 1XMAA 4A6DA 4IF5A 1SD5A 2HUZA 2B5GA 1KU9A 2KRFA 4BHCA 2ZNZA 1O3TA 3V8IA 5D5UB 2G7UA 2VOPA 3DFGA 2FSWA 2H27A 5FVJA 3FZVA 2P5VA 3U1DA 1TW3A 3R95A 3KE2A 3SZPA 1KZFA 4I09A 3N4MA 5EEGA 4L18B 3GKRA 3W91A 1YIOA 3L7WA 1R7JA 1R5GA 1X3UA 1M4DA 2A4NA 1S7NA 5CNPA 1YX0A 4BNCA 3JTGA 3OWCA 1RUOA 3CJNA 3P2HA 4CAXA 1XB4A 4X5KA 5TJJA 4LK0F 2QBYB 3RI4A 2JDDA 1FP1D 5E1ZB 1HKTA 3RKXA 3E5XA 2CY2A 4CICA 4Q48A 2M30A 4CS0B 4PV6A 3LWFA 5HLIA 1XN7A 4N9HA 4HDUA 3CXSA 3R0JA 3JAMK 5F46A 2F5CA 3K1PA 4KOSA 4M6YA 2FT0A 4QC6A 1XF8A 2O6GE 3NQOA 2ZPAA 4R8HA 4M85A 4AG9A 5ICFA 4B5PA 5BOXA 4PGGA 1FC3A 3C7JA 4OU0A 4QVTA 4KMFA 1ZREA 4CXFA 4M9XA 4AIHA 4IVNA 1YW7A 1OYIA 2VEZA 3KP3A 3R6SA 5ILUA 3BPXA 2UWMA 4TV7A 2JT1A 1U6MA 3Q5FA 5F49A 1J59A 4JLYA 3KP5A 4E0AA 1Z6RA 2H5MA 3QP5A 4M9ZA 3NEUA 4FD7A 4I01A 3KETA 2F5FA 2OZUA 2P6FA 4WK8F 5DDGA 4QUSA 3SFZA 1R22A 4GXOA 1B9MA 4AVPA 4KOWA 3P7NA 2W57A 2KJBA 4NB5A 5FO5A 3DDDA 1R36A 2FBHA 4I2OA 3BLNA 3KP7A 3RJPA 2G9WA 1UFMA 5FGMA 1KQ9A 3ZMUA 2HKXA 3L00A 4JK1X 4CAVA 1U5TA 4EMSA 1DUXC 3B73A 5E8GA 1S7LA 2XAHA 2HZTA 1Y7RA 1RNLA 5KVRA 2Q0OA 3WTYC 4HF2A 2TDXA 4A0XA 5HMNA 3IRRA 6PAXA 3S6GA 2H6BA 2K02A 5BPIA 1DPRA 3O6BB 2HTSA 5D5XB 4M6XA 3OV8A 2J5PA 4U0YA 4OIQF 4BMHA 4I7HA 3JTHA 4Q5SF 5LHIA 2O3FA 3G73A 1DPUA 3MZHA 1XD7A 5KTDA 3F6VA 4I02A 4L5JA 1LQ1A 4P9FA 5AONA 2FXFA 1XDUA 3I4PA 2OD5A 2HQNA 2OQRA 3LODA 4M72A 1YQAA 3BJOA 4KVME 4YG2F 2CO5A 4AVCA 5HVQC 1Q2CA 4KIGA 3F0AA 2NYXA 4HKFA 2WV0A 1KU7A 2RQPA 4AIJA 3KLNA 3HTUA 5CVIA 1IB1E 2RV8A 1ON0A 2FBKA 1MDMB 4KVXA 5HDNA 3K0LA 2IL4A 3GYHX 3F5BA 3EUHA 2FL4A 4MBUA 4E8OA 2FA5A 4XSZF 5LRSA 3LA2A 2COMA 2B3UA 4KIBA 2O0YA 3RPUA 3JSPA 4R57A 1HKQA 4P9UA 2Q04A 1ZGJA 2QUFA 2O03A 5HH1A 2PDOA 5CYVA 2AXLA 3D0SA 1BN5A 4HLYA 3SHPA 1VTNC 4AD9A 1WSUA 2WPWA 4U7DA 4A0YA 3LQRA 4KMUX 2HTJA 4NXYA 1ON2A 1G4DA 4XPDC 3M8FA 2H94A 1IW7F 3TOBA 1Z9CA 1QSNA 3FXRA 4R3KA 5F48A 3WGHA 2GE3A 5DV5A 1GHEA 2G3TA 1S7AA 4AVAA 2A3SA 1LDDA 3T8RA 3QOPA 1OZPA 1F1ZA 2ZCWA 4B5OA 2J8MA 2UZKA 4PK2A 3BP8A 4GYGA 1WWXA 3F8NA 2XAJA 4HAMA 2QIRA 1FSEA 4O6JA 3ABUA 3H3UA 1ZRCA 2A6EF 3PQJA 4XSXF 5HS9A 3SXNA 1P4AA 1IAWA 1KYWA 4LFUA 3KEOA 2ISYA 4JQFA 1J5YA 3D5LA 4HX4A 2XUBA 1Z1DA 4UNOA 3CDHA 2DQLA 3I64A 4RAZA 3FMRA 3E5UA 1WI9A 2UXXA 2Q4YA 2EV6A 1XGOA 4LMYA 5CVVA 3ERED 4LG0B 2ATRA 3N97A 5L3FA 1KYZA 3WTXC 1MGTA 1G3SA 1R5HA 4ESJA 2PR8A 2R3SA 1FYKA 3MFKA 4Q47A 2Y75A 2E1NA 2M87A 3R96A 2DXQA 2KIFA 2GANA 1BIAA 5LLQA 4MHGA 2B4DA 2R98A 3ZP5A 2P4WA 3GFMA 1KU2A 2ELHA 3F72A 2K5TA 1RI7A 4GGGA 4L0ZB 3I54A 2WWYA 1CM0A 2DLLA 4RGUA 1IN4A 3E0KA 3ZMVA 3QAHA 1EH7A 3FHZA 2VE8A 3GF2A 1B1BA 4ON0A 2WPXA 4PCQA 3SQNA 3VODA 1RZ4A 3ML6A 3DXJF 3KFWX 3KP6A 2CW0F 1K78A 3K1MA 4UV8A 5L3CA 5BPDA 4RI1A 1SFEA 3F6OA 1W7PA 2PMUA 3S6FA 3CUQB 3R0AA 2KCWA 4LGWA 4UUVA 4KOXA 1TQMA 2IVMA 4DQ2A 4IF4A 1R57A 5ILSA 3W6SA 4EVIA 4ENNA 5DYMA 2ETHA 4MQ9F 4R1HA 1KUXA 3V8LA 1S7FA 3UY5A 1YS7A 4RS8A 4AIKA 3VB2A 2HYGD 2J8NA 3ISPA 3LA3A 2ISZA 1IUYA 4IXAA 4A0ZA 3GZ5A 5ISVA 2P8TA 1WRJA 2RC4A 4FX0A 4P96A 1IZ1A 3F8CA 4HV6A 3M8EA 1Z4RA 1ZARA 3FXUA 2E7WA 1WK4A 5AIQA 3REOA 4HQEA 3GYAA 3HHGA 5L3EA 3PFIA 5DCMB 1HSTA 1UB9A 2VT3A 5ERIA 4ESBA 1RIOH 4GYIA 4Y15A 4UHTA 4MEXF 2MLGA 1IIDA 1TLHB 3TT2A 1K7AA 4YFNF 3CO6C 1IXRC 2F5EA 2DK5A 4RGRA 4Q4ZF 3FXQA 1V4RA 3HRMA 3BPVA 5F1RA 4YIIA 5E8IA 1MKMA 4G6QA 2VXZA 1YYVA 3QRFF 2HQYA 1Z6TA 3C18A 1T0FA 2K4BA 4GO1A 1USSA 2C27A 2VBYA 1IYKA 4U88A 3EQLF 4OOIA 2VBWA 2OB0A 1QGPA 2Z5UA 4UV9A 2EVNA 2VBXA 4LD5A 4G8XA 2QWWA 3SXOA 3J81Z 1XSXA 2MH2A 4Y17A 1T2KA 3IGRA 4FD4A 4OMYA 3NRVA 4MGRA 2NNYA 1YREA 5ICGA 2PI0A 1SFXA 3E97A 3D8PA 2PLYA 2QQAA 3FMQA 2FRHA 2V6CA 2EFPA 1OPCA 1O57A 2G3AA 3K2ZA 5BMZA 5D5VB 4MTEA 3MWMA 3BJ8A 5EBVA 1XSDA 2R7DA 3LAPA 1WWZA 5FFXA 2REFA 1I1SA 2BGCA 2PRBA 2WTEA 2ADUA 2HR3A 5ILVA 3DF8A 5IT3A 2LSOA 3IKTA 2FIAA 3Q9SA 1FYLA 2VC1A 3IKVA 2FOKA 3WU0A 3WU1B 1ZAOA 3JW4A 1NSLA 4KA4A 1XSVA 2VODA 1J9IA 3K1NA 3KZZA 2PBIA 1PU9A 4WX9A 1H0MA 4KDPA 3W6JB 2ZKZA 2FU4A 1S29A 2YU3A 1S8NA 2XIGA 1IN6A 3KP2A 2Z99A 2I00A 5E1XA 4NCZA 5D5WB 3JAMZ 4ESFA 1J75A 1TTYA 2IJLA 3RTRA 1L0CA 5LEKA 2IRFG 4H6UA 4S04A 2BSWA 4ZZDA 1G3YA 3E6MA 3S6KA 4LUAA 3BWGA 1SD7A 1TNTA 3GXOA 1Y9KA 5K5OA 1IN7A 1STZA 4ENJA 3IWFA 5GCNA 1L0OC 2PQ8A 3TO7A 1S7OA 1QQIA 1FYMA 4OAEA 1QNTA 2FIWA 2BBYA 4DNCA 2OZHA 1B87A 4LB5A 4HZFA 4ZYHA 3EYYA 3K9TA 3I5UA 1J4JA 5DWMA 3I59B 2R7HA 2FCKA 2MA3A 4BXUA 1T39A 2IP2A 3CUQC 2XKPA 2NS0A 2ACJA 1CF7B 2FNAA 2YX4A 3WODF 5FB2A 1P6RA 4ZYGA 2XHKA 4HDVA 2XROA 5E20A 4YFKF 4KOTA 2EFNA 5L3BA 3C3WA 1GXPA 4YFJA 3HSRA 2V1XA 1DP7P 3D2MA 2Q0YA 3RIRA 2XASA 5D6FA 2E1CA 4KFCA 4R9MA 3O3KA 2A5YB 2L02A 1I5ZA 5LHGA 4OMZA 2FBIA 1ZH5A 2K86A 3ABTA 4G9YA 2IA1A 3M1EA 2GWRA 4ENKA 3G8WA 2HKOA 4AVBA 3L2CA 2X4HA 3TCVA 5L3GA 4F6AA 4I0AA 2FEZA 4HNWB 4Y49B 4O5VA 4WXDA 1PDNC 4ZYDA 3TDUC 1QSTA 3QPHA 4L8AA 4MEYF 1IXSB 2DO7A 3S2WA 3DNSA 2IT0A 1MJ9A 5A2QZ 2PJPA 2DTRA 4L0YB 4I0BA 3LAJA 1I6XA 2Q44A 3IC7A 3DR8A 1ZYRF 1WKMA 2Z9OA 3ECOA 4G6DA 4KOYA 1Q1HA 3PGPA 4PDKA 5IB0A 5DD8A 1B6AA 3PQKA 3P2FA 2BV6A 3ZN0A 1USTA 2LNBA 2B5GB 5CLSA 2DQRA 1HBXG 1ON1A 2EA2A 2NNNA 2ZMEA 3S6HA 3KZYA 2XAQA 3CXPA 3E6BA 5JQ4A 4E70A 3ROUA 4WF2A 1Y0UA 3RYRA 4AG7A 3WTWC 4BH9A 5BS6A 3IRQA 2QZ8A 2OZ6A 3ZPLA 1KQ0A 1BM9A 3JUWA 3E5QA 1QPMA 4HYEA 1JGSA 2GQQA 1YLFA 3EFAA 2P6EA 2Z3YA 4BAYA 2X7BA 2HDCA 1P4WA 1I27A 1TBXA 2O61A 1BOBA 2J5OA 2DI3A 5LHHA 4J3GA 1S6LA 1OKRA 5HS8A 1ZRDA 1KQ8A 2P6GA 4JXQA 3HRUA 4LK1F 3GEZA 2ZW6A 4LLGF 3ZN1A 4XNHB 4OINF 2H6CA 4A12A 1RUNA 4ORFA 2JZYA 2VXKA 2XGXA 1MJBA 1YK3A 5FD6A 1Z9UA 4B5PB 2RNJA 2PR1A 4UVAA 4EJTA 4HA8A 1RXTA 1U8RA 4KLWA 3HOSA 4EJOA 4R79A 4LJZF 2GAUA 1S7KA 2W85A 3D2PA 3EETA 2P6TA 2CQKA 1FLIA 4GCVA 2W25A 2CGPA 5FLXZ 1T98A 3F23A 1F9NA 2KIUA 1XEBA 4N9IA 2ZJ2A 4UVCA 3O2PE 2H09A 2FNPA 1YW9A 2ZNYA 1U78A 3MQ0A 2L01A 1CGPA 4R3LA 5C82A 2RVCA 4RS2A 2QENA 2L3DA 1VKCA 2JRTA 1SMTA 2D2WA 1PUEE 3KP4A 2XAFA 3FM5A 1IICA 2B3VA 2LKPA 4RB1A 5CVUA 4L5IA 1KUYA 5E1WA 2O8XA 3M9AA 5K5RA 3EXNA 4EJVA 4KLVA 3QU6A 4YRHA 3DSBA 1U5TB 3GUDA 2ZW7A 4HNXB 5IX3A 1D8KA 2IPQX 1E17A 3BJ6A 2XV4S 2VBQA 1UHWA 3FF5A 1HW2A 4UWIA 1P4NA 2HFHA 3I9SA 3QU3A 5HLGA 1LNWA 2QM3A 4RGXA 4LX9A 3RKWA 3W6KB 2M1BA 1BC7C 3TTHA 1OR7A 4IHSA 3VWDA 3U2RA 2DBBA 4NHJA 2OBPA 3G3ZA 1HW5A 1ZG3A 4ASNA 4G94A 1KGSA 4EJUA 4YGOA 2HOEA 2IA0A 1Q2YA 4EM2A 4I49A 3KEQA 3MAJA 3J80Z 5JI6A 2VN2A 4Y49C 5JHUA 2D1HA 3GZ6A 2B4BA 2K4JA 2V1DA 3C1DA 2DPUA 1QO0D 1O3SA 3LA7A 3GO5A 1P0HA 4L9NA 3SZTA 2KKOA 3DPLC 1ODDA 1N71A 2OZGA 5JFRA 4KUAA 4YFXF 4PSWA 4ZYEA 3HYIA 3FIXA 1HQCA 3E6CC 4U0VA 2YR2A 5D8KB 5DEQA 3WTTC 3EYIA 4B09A 1XCBA 2EFWA 2ZXJA 4BYYA 2MLKA 2W24A 2DFIA 3V7RA 4OLLA 4P5OA 4UVBA 2GXGA 1T6SA 1FBQA 3QP6A 4HW0A 1FZPB 3R9GA 3MGDA 2RN7A 1IYLA 3R9EA 3GW2A 3F8KA 1BI0A 1ZLJA 2D45A 2K7LA 1FBSA 2OU2A 1R00A 1NMTA 4U0WA 4M74A 5D8LB 3TE4A 2C6YA 2DU9A 4QB9A 1XMKA 2MH9A 3LFKA 2AJ6A 3WG9A 2FMYA 2KIMA 2JLMA 2BEIA 3I0TA 3LD2A 4FHTA 4A5NA 4OIPF 2GXBA 2CWEA 3ZMTA 1ONVA 4XPKA 1O3RA 5LGTA 4PGHA 1BC8C 2EB7A 4HBLA 3BY6A 2NAZA 4H0EA 4BHPA 4LLLA 2EUIA 5F47A 1XE4A 2QLZA 2CYYA 2ESHA 4FD5A 3GLXA 4XNHC 4EM1A 1SD4A 3I71A 3Q9VA 3T9YA 3AAFA 3MEXA 4KNYA 1QSRA 4MTDA 4R87A 2YSRA 2QBYA 5EEHA 5DCFA 3WGGA 3ZZIA 4D0PA 3DKWA 3EY5A 5H20A 3EDPA 2FE3A 5JVTA 1YG2A 4CAWA 4B8XA 3FMSA 4EV0A 2OQGA 1YVKA 2XAGA 1BI1A 4F7ZA 2REEA 3G3SA 2M5WA 3VWEA 5CVRA 1EH6A 2B4DB 1ZGAA 1ZLKA 3BJ7A 5IV0A 2Q4VA 4RB2C 4CHUA 4AWXB 2IA2A 2STWA 1M4GA 2V1UA 4P55A 1QZYA 5J8CA 4UWJA 4CO8A 3DEUA 2B0LA 1G3WA 4EJWA 1IRFA 3GFLA 4IPAA 4XPLA 2HEOA 2QYOA 1Z05A 1K78B 4MI4A 2A61A 4IRGA 4HQMA 2EFOA 4MJ8A 1JXSA 4JD6A 1C0WA 4M3SA 2DW4A 2GA2A 1W7PB 1L3LA 4ZBGA 3F8FA 2CFXA 3ZJ0A 2KJCA 3R61A 3BZ6A 1S5KA 3ZQ7A 1QZZA 1KA8A 1FP2A 1YS6A 5CJ9A 1XGNA 1S3JA 3J81K 4HF1A 3HHHA 2DPDA 3CTAA 1NHAA 1XGSA 2OA4A 1OMIA 1XGMA 1FSHA 1TW2A 5DD4A 2CNMA 4KOUA 3MZYA 1I12A 1FWZA 5H6QA 1KU3A 1S3ZA 2UXNA 2ZBKA 1MD0A 4QBJA 2VE9A 1W5TA 4XBFA 1BOAA 3PP9A 2EK5A 1K4JA 3K9UA 1SMYF 5CVJA 2HWVA 1WQ2A 4CRYB 4OIRF 4HV5A 4XPDB 1M44A 2EWNA 2EV5A 2V9VA 2EV0A 2XKOA 2OH1A 4WXHA 3CUOA 4KICA 2JTVA 4QWQA 1G3TA 3H4QA 3V8KA 3WE2A 2R8VA 3DPTA 1P92A 1HKSA 1D3YA 3TO6A 3T5XA 3WTZA 2X0LA 1MDMA 1K79A 1MJAA 3BOQA 1R23A 2FMLA 3F3XA 3R4KA 4Y13A 5IT9K 1VHSA 1UHMA 5LRRA 5TRDA 3LQQA 1SFUA 4JWPA 3BJAA 2HQRA 2LDUA 2ZFWA 4NQWA 3CO7C 4G7OF 4BHBA 2O28A 4ZH4F 3U9GA 1P4XA 4L9JA 1SAXA 4WXCA 3B8GA 4XLNF 2VOOA 1AOYA 4LLNA 1IN5A 2PMHA 2NRAC 4PK3A 1R1TA 2CNSA 2JPCA 5HS7A 4KT5C 4U9ZA 4MHDA 1LJ9A 1ZRFA 2M8EA 2P7VB 4AB7A 2Q8KA 3F22A 4HX8A 5K1YA 2RKHA 3T1BA 2F5IA 2AE6A 3H92A 3QB8A 2VZZA 1LEAA 5E96A 1XCVA 3F8BA 4MQVA 3VFZA 3CLOA 1LEBA 3I3GA 5DUIA 4ETSA 4HF0A 2CSOA 3KKWA 3WTVC 5L3DA 1U3EM 1QSMA 3TFYA 3HSFA 5D6EA 2BE5F 4M71A 2FSRA 1PP7U 3GVAA 3DV8A 3GX4X 4U7BA 3FX3A 2PEXA 4CGZA 5DUKA 4KN7X 1FX7A 4UBRA 4LG0A 4BQAA 3FBUA 1D8JA 4L89A 2A6HF 2P5KA 3ELKA 5HLHA 4II9A 3HIFA 2GZWA 3WTUC 1T38A 2P5LC 1HSJA 5KTAA 1RO5A 1O7LA 3HRSA 4K2EA 3V4GA 3IL2A 1J2XA 1D5VA 3HRTA 2FF4A 4ONUA 1G6NA 2EA4A 3OOPA 1HW1A 1TQPA 2LF7A 1K6OA 2VI7A 3LSTA 2GA1A 5A2QK 2XRNA 3H3ZA 1YVOA 1XDSA 1ZHFA 3T90A 4CZZA 1W4MA 2BEOA 2VONA 2VBZA 3FM3A 1U2WA 3I58A 2PFBA 2Y48A 3EO4A 2R7FA 4A6EA 2BUEA 3N7ZA 4FD6A 5BQTA 2QMLA 3KLOA 1XMTA 1Z4EA 2QQ9A 1LDKB 1A04A 1IRGA 4H89A 1FPQA 3E6DA 4A5MA 1LDJA 1R58A 3W6XA 1BO4A 3L09A 1TNSA 1GXQA 3WTSC 3GWZA 3CUQA 1YR0A 3FNCA 3FYNA 4EM0B 5I0CA 1O7FA 3T8TA 3SXYA 1M4IA 1SD6A 4PZJA 1UFHA 5KTCA 1M1DA 1MZBA 4IHTA 1F5TA 2CG4A 3I53A 1HXDA 1B9NA 3P9CA 5F64A 3DR6A 3FXTA 4FT8A 1AWCA 2MC3A 2ZO4A 4KIFA 4KORA 2ZW4A 2ARHA 2VQYA 2D1VA 5K5QA 4G7ZF 1I1DA 3K69A 3NE7A 4QLCU 2D4OA 2PSWA 2DAOA 1B6BA 3FRMA 3TQNA 3JSOA 3V8JA 4G7HF 3B02A 2OAZA 1BJAA 2ZW5A 1ZG1A 2W84A 1S60A 3ECHA 5DCMA 4KVOE 1E2XA 2F2EA 2F5DA 2P0WA 2P6SA 2PN6A 1U6GA 3M7GA 5FFZA 4HNYB 3WE3A 5H84A 3TOAA 1ULYA 2NMTA 1H9GA 2E7XA 4L9TA 3RPQA 2QQBA 2VC0A 1IN8A 1ZG5A 2MBFA 2DT5A 4MY0A 4NSQA 4ENMA 3CXQA 4I98B 5LGUA 1YTYA 4RAYA 3HOTA 5J6XA 3ZMDA 3GFIA 2ZMEB 1GHCA 1EH8A 1CJWA 3D3SA 5LBQA 3L9FA 5ICCA 4A2UA 5FLXK 1XIXA 5HDKA 1LB2A 1YLEA 2Z0ZA 1BI3A 1QSOA 2CNTA 1QBJA 5F6FA 1YFHA 5E18F 3F21A 3WR7A 2IW5A 1R1VA 2HS5A 2A69F 2K27A 2Z10A 2LF8A 5AIPA 2J8RA 1J0RA 2XVCA 4KYWA 3HUGA 4IRIA 5JPHA 1YW8A 4NF1A 4NEXA 1I1GA 4RB3C 4RGSA 1BIBA 3P9IA 4K30A 3FWEA 1FBUA 2JDCA 5LEJA 1R1UA 2HV2A 4IUSA 2FQ3A 3T0YA 5E17F 4KUMA 1REPC 1JE8A 2HGCA 2FE7A 4WWCA 2EFQA 1BBYA 2MD5A 1TIQA 2I79A 3PZJA 4OIOF 3DQVC 2A68F 1YO5C 1IF1A 2PG4A 4U5YA 2JEVA 3ZMZA 4XLPF 4JJXA 4MY3A 1PUAA 4CDGA 4YIFA 1B59A 4M9SA 4H6ZA 2Z11A 3R9FA 4E2AA 3VEPA 1LRZA 5J8FA 3GFJA 2HYFA 3V7SA 3J80K 1Z91A
chains in the Genus database with same CATH superfamily
3QPTA 1SGNI 2DK8A 5D4SA 1I21A 2WCYA 4F0XA 1V3FA 1Y1BA 4CUGA 5H6RA 1K4SA 5TISC 5ICEA 3IWGA 4JCVE 4IAVA 1ZR2A 4PXCA 3K7AJ 1FTZA 2ZXVA 3TKYA 5E3QA 4GM5A 1DU0A 3H0GJ 3SHFA 3CJRB 1GLNA 2M45A 3E3VA 3JCUC 4ZTJA 2ID6A 2UUZA 3FK7A 1HC8A 2F4MB 4ZZLA 5M3MJ 3GTLJ 1VNDA 2PC1A 3JVNA 4PPZA 1ETKA 4GXHA 1Q2DA 3RYPA 2YNDA 2IBDA 5CQGA 2RDPA 3COAC 3ISXA 4II2A 4Y3OA 1AKHA 3IWZA 1OYYA 3SGQI 4O3MA 2POKA 4OAYA 4YEJA 2NSMA 4EVYA 4C2XA 1KONA 5FLMJ 2FVGA 5K7HA 3ZQGA 4UIAA 1ZN2A 2E19A 4BS9A 4KZTA 2VB6A 2HZDA 2Y0MA 1LR8A 4BINA 5EDNA 5GP9A 4DYCA 2Q7BA 3O8GA 3P9KA 1A6QA 4IJAA 4IRHA 3J7ZI 4IQ4A 4IHXA 5HDGA 3HJEA 4MFQA 3CCYA 4A3BJ 2L4MA 1VQ9I 2QQDA 4NJRA 5CBMA 3CESA 1B4AA 1JHHA 1PJUA 4DZJA 1R43A 1BR1A 4XOPA 2CQXA 4JBAA 3D7DA 1TT5B 3M3YJ 3ULQB 2Z3OA 4JXRA 2FXAA 2IS2A 2QSGX 5EC4A 2DODA 1RR8C 2BYVE 3S1MJ 4CAFA 4CRZB 4XRSG 3I59A 4FE4A 5HOOA 4B14A 3SEKC 4XORA 2HU9A 3HTSB 2STTA 1UCRA 2LB7A 4OADA 3KPHA 4NBQA 2KPMA 3PL8A 1H9TA 1CF7A 2BOLA 1UAAA 1NE9A 3IUOA 5LGNA 4WCGA 3KCCA 4Q7AA 2EJRA 2VT2A 1OJLA 3JR9A 4KUBA 3S14J 4KN4X 1V0CA 3EC4A 4BY1J 1ZG7A 4KS9A 4GS4A 4DJLA 1LVAA 4HOBA 1CG2A 4F0YA 1OYWA 3B7IA 3ZCOA 2B58A 3BDDA 2R4GA 4S05A 2ARPF 2A07F 3UFFA 2DOEA 1NTCA 3D66A 5D4RA 1Y9WA 1OMUA 1FOWA 1DGRM 2E5RA 2L4AA 2OTLI 1YGHA 1Z8WA 1W3SA 4EGYA 1JHFA 3TDZC 2UV1A 1K83J 1X4SA 1MK4A 2KDZA 2R5ZB 4U9YA 3FBIB 3R1KA 1AN1I 4PQAA 2CUEA 3J7AO 2V7FA 2E73A 2JSCA 2LEOA 2GIVA 2JEWA 5LRGA 5AG4A 1BI2A 1GVDA 3F8MA 1FOKA 2AQFA 1W7PD 1J7KA 1SVLA 2ESNA 1DDNA 3R5AA 4HGUA 3A1YA 4LB6B 2L54A 4UUSB 2WC2A 2GKVA 2JUGA 3A2KA 3VOEA 1WHUA 2G7HA 2MABA 2Q2EA 3FEEA 3GLLA 4H2KA 4K3NA 4P4JA 4UA3A 1KUVA 2BY1A 2VJ5A 1IGBA 1SANA 1TQIA 2G0BA 2R5YA 3TGNA 2PJ7A 4Y4RA 2QVOA 3ZMSA 2VZYA 4UFWA 3RYOA 2CXAA 2WADA 1U5TC 5GAGJ 5LYDA 3WGIA 3RZAA 5J3LA 3WABA 3R5DA 3BQZA 4C9YA 4RB0A 5ED4A 2QECA 3OS0A 3MCZA 3CPXA 3FXTA 2XRLA 5IOZA 4L9VA 2FS5A 3TO9A 4A94A 1TIHA 5KK1A 4UXNA 4FCYA 2H8WA 1P7IA 1RESA 1Z7UA 4HX7A 2K40A 1DTDA 3FB3A 4HLXA 3GY9A 2X9DA 4DYRA 1SGQI 2R1IA 1O3QA 2AS5F 2HQAA 1NUBA 4R6TA 3MKZA 5H86A 4IEJA 2PMZA 1PUFA 2KZVA 2JPBA 5JR3A 1FYBA 1GVJA 1P2FA 3NH4A 1PP8F 4DBRA 1Y39A 4CYDA 2R7VA 5GPCA 2FD5A 2PRQA 2V79A 3H35A 3C26A 1W5SA 1FNNA 3ISZA 2ECCA 3OS2A 3DP7A 2BL1A 2OC6A 2EZIA 2ZMEC 2D4PA 1AHDP 4N0BA 3B3WA 3UR3C 2L7MP 2NVYJ 4UEEA 2YPRA 1HDLA 3RKYA 1IXCA 2QKLB 3HSEA 4OWRB 4FX4A 9WGAA 1V1HA 1N78A 3IHUA 4PSXA 2GFQA 2WV1A 3FX6A 1XMBA 5C88A 4FISA 5FD5A 4LITA 2YX7A 3RDIA 2Z33A 3CZXA 4WJBA 4EGZA 1JTXA 1FT9A 2P7CB 3B3TA 5DWNA 4M73A 2RGVA 4XRFA 4B3AA 5IYCJ 2LG4A 5EGOB 3H9QA 3OSGA 1FY7A 3CDLA 4C3JJ 4KOVA 1NH3A 1F4KA 5IT9Z 3V7CA 4NC6A 1SQHA 1EV7A 1FIPA 3BROA 3R60A 4EQQA 1PCAA 4Z2YA 4MNUA 1XMAA 2COBA 4EWTA 3BTJA 4A6DA 3A0BC 1SVOA 4X0GA 4IF5A 1BW5A 1R49A 3CC7I 3ZOBA 1SD5A 2HUZA 3PUFA 2B5GA 2KZGA 7CPAA 1KU9A 2KRFA 2QCOA 2ZNZA 4I76A 4BHCA 1O3TA 3V8IA 5D5UB 3FXOA 2G7UA 2VOPA 3DFGA 2FSWA 2H27A 2I5UA 2YQPA 5FVJA 3LNQA 1T8IA 3FZVA 3UKGA 2WBMA 2P5VA 3U1DA 1LE8A 1E0EA 1H8LA 1TW3A 4AC0A 3KE2A 3R95A 3SZPA 2ERWA 1KZFA 4I09A 3N4MA 3FBNB 5EEGA 4L18B 3GTGJ 4CZCA 4ONWA 1VIXA 2ZFUA 4IX7A 3GKRA 1HDUA 1YIOA 2JWTA 3IAM2 1R7JA 3L7WA 3W91A 3MRUA 1R5GA 3BC8A 2WAQN 1X3UA 2WB1N 4BBRJ 1M4DA 2NU3I 1S7NA 2A4NA 3IIBA 2DFHA 1YX0A 1X3WB 4OKOA 4BNCA 2HI3A 2W48A 3JTGA 1RUOA 3CJNA 1TBRR 2C1CA 3VDXA 3OWCA 3P2HA 4CAXA 2HYJA 4BUPA 1XB4A 3GB0A 4X5KA 5TJJA 2EK9A 4LK0F 4DYQA 2QBYB 3RI4A 4MFDA 2JDDA 1FP1D 5E1ZB 5J1RA 5EYRA 1HKTA 2K3FA 3RKXA 3E5XA 2CY2A 5JLWA 4CICA 4Q48A 1ULKA 1MBGA 2DMNA 2M30A 3GIUA 5EMIA 1X4OA 4CS0B 2JBJA 1Y0NA 4PV6A 2G0EA 3LWFA 5HLIA 1X58A 2ELIA 1XN7A 4N9HA 4HDUA 4FASD 3CXSA 2QQ8A 1VFCA 1LPQA 2LBFB 3R0JA 3JAMK 5M5WJ 2NVXJ 5F46A 2F5CA 3K1PA 2L8EA 2NU2I 4KOSA 4M6YA 3CMAI 1R3NA 2FQ4A 2FT0A 4QC6A 2NOJB 1JT0A 1XF8A 3OS1A 4NGPA 2O6GE 2Z2SB 2H1KA 3NQOA 1AUGA 1ITYA 4R8HA 2ELJA 1MMNA 2ZPAA 4FUUA 4M85A 4AG9A 1TL8A 2FX0A 3S93A 5ICFA 2PJ2A 4B5PA 5HVGA 3C2GA 5BOXA 4PGGA 1FC3A 3C7JA 4OU0A 4QVTA 4QIWN 4KMFA 1H8AC 1ZREA 2L9VA 4CXFA 4M9XA 4AIHA 4IVNA 1YW7A 3BG9A 4A3JJ 4MHZA 1OYIA 3S3NA 2VEZA 3BR5A 3KP3A 3R6SA 2B9SA 1N77A 3D7FA 4CCKA 3QTLD 1OFCX 5F04A 1VQ5I 5ILUA 3BPXA 2UWMA 4TV7A 2JT1A 1TF9A 1U6MA 1K6YA 2AFSA 3Q5FA 4OC0A 5F49A 1J59A 3KZWA 4JLYA 4UF4A 2DKVA 4F8ZA 4NC7A 3KP5A 4E0AA 2Y9ZA 1Z6RA 2BUSA 2VJJA 2EINH 2H5MA 4HPSA 3QP5A 2E1MB 1N75A 1X74A 4M9ZA 3NEUA 1VQMI 4FD7A 4I01A 2BY0A 3KETA 1ZG8A 2E35A 2F5FA 3ESWB 2OZUA 2LY2A 3BT9A 2P6FA 5FJ8J 2IQ6A 1WI3A 4A3GJ 4WK8F 5DDGA 1XJOA 2GLFA 2BCOA 1BAVA 1BLLE 4QUSA 3PO3J 2HPIA 3SFZA 2KRHA 5J4YA 1R22A 4GXOA 1B9MA 2D5VA 4AVPA 4NC8A 3D4UA 4KOWA 2BVMA 3P7NA 3SJGA 2HVQA 2W57A 2KJBA 4NB5A 5FO5A 2ZXIA 1OR7C 3DDDA 2CTBA 1OCCH 1AMPA 1R36A 5FUYA 1CBXA 4B48A 2FBHA 4I2OA 4W97A 1GYTA 3BLNA 1YMEA 1QVUA 4TNUA 1WJBA 3KP7A 3UOEA 3RJPA 2G9WA 1UFMA 5FGMA 1KQ9A 1ZLHA 3ZMUA 2HKXA 1YRNB 1KBFA 4QSHA 2E2JJ 2JMWA 1Z3XA 3L00A 4JK1X 4CAVA 1U5TA 4EMSA 1DUXC 1YIJI 3B73A 4CPAA 5E8GA 1SGEI 1S7LA 2XAHA 5M5XJ 2KISA 2HZTA 3DCFA 1Y7RA 2WVJA 7WGAA 1RNLA 5KVRA 2KIQA 2Q0OA 4KISA 2ZSIB 3WTYC 4HF2A 4BJ5C 1IW4A 2TDXA 2L0KA 1QZEA 3K4CA 4A0XA 1U0JA 4CCOA 1NG6A 3K70C 5CKTA 2R7QA 5HMNA 3FSXA 3IRRA 2WSAA 6PAXA 3S6GA 2H6BA 2K02A 5BPIA 2Y0SA 5AG7A 3RZDJ 1DPRA 2AXTC 3O6BB 2HTSA 5D5XB 4M6XA 3OV8A 3NA6A 5HLTA 4FKDA 2J5PA 4U0YA 4OIQF 4BMHA 4ZX8A 4I7HA 2OVOA 3JTHA 4Q5SF 5LHIA 3SJFA 2O3FA 3G73A 1DPUA 2WGCA 1YOVB 2CU7A 2EH3A 1SFOJ 3OYIA 1QA6A 2M0MA 2WA0A 3MZHA 1XD7A 3QNVA 3LL7A 4FTHA 5KTDA 3F6VA 4I02A 4L5JA 2IGOA 1LQ1A 2HPMA 3PFEA 4P9FA 4CCJA 4M6HA 5G21A 2ZC2A 1Q1VA 5AONA 5G20A 1HEVA 2FXFA 3NFZA 3K10A 1XDUA 5CPRB 2RFHA 2XF6A 2DFFA 3I4PA 3KYCB 2OD5A 2HQNA 2OQRA 4JYKA 2WYRA 3LWUA 1IRXA 2E1OA 4M72A 3ONQA 1BA5A 3LODA 1YQAA 3BJOA 4KVME 4YG2F 3PB4X 1I50J 2CO5A 3MVPA 2B0UC 1VQKI 4AVCA 5HVQC 1Q2CA 2ZEMA 2RQQA 1Z0XA 5HI7A 4KIGA 3F0AA 4UXIA 2NYXA 1ULNA 4HKFA 3O8HA 3DWLE 2WV0A 2NXNB 1KU7A 2F48A 5KAFC 2K9HA 1JQGA 3PB9X 1R4MB 3CMMA 2RQPA 4AIJA 3KLNA 2Q1ZB 4FETA 5K7FA 3Q0UA 2ABZA 4WP4A 3HTUA 4XLCA 5CVIA 5IP9J 1Y6IA 4RAFA 1VQPI 1IB1E 2RV8A 1ON0A 2FBKA 4PJJA 1MDMB 4KVXA 4UIBA 3OMYA 3ABLH 5HDNA 1AYEA 4GFBA 2DCEA 3K0LA 3JRIA 2IL4A 3GYHX 2PJ0A 3F5BA 3EUHA 3CMYA 2FL4A 4MBUA 2GLJA 2FA5A 4E8OA 2OD1A 4XSZF 5LRSA 3LA2A 2COMA 3WC7A 2B3UA 2DF5A 4GRIA 4KIBA 2O0YA 3RPUA 4B3XA 3JSPA 4R57A 3IWWA 1HKQA 2BHZA 3S17J 3I9V2 4XLEA 5EZGA 4P9UA 5K7ZA 2Q04A 4NQWB 5M5YJ 4PXBA 1ZGJA 4C3IJ 2PIYA 3IU2A 3FMCA 3HKZA 2QUFA 3BR1A 2O03A 5HH1A 2CV2A 3VSKA 1XX6A 2L9SA 3QWLA 3FXKA 4QPQA 2DJIA 3I4NJ 4OC3A 5C4XJ 4YWYA 2PDOA 5CYVA 3MKLA 4ZYAA 1TBNA 5AG6A 1U9NA 2AXLA 2GOMA 2KLOA 3D0SA 1BN5A 4HLYA 2KRCA 3BZCA 3SHPA 1G2HA 3BR6A 4OVOA 1FOYA 1VTNC 3BI0A 4AD9A 1UVFA 1WSUA 2EILH 1OCTC 3GUXA 2WPWA 2KMUA 2XRCA 4U7DA 2WY8Q 4A0YA 3LQRA 4KMUX 2HTJA 4XL9A 1DQUA 4NXYA 4CCMA 5B1BH 1ON2A 4XLFA 1G4DA 4XPDC 3M8FA 4MFEA 2VQLA 1K7VA 2H94A 4D1QA 3PIPF 1IW7F 2HDWA 2L7ZA 3TOBA 1Z9CA 1QSNA 3FXRA 4A3FJ 4R3KA 5F48A 3WGHA 2GE3A 4A93J 5DV5A 4BU2A 4A3KJ 1GHEA 2G3TA 1HLVA 4A69C 2E5NA 1S7AA 4AVAA 3CJQB 2MFZA 2A3SA 3G1LA 1LDDA 1QVTA 3DTIA 3QOPA 5CQEA 3T8RA 1F1ZA 2HOSA 1OZPA 2OV7A 2ZCWA 4B5OA 2OPTA 2BVLA 4BY7J 3ZRGA 2UZKA 1B8IB 2J8MA 4PK2A 5CNPA 3BP8A 2JN6A 5C3EJ 2E60A 4GYGA 1WWXA 3F8NA 2XAJA 4MPIA 4HAMA 2QIRA 1FSEA 4O6JA 3ABUA 1VQLI 3H3UA 1ZRCA 2MYSA 1HA8A 3SEZA 2A6EF 2EK8A 4XR6A 3PQJA 3HPHA 4XSXF 4LG3A 2X51A 5FKLA 5HS9A 2V4JC 3SXNA 1P4AA 1YJ9I 2X6OA 1IAWA 1K7UA 1KYWA 4A33A 2K9QA 3NH8A 4LFUA 3KEOA 3S32A 2ISYA 3CCRI 4JQFA 1J5YA 3D5LA 4HX4A 2CW8A 2XUBA 1Z1DA 3TBIA 4UNOA 3CDHA 1BPMA 2DQLA 4ZYQA 2VPRA 3FXJA 4UY8I 3I64A 1HDPA 4E4HA 4HSTA 4C2TA 4RAZA 3FMRA 2L7FP 3E5UA 3V38A 1WI9A 2UXXA 2Q4YA 2EV6A 1XGOA 4LMYA 5CVVA 2WUUA 3ERED 3CC4I 3FHNA 4LG0B 2ATRA 3B3SA 1ZKGA 3N97A 2LC2A 5L3FA 1ARLA 4B6ZA 1KYZA 3WTXC 1MGTA 3BCAA 5DAEA 4P4EA 3HOUJ 3PIOF 2KFDA 1G3SA 1R5HA 1YW6A 4DYOA 2EBJA 1LCPA 4M6IA 1W5CC 4ESJA 2PX9A 2PR8A 2R3SA 1FYKA 1S20A 1VQ8I 3MFKA 2QEXI 4Q47A 2Y75A 2E1NA 2M87A 3H5RA 3R96A 3NWSA 2C6PA 4ZDOA 2DXQA 2KIFA 2GANA 1BIAA 1BR2A 5J4VA 5LLQA 3OYDA 2X3TA 4MHGA 2B4DA 2R98A 3ZP5A 2P4WA 2ENNA 3H8EA 3GFMA 2V26A 4GDFA 1KU2A 4LIVA 2LK2A 4D9JA 2QQEA 2M7AA 2ELHA 3F72A 2K5TA 1RI7A 2MW8A 4GGGA 2E1MC 4L0ZB 5EZHA 4CGLA 3VDUA 3I54A 4RUHA 2OJED 2WWYA 2E2IJ 2VQCA 1CM0A 2DLLA 2DYRH 3SJEA 1I3AA 1VQNI 4RGUA 1IN4A 1N13A 4XNFA 3E0KA 4A95A 3D5SC 1VGYA 3ZMVA 4CYNA 3C2HA 3QAHA 1EH7A 3FHZA 2V6EA 2VE8A 3GF2A 1B1BA 4ON0A 2MG4A 4J01A 2ICWG 2WPXA 4PCQA 4NNJA 1HDQA 4MRIA 1LOKA 3SQNA 1YVKA 2ORVA 3K2KA 2HB6A 2V1NA 3L1PA 2MC4A 2JA2A 3VODA 1RZ4A 4KT6A 3ML6A 1SC7A 3PO2J 3DXJF 3KFWX 3KP6A 3SFIA 2F4IA 2CW0F 2LRDA 1K78A 2LKSA 3K1MA 4UV8A 4E7KA 1E3OC 4IHWA 5L3CA 5BPDA 4RI1A 3KYDB 5KHDA 1SFEA 2JJ7A 2WY7Q 3F6OA 2LD5A 1W7PA 2PMUA 5ELYA 3S6FA 3D68A 5B66C 3CUQB 3R0AA 2DIPA 2KCWA 2AO9A 3CZ6A 4LGWA 4UUVA 1SGDI 4KOXA 1TQMA 1KBEA 2YNCA 2IVMA 4DQ2A 2JVGA 3RSNA 4IF4A 3MEKA 1R57A 5ILSA 3W6SA 2AQEA 1SEUA 3W2VA 4AIDA 4E7JA 3KYLA 1UUCA 2IS1A 2VI6A 2SGQI 4ZI6A 2BY2A 2VJIA 5E79C 4EVIA 1MNMC 2K85A 2EBIA 2JRMA 2JXDA 1OCRH 3CLQA 2RAEA 4ENNA 1W0TA 3UGDA 2JBKA 5DYMA 2VUMJ 2QPOA 3VATA 2AFZA 2ETHA 4MQ9F 3C2BA 4R1HA 1KUXA 4UEZA 2A6TA 3V8LA 1S7FA 3UY5A 1YS7A 4RS8A 4AIKA 2KHMA 3VB2A 2Y9YA 2V8DA 2HYGD 2J8NA 3ISPA 3LA3A 1TURA 3BJIA 2ISZA 1IUYA 4IXAA 4A0ZA 1W0UA 3GZ5A 3D7HA 1OVOA 1S9HA 5ISVA 5AGEA 1BJZA 2K9NA 2P8TA 3H9GA 1WRJA 3S1RJ 2RC4A 2V53A 2BO9A 3HEFA 2XGCA 4FX0A 2YS9A 4P96A 1IZ1A 3F8CA 4HV6A 3M8EA 1Z4RA 2GKRI 1ZARA 2BY3A 3FXUA 3K4MA 2E7WA 2V9KA 1WK4A 5AIQA 3REOA 4HQEA 3GYAA 3HHGA 3H8FA 5L3EA 2Z3KA 1MBJA 2I10A 3PFIA 5DCMB 1HSTA 1FTTA 2CWFA 1UB9A 2VT3A 2YUUA 5ERIA 2CUJA 2F5VA 4ESBA 1RIOH 2DTZA 4GYIA 3PJRA 5FUXA 4Y15A 2BW3A 4UHTA 4MEXF 3UEYA 2PE3A 1CPSA 1XS9A 2MLGA 1IIDA 2DPTA 3OL4A 1Y8FA 1TLHB 4W1UA 3TT2A 1K7AA 4YFNF 5D29A 4BKXA 4X3RA 2DOAA 2JK3A 2HQ5A 3G6EI 2L9RA 3H3VK 4F9VA 3CO6C 2IS6A 1UZCA 1IXRC 2F5EA 2DK5A 3CDIA 4RGRA 4Q4ZF 2VRWB 3FXQA 3K70D 1V4RA 3HRMA 5G1ZA 1JKOC 3BPVA 5F1RA 4YIIA 3IWEA 5E8IA 1IOFA 1MKMA 4G6QA 2VXZA 1D0ZA 1S5LC 1YYVA 2CH0A 3QRFF 1PVEA 2HQYA 1Z6TA 3CPAA 1YJWI 3C18A 1T0FA 2K4BA 4GO1A 1USSA 2C27A 2DMPA 2VBYA 1I6HJ 4U88A 1IYKA 3EQLF 3L2QA 4MCRA 2LP0A 4OOIA 2VBWA 2OB0A 3HPGA 3GTJJ 1QGPA 2Z5UA 4UV9A 2E2HJ 1HF0A 4BBHA 1P9ZA 2K5CA 1IV8A 3IH3A 2CQNA 3VYUB 2EVNA 2VBXA 4LD5A 4G8XA 2QWWA 4CYPA 3SXOA 3J81Z 2XSJC 1XSXA 1CX8A 2MH2A 4PJLA 4Y17A 2XAUA 3L2UA 2KCXA 4IHMA 2TCTA 1T2KA 3IGRA 1IDYA 4FD4A 3GLJA 1SVMA 4OMYA 3NRVA 4MGRA 2NNYA 1FARA 1CPXA 1YREA 3SYTA 3S3OA 3L2NA 5ICGA 3TW6A 5EG0B 2PI0A 3HUGB 1YX5A 1Z8XA 1SFXA 4XQFA 3E97A 3D8PA 2PLYA 2QQAA 1TBQR 4NGMA 2L9NA 3FMQA 2W82A 2BHYA 3MZ8A 2Q4ZA 2EZHA 1D0YA 2EFPA 2FRHA 2V6CA 4Y7NJ 1OPCA 1O57A 1ELMP 2G3AA 2NVTJ 4XONA 3K2ZA 3RAMA 5BMZA 4RA2A 4MTEA 3MWMA 5D5VB 3BJ8A 5B5EC 3QQAA 5EBVA 3GZNB 1XSDA 2R7DA 3CCEI 3LAPA 1WJEA 2V1CC 1WJFA 2DA6A 1WWZA 1TZLA 1HOMA 2VKDA 4B43A 5FFXA 4PFOA 2REFA 2NU1I 1I1SA 3G3SA 2BGCA 2PRBA 2WTEA 5DTDA 2ADUA 2HR3A 2XPWA 5ILVA 5J47A 3DF8A 3H0DA 4Y33A 5IT3A 2ANPA 3J7YJ 1OCPA 2LSOA 3IKTA 5FROA 1M8BA 5LYLA 5BNGA 3CCSI 2FIAA 1ZO0A 2NU0I 2IXSA 3RQ4A 3Q9SA 2EZLA 1FYLA 2SGFI 3A02A 2VC1A 3IKVA 2ZEOA 2FOKA 2A5WA 2H8RA 1FT7A 1EKEA 4E7LA 3QWPA 3WU0A 3WU1B 1ZAOA 2BZTA 1FEXA 2LMDA 3B3VA 3JW4A 3KHXA 1NSLA 4KA4A 3FC3A 4AVZA 2XB5A 1WTJA 4CH7A 1XSVA 2DDAA 2VODA 1J9IA 3K1NA 3KZZA 1YQEA 2PBIA 1PU9A 1R79A 4WX9A 1H0MA 1TWAJ 4KDPA 1WGTA 2ME6A 3W6JB 4F3QA 4P4DA 2PCUA 3GTPJ 2ZKZA 4P1WA 5GTHC 2FU4A 1S29A 2YU3A 5FRMA 2ID3A 1S8NA 2XIGA 3JRGA 1IG7A 2KT0A 3GTOJ 5JHFA 4ZDPA 4X8IA 1IN6A 3KP2A 1NG7A 3LSGA 2Z99A 1BW6A 1IU8A 2I00A 5E1XA 4XLHA 4CCNA 1TOTA 4X1EA 5D5WB 3JAMZ 4ESFA 1J75A 1TTYA 2I8DA 2JDCA 4NCZA 2IJLA 3TMOA 3RTRA 1ELLP 3FJUA 3QYEA 1O4XA 2KDOA 2OUMA 4OC2A 1L0CA 2NVUB 5LEKA 2IRFG 4H6UA 5A28A 1MBKA 4S04A 1DS3I 2BSWA 2CF4A 1HEEA 4I99C 4ZZDA 1G3YA 4BQNA 1AKHB 3E6MA 2VXDA 5E3LA 2DEAA 5IP7J 2W00A 3GMEA 3L2VA 1LR9A 4P4BA 3S6KA 4XOTA 4LUAA 2WAQA 3G4SI 1U8BA 3BWGA 2PJRA 4P45A 2WB1A 1SD7A 1TNTA 1WH5A 3GXOA 1UVGA 1Y9KA 2DT7B 1IN7A 1STZA 2E71A 5K5OA 2P81A 4ENJA 1TKHA 3IWFA 3CJTB 5GCNA 1YW4A 4CYOA 1L0OC 2PQ8A 3IP4B 3TO7A 2NS7A 4CSWA 1S7OA 1QQIA 3Q0VA 1FYMA 4OAEA 1QNTA 2FIWA 2BBYA 4DNCA 2OZHA 2YNEA 1B87A 4W9YA 4LB5A 3WG7H 4UFVA 4HZFA 4ZYHA 3MN8A 4CYCA 2PJ4A 3EYYA 3K9TA 3DBHB 3I5UA 1J4JA 1H0ZA 2NVQJ 4LQGA 5DWMA 3I59B 5DM6F 2R7HA 2NOGA 2FCKA 1CSOI 2MA3A 4BXUA 4M3GA 4C3HJ 1MT1A 1T39A 4GI3C 1D5YA 2IP2A 3CUQC 2XKPA 2NS0A 2LY9A 2ACJA 1CF7B 1F43A 3PBBA 2FNAA 5E3NA 4HRIA 2QKMB 3IH4A 1MH4A 4II3A 1EE3P 2YX4A 3WODF 1V5EA 5FB2A 3HOZJ 4N4OB 4RLFA 1P6RA 3LSJA 2XHKA 4XM3A 1ETOA 4ZYGA 1K4TA 4HDVA 1XBUA 4A31A 3BZKA 2LREA 2XROA 4XKCA 4JX5A 1NXUA 1D0XA 5E20A 4YFKF 2Y2ZA 4KOTA 2EFNA 1XOVA 4KSFA 3A0HC 5L3BA 3K4NA 3C3WA 3E7LA 1GXPA 4BJTA 1XA6A 2AFUA 3RO0A 5F1JA 4YFJA 3HSRA 2V8HA 2K9SA 4R76A 2V1XA 1DP7P 1Y8RB 2Q0YA 4HNVA 2GBYA 3D2MA 3GTKJ 3RIRA 2XASA 5D6FA 2E1CA 4KFCA 4R9MA 3O3KA 2A5YB 2L02A 1I5ZA 3BTLA 5HNFA 1GV5A 5LHGA 5HQ8A 4NGQA 3FKJA 1YJNI 2Q2EB 5FKOA 4OMZA 2FBIA 4BEHA 5GTIC 1ZH5A 4OIDA 2K86A 4UCNA 3ABTA 3DLLF 1YHQI 4G9YA 1OYVI 1X1CA 2IA1A 4DGWB 2R5YB 3K4KA 3M1EA 2GWRA 4ENKA 3G8WA 2HKOA 2R7ZJ 3K4LA 1EF4A 3DEEA 4BQQA 1UHAA 2VASA 5E3MA 3OIOA 3BR3A 2R7SA 1UG2A 2X4HA 3L2CA 4AVBA 3TCVA 5L3GA 4P4FA 4F6AA 4I0AA 2FEZA 4SGBI 1F2OA 4HNWB 4Y49B 3FISA 4D5CA 4O5VA 2R7WA 2F3CI 1FIAA 4WXDA 1PDNC 4ZYDA 1Y1CA 3TDUC 2DJNA 2AFMA 1FNOA 1SFKA 4NFRA 2LR8A 1QSTA 3NAUA 3QPHA 4L8AA 4ZJZA 4MEYF 1IXSB 2DO7A 3S2WA 3DNSA 4ZDLA 5IB9A 4D7NA 2IT0A 1PUFB 1MJ9A 5A2QZ 3HGGA 3AG1H 4YELA 1W1WE 2XGDA 2DTRA 2PJPA 4QTRA 2DFEA 1Y8QB 4OIWA 4L0YB 2DN0A 4NDLA 2C6GA 4I0BA 2ZEFA 4M3BA 1ETWA 4JX6A 3LAJA 1I6XA 3AL0B 3HXLA 1UWYA 3PFYA 1XRYA 2ODFA 2Q44A 3RZOJ 4BXXJ 3IC7A 2E36A 2K9LA 2ZELA 3FK6A 3DR8A 4NGNA 3EPZA 2MSYA 1ZYRF 3SDBA 1WKMA 2VL8A 2Z9OA 2WAFA 3ECOA 4G6DA 2PJ3A 4KOYA 1Q1HA 3PGPA 4PDKA 5IB0A 4B13A 1Z3YA 5DD8A 5IYBJ 4UB6C 1ETQA 1B6AA 4ZY2A 2FJ1A 2R7TA 1RPWA 3PQKA 2OCEA 3FKIJ 1KWMA 3P2FA 2JA8J 2BV6A 3ZN0A 1XPXA 3E1SA 1USTA 2LYCA 5FKKA 3I4MJ 1W36C 4UCPA 5GAHJ 3KR5A 2LNBA 3VYTB 1TBOA 1RFHA 2B5GB 5CLSA 4C7IA 2DQRA 3S8PA 2XF5A 4FWUA 1HBXG 1ON1A 3A9LA 2EA2A 2NNNA 2ZMEA 1Z77A 3S6HA 2E34A 1LR7A 3KZYA 3GTQJ 2XAQA 5FKMA 3BHXA 3CXPA 3U21A 3E6BA 1Y1WJ 2O8KA 4V19K 3B35A 4KJZA 1KZHA 5JQ4A 4E70A 1LE8B 3FF3A 3ROUA 4WF2A 1Y0UA 4XICA 3RYRA 3WC6A 4AG7A 3ASNH 3WTWC 4BH9A 3MKYB 5FUVA 1TUSA 2IJZA 2XDVA 5BS6A 1B72A 2M9HA 3PFOA 3IRQA 4A3IJ 2QZ8A 2OZ6A 3ZPLA 1KQ0A 2UZ3A 1BM9A 2H1LA 3JUWA 2ZSHB 4PFPA 3E5QA 4DBQA 5E3OA 1YTPA 2FNFX 1QPMA 2CUZA 1JGSA 4HYEA 2GQQA 1YLFA 1ORKA 3EFAA 2P6EA 2Z3YA 4BAYA 2X7BA 1GV2A 3A01A 3HM5A 1XG1A 3VPRA 1OLTA 5C4JJ 5CCMA 2HDCA 3KX2A 1P4WA 1I27A 1TBXA 1BOBA 3RQIA 2O61A 3QPLA 1ARMA 2J5OA 3HLPA 2DI3A 4A37A 2ZJRF 4IK2A 2Q7SA 4B10A 2DYSH 5LHHA 3HOWJ 4J3GA 1S6LA 1T95A 1JUSA 3VDPA 1OKRA 1Y0RA 5M3FJ 5HS8A 1ZRDA 1KQ8A 3PM1A 2P6GA 4JXQA 1OQYA 1POGA 4C30A 3HRUA 3PNTA 2VKHA 4UXJA 3OXLA 1PTRA 4LK1F 4F91B 3OYAA 3GEZA 1QMUA 2ZW6A 2DPSA 4LLGF 3ZN1A 4XNHB 2CRGA 2W1OA 5J1QA 5C44J 4OINF 2NU4I 4O23A 2O5RA 2H6CA 4A12A 1RUNA 1VQ7I 2N8GA 4ORFA 3B3CA 2EZKA 2JZYA 3E2IA 1F2PA 3JRFA 4DJAA 5LD2C 2VXKA 2XGXA 1MJBA 1YK3A 5FD6A 3J80K 1Z9UA 1N25A 2ZEGA 3A03A 1QPIA 2KL4A 3KZIC 1WKXA 4A30A 3WC5A 4B5PB 2RNJA 1PPFI 5LYIA 2PR1A 1RTQA 1ETYA 4UVAA 3V42A 4EJTA 2RNGA 4HA8A 1U8RA 1RXTA 1JUMA 3HOSA 4EJOA 1E3HA 4FE7A 4KLWA 4R79A 2M5XA 4LJZF 3VWBA 3HL2A 2GAUA 1S7KA 3CCMI 2W85A 2OR4A 4ZX9A 3D2PA 3EETA 1R6RA 3ZQFA 2P6TA 4HEA2 2CQKA 5JHWC 1FLIA 4GCVA 1Y7EA 4MLOA 2W25A 3W2WA 2W4SA 2X6YA 2CGPA 5FLXZ 1T98A 3M07A 2LFBA 3F23A 1F9NA 3VYSB 2KIUA 3KGQA 3L2RA 1XEBA 4HG2A 4N9IA 1CT2I 4XIDA 2ZJ2A 4OMEA 3PSFA 4UVCA 1WGCA 3O2PE 3F9KA 2Q43A 2H09A 2XC7A 2FNPA 3PUBA 1YW9A 2ENZA 2L7KA 2ZNYA 2QF7A 3H1CA 1U78A 3MQ0A 3GOXA 2L01A 1CGPA 1Q7LA 4R3LA 3SI1A 1ZLIA 3OXFA 3SZGA 5C82A 2RVCA 4RS2A 2QENA 2L3DA 1VKCA 2JRTA 1SMTA 2D2WA 2VIXA 3PNVA 1PUEE 2LH9A 3KP4A 4C68A 2XAFA 3FM5A 4IOAF 1IICA 1RKTA 3DU6A 5GAEJ 2B3VA 5JLXA 4MFZA 4OC1A 5F08A 1LKXA 2LKPA 4RB1A 3TP3A 1Z8TA 4B12A 3OSFA 3ASOH 2N17A 1R5ID 5CVUA 2L7XA 4L5IA 1H89C 1KUYA 5E1WA 2QQ0A 2O8XA 1VZ0A 3M9AA 5K5RA 3EXNA 4EJVA 4KLVA 3QU6A 4YRHA 4HNTA 2F4OB 3DSBA 4CCLA 1Y1VJ 1U5TB 2X6XA 3GUDA 2ELKA 1X2MA 2QA4I 1CP6A 2ZW7A 4D5FA 3RCOA 4HNXB 4RM2A 5KNLA 1D8KA 2O4HA 5IX3A 2IPQX 1AU7A 3BJ6A 1WCMJ 1E17A 2JA1A 2F8HA 2XV4S 2JSPA 4J19A 2VBQA 4G1PA 2M0CA 1UHWA 2OF7A 4ZY0A 1P9GA 1AA7A 4PXEA 3FF5A 1HW2A 4UWIA 2EQRA 4AM3A 3TL4X 1P4NA 4MFLA 3D5RC 3OYKA 3TC8A 2HFHA 1JUPA 3I9SA 1HCRA 3QU3A 3A4CA 1ERDA 5HLGA 1LNWA 2QM3A 4RGXA 4LX9A 3RKWA 3W6KB 2M1BA 3AG3H 1BC7C 3M4OJ 2V8VA 4JYWA 1OR7A 2YU9J 4IHSA 4OC4A 3TTHA 2IEKA 4QPOA 1MBFA 3LSRA 3VWDA 3U2RA 4CGOA 3KL9A 1D1CA 5K8OA 2DBBA 4NHJA 2XEGA 1LFUP 3R5CA 2OBPA 3G3ZA 3HGYA 1HW5A 1S72I 1ZG3A 3S2DJ 2CUFA 4B47A 5FKNA 4ASNA 1MMSA 5J40A 4G94A 1KGSA 1X1AA 4EJUA 4YGOA 2HOEA 2IA0A 1Q2YA 3G2BA 4EM2A 4I49A 3CCJI 2VL1A 2DA1A 3KEQA 4M3FA 3MAJA 3QODA 3J80Z 4R7MA 5JI6A 1R9TJ 2VN2A 2LOOA 3KY9A 2R5ZA 4Y49C 5JHUA 5J1YA 2D1HA 3GZ6A 2B4BA 2X52A 5LRJA 2K4JA 3CT9A 2GVIA 3MN2A 2V1DA 1ZR4A 1GT0C 4M3DA 3C1DA 1CGJI 1DS2I 1R0RI 2DPUA 4E1RA 1QO0D 1O3SA 1Q9BA 2AFXA 2LKXA 2O9LA 2VPLA 3KR4A 4MCQA 2OOTA 3ZQIA 2TRTA 3LA7A 3OYMA 3MD2A 2ORWA 3GO5A 2LUYA 4UUSA 4XKBA 2O7OA 1P0HA 4L9NA 3SZTA 3E0JB 2Z3PA 3LFUA 1Z7LA 2KKOA 3CCLI 2M3AA 4MHYA 4G6TB 3OYNA 4F9UA 3DPLC 3AL0C 3EUKL 1ODDA 1N71A 3OR2C 5B3SH 2OZGA 5JFRA 4KUAA 4UCMA 4YFXF 3S2HJ 4PSWA 4ZYEA 2CIJA 3HYIA 3K2AA 4ANJA 3S9LA 1P9QC 3FIXA 3HH2C 4CGNA 1HQCA 1LFPA 3E6CC 1VF9A 2DMTA 3SJXA 4U0VA 2YR2A 5D8KB 2EO8A 4A2ZA 5DEQA 5I4MA 3WTTC 1SGYI 2VJ4A 1WFXA 2IGKA 5JVGF 3EYIA 4B09A 1V54H 1OCOH 1XCBA 2HVRA 2EFWA 2ZXJA 2EIJH 4BYYA 1JKRC 2XB0X 2MLKA 3ZQLA 4AYBN 1TKFA 2W24A 2GLOA 2DFIA 3CP2A 1TT0A 3V7RA 1CP7A 4OLLA 4P5OA 2IGMA 4UVBA 2GXGA 1T6SA 1FBQA 2M8GX 3QP6A 4HW0A 5F27A 3OYLA 1FZPB 3R9GA 3MGDA 2RN7A 1WJDA 1NK3P 1IYLA 1A31A 2CJJA 2PJBA 5IYDJ 3R9EA 3RBUA 4PK4A 1FJLA 2CW7A 3GW2A 3F8KA 1BI0A 1ZLJA 2D45A 4P6YA 2K7LA 1FBSA 2OU2A 1R00A 1MSFC 1NMTA 3U1KA 4DOZA 3B4VC 2HC9A 4U0WA 4M74A 4XKVA 5D8LB 3OYFA 3FH4A 3TE4A 2C6YA 2N1AB 2GM4A 1YX3A 2DU9A 4QB9A 1UELB 1XMKA 2MH9A 4JX4A 1VHEA 3LFKA 3KI9A 4WWVA 1G8XA 1TKJA 3AKZA 2ECBA 2AJ6A 1DE4C 3IH2A 3WG9A 2FMYA 2KIMA 4M6VA 2JLMA 1RC9A 5EGOA 2BEIA 1JJ8C 2CJSC 5EX3A 3I0TA 1GUUA 2HDDA 3LD2A 4FHTA 4A5NA 4OIPF 3I56I 3FDYA 2GXBA 2LVSA 3QOEA 2CWEA 4A3CJ 3MKWB 1DP3A 4NJQA 4BE2A 5LYFA 3ZMTA 1ONVA 4XPKA 5K8MA 1X3ZB 1O3RA 5LGTA 5CCLA 2R7XA 1LANA 2ZOGA 1MMDA 4PGHA 2R93J 3R5BA 1BC8C 1DGWY 3WHBA 2EB7A 5EEAA 4HBLA 3OR1C 2Z3LA 4RLQA 3BY6A 2NAZA 2REEA 4F55A 3IO1A 4H0EA 4B1RA 4BHPA 1T56A 4LLLA 2EUIA 4TWEA 3D00A 1X10A 3LSIA 2YGWA 5K8NA 5F47A 1XE4A 2QLZA 2CYYA 4S0HB 4BE0A 2ESHA 4A3MJ 3LSPA 1MMGA 1VQ4I 3D1NI 1LAPA 2CV0A 2W0TA 4FD5A 1QRYA 3GLXA 4XNHC 2PVVA 2W7NA 4E6KG 4EM1A 2CV1A 1MH3A 1SD4A 3I71A 3Q9VA 1JWQA 3T9YA 3AAFA 3HBLA 3TEDA 4MIMA 5E3RA 3MEXA 3DPUA 4KNYA 1ETVA 1QSRA 5LFAA 4MTDA 1LFBA 3PSIA 4P4IA 4BD9A 4R87A 2YSRA 1W36D 2UVOA 4MXUA 1J09A 2EIKH 2ZEPA 4AUXA 2QBYA 5EEHA 5J1UA 3IV5A 5DCFA 2L2OA 4NGTA 2JZMA 2FOWA 3WGGA 3ZZIA 4D0PA 2MGQA 1R71A 3H9JA 3DKWA 3EY5A 5H20A 3BG6A 3LOCA 1M4LA 1GDTA 3EDPA 2FE3A 5JVTA 3LACA 2X1CA 1A5JA 4C2ZA 1A35A 1YG2A 4CAWA 4B8XA 3FMSA 1X1DA 3BG7A 1MIJA 1QHHD 3AG4H 4EV0A 2RB7A 2Y69H 2OQGA 4E7HA 4E7ZA 1NK2P 2XAGA 1BI1A 4F7ZA 3CF5F 2JW6A 2M5WA 3BLYA 2A05A 1TF8A 5CVRA 3VWEA 2LBFA 1EH6A 4P10A 3DKYA 2B4DB 1ZGAA 1CQTA 1ZLKA 2PJ5A 4EATA 3BJ7A 2PJ8A 3I1UA 5IV0A 5IY5H 4YU9A 2Q4VA 4RB2C 4CHUA 5KCMA 4AWXB 3FXMA 2HXIA 2DA3A 4DW6A 1WVRA 2IA2A 4BGDA 4BE1A 5DS9A 1Z67A 2STWA 4ZGYB 3BR2A 2X6WA 1Z2IA 1M4GA 1MBEA 2V1UA 1XTAA 4P55A 1QZYA 5J8CA 1K61A 5FRNA 4UWJA 3ABMH 3KASA 4CO8A 2B63J 1SAUA 4DIQA 4MCPA 4CA0A 5EF6A 4AXVA 3DEUA 2B0LA 1G3WA 4EJWA 1IRFA 3GFLA 2VLAA 4I6ZA 3S1QJ 4RN7A 4CYQA 4IPAA 2GU2A 2ODDA 1CHOI 4IQJA 4XPLA 4A39A 4A3DJ 3PB8X 2HEOA 1XC5A 2QYOA 1Z05A 2CMPA 1K78B 2A61A 4MI4A 3VARA 4IRGA 4LOCA 1KMAA 4HQMA 3B2YA 3KHZA 4ABZA 2EFOA 4MJ8A 1JXSA 1IDZA 2BXYA 4JD6A 2Y30A 1C0WA 1FMWA 1PYTB 1TXRA 4M3SA 5IP6A 2DW4A 2GA2A 3N05A 3S9MA 3VH9A 4FBEA 1W7PB 4JZ0A 2J9AA 3KQXA 3OYJA 3DTEA 1TGSI 1L3LA 3CCVI 2JA5J 4ZBGA 3HDDA 2Z16A 4UXHA 5THWA 3X2QH 3T8WA 2DA5A 3F8FA 2CFXA 1UJ8A 2DA2A 3ZJ0A 4A32A 2KJCA 1FOXA 1LAMA 3WU2C 4A3LJ 3R61A 3F0CA 3BZ6A 3EUAA 1S5KA 3ZQ7A 3S1NJ 4XN0A 3ZGKA 1D1AA 1QZZA 1KA8A 2DOFA 2PMZN 2PIZA 1FP2A 1YS6A 5CJ9A 2EPFA 3SDGA 4M6GA 1XGNA 1S3JA 3J81K 1YRNA 2Q51A 4HF1A 2IS4A 3HHHA 2DMUA 3CTAA 1ZGWA 1NHAA 2DPDA 3FECA 5LRKA 1XGSA 2OA4A 4A3EJ 1OMIA 4L9MA 4PXDA 1XGMA 4RM3A 1FSHA 1FMVA 3HOXJ 1TW2A 5DD4A 1LFWA 2CNMA 2QSFX 3BG3A 1BUSA 3VYRB 4E7SA 1IY7A 4KOUA 5CPAA 1UHSA 3MZYA 3OWTA 3W3CA 1I12A 4KSAA 2R7OA 5BWAB 3HOVJ 5AG5A 1FWZA 5H6QA 4V2GA 2R0QC 4BBSJ 3ZR8X 1KU3A 1S3ZA 4HNUA 2UXNA 2ZEHA 2ZBKA 4MCSA 4XRMA 3OIQA 1MD0A 4M3EA 2VE9A 4QBJA 1W5TA 4XBFA 5HVHA 1BOAA 3AG2H 3ZXSA 3D67A 2DDBA 2EK5A 3ZQCA 1K4JA 3IFEA 3PP9A 3SI2A 2KMPA 3CD6I 2KMQA 1IRZA 1IUFA 3DGVA 3K4BA 3K9UA 1SMYF 3PB6X 3DBRB 2BW3B 2HWVA 5CVJA 1WQ2A 3JRDA 4CRYB 5HNHA 8CPAA 1TWHJ 4OIRF 1U9OA 1A36A 4HV5A 3EUHC 1X1PA 1T08B 3S3MA 5A27A 4BL0B 4XPDB 3LMMA 1TWFJ 1M44A 1BPNA 2EWNA 1V5FA 2EV5A 2V9VA 2QVPA 2EV0A 2PJ9A 2E5ZA 2XKOA 2OH1A 1CE3A 4WXHA 3CUOA 4KICA 2JTVA 3OL0A 4QWQA 3H5NA 1G3TA 4YIRX 2ZOFA 3CF2A 3DKXA 3H4QA 3V8KA 3WE2A 1BMOA 2R8VA 3BQYA 3DPTA 9ANTA 1P92A 4HSRA 3BI1A 1HKSA 1YE9A 1D3YA 3TO6A 4EEFG 3RNZA 2R7UA 4BQOA 2R7RA 2YUSA 2Z1DA 2C6CA 3T5XA 4XN3A 2X0LA 3KEYA 3WTZA 1MDMA 1K79A 3W2AA 2EIMH 1MJAA 3BOQA 1R23A 2FMLA 3F3XA 3R4KA 5IPAA 3PNYA 4Y13A 3DU5A 1Z21A 5IT9K 2DA4A 1LUJB 2BXZA 1VHSA 1UHMA 1Z5RA 4R8FA 5LRRA 1ULMA 5TRDA 3LQQA 1SFUA 4JWPA 3BJAA 3G1OA 1ZELA 2HQRA 2LDUA 3PEIA 4IHYA 2ZFWA 3Q0WA 1WH7A 1Y0YA 4NQWA 2BOAA 3CO7C 4G7OF 4BHBA 2KMOA 4E1PA 2O28A 3DTKA 3U9GA 4ZH4F 1P4XA 1VI0A 4L9JA 1SAXA 4MMOA 3QPSA 4WXCA 3FEDA 5B1AH 2PJAA 3B8GA 4XLNF 2VOOA 1YU6C 2I3CA 1AOYA 4LLNA 4AMLA 3V7ZA 2M7BA 1IN5A 4XKWA 5DS0A 4U87A 1PCEA 5IOYA 2OCCH 4A24A 2JVHA 2PMHA 2NRAC 2WZNA 4PK3A 1R1TA 3ZQHA 3CC2I 2Z3MA 2SGEI 2CNSA 2JPCA 5HS7A 2LLKA 3BCBA 4C2YA 5GPAA 4KT5C 4RMNA 3H36A 4U9ZA 2VKVA 2M4GA 4MHDA 4CAEA 3UNGC 1IY5A 1LJ9A 5G22A 4C7HA 4BXFA 3KIOA 1ZRFA 3HC7A 2M8EA 2P7VB 2SGDI 2O53A 4AB7A 2Q8KA 1PYVA 3F22A 4HX8A 3E59A 4PJNA 3IU1A 3PRTA 1OCZH 1T33A 5K1YA 4IHVA 2HOAA 1X2NA 1MSEC 2RKHA 2QSHX 3T1BA 2GKTI 2AE6A 1WJAA 4JOMA 1ZG9A 3H92A 2F5IA 3OYGA 3QB8A 2VZZA 1LEAA 2CWGA 5E96A 1XCVA 3F8BA 4PJMA 4MQVA 3VFZA 3CLOA 1LEBA 4FAIA 3I3GA 5DUIA 5HXDA 4Z65A 4B4CA 3OVOA 3M8JA 2JA6J 4ETSA 1B8IA 4HF0A 2Y31A 2NYQA 2CSOA 3G71I 1M1EB 2GOXB 4Q38A 5F09A 4B44A 3KKWA 3WTVC 1JKQC 1K7TA 1APLC 5L3DA 3PDNA 4N4NB 4BDZA 3JREA 3OY9A 2VKEA 1IO2A 1U3EM 2V1CA 3ABKH 1QSMA 3TFYA 1P7JA 3CMEI 3CDXA 3N5FA 2HVSA 3HSFA 3NH5A 5D6EA 2PJCA 2BE5F 4M71A 2FSRA 1I39A 2ZJQF 3L2WA 3CQZJ 3I3LA 3GVAA 1PP7U 3HOYJ 3D7GA 3DLAA 3DV8A 3GX4X 4U7BA 3FX3A 1UMQA 3OYHA 4MHPA 1MW7A 2PEXA 5TGTA 4CGZA 3WT4A 5DUKA 3UGLA 2WAEA 4KN7X 1V55H 1FX7A 3KQZA 1ZK8A 2HNHA 2XPUA 4UBRA 4LG0A 1JT6A 3AFHA 1X12A 4NGSA 4BQAA 3SI0A 1VHOA 2ZEEA 3FBUA 3QAYA 3HG9A 2ZXHA 1D8JA 4L89A 1X1BA 3RKQA 2A6HF 2P5KA 2A20A 1IC8A 3ELKA 4XRSA 2IGNA 2QYVA 1WGXA 3OYCA 2MD0A 2PJRB 5HLHA 4II9A 2Y0SN 3NE8A 1MNEA 1MMAA 1MNDA 3HIFA 2GZWA 2QQCA 2KQRA 3WTUC 1T38A 2P5LC 1HSJA 2XEFA 2SGPI 1RO5A 5KTAA 4HPQA 1O7LA 3HRSA 3SEQA 3HUVA 2X1DA 1I3QJ 4K2EA 5F0CA 3V4GA 3IL2A 1J2XA 1WJ5A 4J00A 1BL0A 4F52A 1ENHA 1D5VA 3GCMA 1XX5A 3HRTA 2FF4A 4ONUA 1G6NA 2EA4A 1VDDA 3OOPA 3S15J 1S7EA 2JUCA 1HW1A 1TQPA 2LF7A 1K6OA 2V77A 2VI7A 2L5QA 3K6GA 3NARA 1PJRA 4CYCB 2Z3NA 3LSTA 4MFJA 3TW7A 2GA1A 5K8PA 1DU6A 3BXMA 5A2QK 2XRNA 3H3ZA 4BDYA 1ZQ3P 1IOIA 1XDSA 1ZHFA 1YVOA 3T90A 4CZZA 1W4MA 4NGRA 2BEOA 3JRAA 2VONA 2VBZA 4MO7A 3DLJA 4RBOA 1Y56A 3FM3A 2YNCC 1U2WA 1F36A 3I58A 2PFBA 2Y48A 3LSHA 3H5AA 2DA7A 3EO4A 4UB8C 2R7FA 4A6EA 2BUEA 2N71A 1V1IA 3N7ZA 1MBHA 4FD6A 3DEWA 2XEIA 5BQTA 2QMLA 2ZXWH 3KLOA 1W4RA 1XMTA 4H4KC 2QJ8A 4IO9F 3OYBA 2KMRA 1Z4EA 2QQ9A 3HZJA 2CFOA 1LDKB 1A04A 2B7EA 3FXLA 2LY1A 4UUTA 1IRGA 2DXIA 4Y52J 4H89A 2DMQA 1FPQA 1RETA 3E6DA 4A5MA 1NSAA 1RKWA 2ZEDA 3PBEA 1LDJA 1TP4A 2N52A 1R58A 5F0FA 3W6XA 4OAZA 1BO4A 2ZB9A 3L09A 1QQ9A 1TNSA 4D7MA 3I55I 2X1EA 2DT6A 2F7VA 2OTJI 1GXQA 5KAIC 3WTSC 4EMEA 3GWZA 4ZC3A 3CUQA 4XMYA 3LSKA 1A2ZA 3CP8A 2CTCA 1FAQA 1YR0A 3B6AA 2V8GA 2JA7J 3FNCA 3FYNA 4EM0B 4BEHB 5I0CA 4PUSA 1O7FA 1QU3A 2JQ7A 1VQOI 3T8TA 3SXYA 2AFWA 2R92J 1SD6A 4RAGA 1M4IA 3HKZN 4PZJA 1UFHA 5KTCA 1M1DA 3WHCA 1MZBA 2M4KA 3CXLA 4IHTA 4XLAA 1F5TA 2CG4A 1HDDC 4X2TA 5F0HA 3I53A 1JJ6C 1HXDA 1B9NA 2K3PA 2V9PA 3P9CA 5F64A 4FT8A 1XBTA 3OOUA 2G9DA 1AWCA 3DR6A 2MC3A 2ROWA 4B11A 2ZO4A 4KIFA 5E3PA 2NS8A 2ZW4A 3UGIA 2ARHA 2VQYA 2D1VA 4KORA 5K5QA 1X4PA 1XMXA 4G7ZF 4LQ6A 3JRCA 1I1DA 3K69A 2GREA 1A6IA 4DZPA 3NE7A 3H5ZA 1CT4I 4QLCU 4ZTFA 2D4OA 1TWCJ 3SJMA 2PSWA 2DAOA 1B6BA 3FRMA 2J87A 1Z8LA 3TQNA 3JSOA 3V8JA 4MFKA 2K9MA 5HODA 4AU7A 3GTMJ 4G7HF 1LVKA 2M2EA 3B02A 2OAZA 3MMYB 1BJAA 3K4JA 2XGEA 2ZW5A 1G59A 3S16J 2M34A 2X48A 1ZG1A 3SGBI 2W84A 1S60A 3BTCA 2VQGA 2EWBA 1YITI 3ECHA 4OP4A 4OC5A 1T0FC 3M1CA 5DCMA 4KVOE 1E2XA 2F2EA 2F5DA 2P0WA 4JP0A 4LIUA 1Z7KB 2P6SA 2PN6A 1U6GA 2GIZA 3M7GA 4ITVA 5FFZA 4HNYB 3WE3A 5H84A 3TOAA 1ULYA 4G12A 2NMTA 1H9GA 5EX0A 1CGII 3LMSA 4RDUA 2E7XA 4L9TA 3RPQA 2QQBA 2VC0A 1IN8A 3B6CA 1E3PA 1M8CA 4Z6YA 3Q3SA 1ZG5A 2KP6A 2MBFA 2DT5A 3W6VA 2XSDC 1OISA 4MY0A 4BACA 1IGNA 3QYFA 4ENMA 4NSQA 3CXQA 4EFDA 2P6AC 5D8NA 1X19A 4ZY1A 4I98B 5LGUA 4YRVA 4IOCF 1YTYA 1H88C 5FUWA 2B8TA 4RAYA 5JM6A 3HOTA 5J6XA 1IJWC 1IY6A 3LSMA 1YLOA 1WJCA 2QGUA 3ZMDA 2CWHA 3GFIA 2ZMEB 1WZ2A 1GHCA 1XFOA 1EH8A 4KITB 3OL3A 1CJWA 3BG5A 4PJ0C 5LBQA 3L9FA 3D3SA 5ICCA 2J9RA 4CGMA 4FQGA 4A2UA 5FLXK 4F93B 1XIXA 2VQHA 5HDKA 1LB2A 1YLEA 3IEHA 1QHGA 4IKFA 4C2UA 4A38A 2Z0ZA 1BI3A 1B72B 1QSOA 5H2FC 1VQ6I 2HXOA 2CNTA 1QBJA 5F6FA 1YFHA 4KSIA 5E18F 4DUKA 1HJAI 3DBLB 2DB6A 4UFXA 3JRHA 3F21A 2IW5A 3WR7A 2IMOA 4V2FA 3ZQQA 2RREA 2PJ1A 1R1VA 4XK4A 5EJCA 2XEJA 2HS5A 5FLVA 1EJ9A 2A69F 1R4NB 1HPTA 2K27A 3J7AY 2Z10A 3RPUD 2X85A 2LF8A 4L5EA 3JRBA 5JH9A 5AIPA 2CQ7A 2GXAA 1F57A 3FVLA 3A01B 4IL6C 4CGPA 6CPAA 4E7IA 1IV6A 3UEJA 2J8RA 2ZJPF 1J0RA 3FIWA 4MFPA 4IZZA 1EA3A 2ME0A 2XVCA 2CS3A 3TX8A 4KYWA 5EG0A 3HUGA 3GBGA 4IRIA 5JPHA 2AHQA 1YW8A 3P5JA 3S9NA 3RU0A 1ACIA 4NEXA 1I1GA 3G1MA 4NF1A 2PVWA 3ERMA 1V5GA 3OIPA 4RB3C 4RGSA 1BIBA 4UEFA 3P9IA 4K30A 2RIJA 1UG0A 1YI2I 3FWEA 3BTIA 1FBUA 4X6AJ 3VSLA 5LEJA 1PTQA 4B6DA 3OYEA 1R1UA 4NUBA 2HV2A 2FQ3A 4IUSA 3T0YA 1JGGA 2JYYA 2XPVA 5DM7F 1JI8A 4Q36A 5E17F 3PB7X 4KUMA 1REPC 2FUG2 2LTPA 1JE8A 3FSYA 4P44A 2HGCA 4AYBA 2FE7A 2F6CA 4C2MJ 4WWCA 2EFQA 3NWTA 1D1BA 3CCQI 1YSJA 5JGFA 1BBYA 2MD5A 3HB9A 1ZTRA 1TIQA 2ZENA 1WPKA 4MHNA 3OXGA 3TP0A 2I79A 2PJ6A 3PZJA 1TC3C 3IC1A 4OIOF 3DQVC 1SGRI 2A68F 2IAIA 1YO5C 1BR4A 3CCUI 1IF1A 2PG4A 4U5YA 2JEVA 3VE5A 3TJQA 3ZMZA 4XLPF 5GADJ 4JJXA 4MY3A 3IAS2 1PUAA 4CDGA 3IJ3A 4YIFA 1JTYA 1RR7A 1B59A 2CQQA 1U5KA 4M9SA 4H6ZA 3QYBA 3H8GA 4F92B 2Z11A 3JTKA 3R9FA 1OBRA 2AFOA 3BR0A 4E2AA 3VEPA 1JKPC 3JRUA 1TWGJ 5J8FA 1LRZA 1Z2LA 1ETXA 2HOTA 5HVFA 1CT0I 1OMTA 1RRJA 3GFJA 2HYFA 1SGPI 3V7SA 4BJ6C 2XF7A 1Z91A
chains in the Genus database with same CATH topology
3QPTA 2DK8A 5D4SA 1I21A 4F0XA 1V3FA 5H6RA 5ICEA 3IWGA 2ZXVA 3TKYA 3SHFA 2M45A 3E3VA 4ZZLA 2PC1A 3JVNA 1Q2DA 3RYPA 2YNDA 2RDPA 3COAC 3IWZA 1OYYA 4O3MA 4EVYA 4C2XA 1ZN2A 4KZTA 2Y0MA 2Q7BA 3P9KA 4IJAA 4IRHA 4MFQA 5HDGA 2L4MA 1B4AA 1JHHA 4JBAA 3ULQB 2Z3OA 4JXRA 2FXAA 5EC4A 2BYVE 4CAFA 4CRZB 3I59A 5HOOA 4B14A 3HTSB 2STTA 1UCRA 4OADA 1H9TA 1CF7A 1NE9A 5LGNA 4WCGA 3KCCA 2EJRA 2VT2A 4KUBA 1V0CA 4KN4X 3EC4A 4KS9A 4GS4A 1LVAA 4HOBA 4F0YA 1OYWA 2B58A 3BDDA 4S05A 2A07F 5D4RA 1Y9WA 2L4AA 1YGHA 4EGYA 1JHFA 3TDZC 1MK4A 4U9YA 3R1KA 3J7AO 2JSCA 2GIVA 5AG4A 1BI2A 3F8MA 1FOKA 1W7PD 1J7KA 2ESNA 1DDNA 4LB6B 2L54A 2WC2A 3VOEA 2G7HA 2Q2EA 4UA3A 1KUVA 2G0BA 1TQIA 3TGNA 2QVOA 3ZMSA 2VZYA 4UFWA 3RYOA 2CXAA 1U5TC 3WGIA 4RB0A 5ED4A 2QECA 3MCZA 4L9VA 2FS5A 3TO9A 5KK1A 4UXNA 1Z7UA 4HX7A 3FB3A 4HLXA 3GY9A 2R1IA 1O3QA 2AS5F 5H86A 2JPBA 5JR3A 1GVJA 1P2FA 1PP8F 4CYDA 2V79A 3C26A 1W5SA 1FNNA 2BL1A 3DP7A 2D4PA 4N0BA 2YPRA 3RKYA 1IXCA 3HSEA 4FX4A 3IHUA 4PSXA 5C88A 5FD5A 2YX7A 3RDIA 2Z33A 4EGZA 2P7CB 1FT9A 5DWNA 4M73A 2RGVA 4XRFA 4KOVA 1FY7A 1F4KA 5IT9Z 1SQHA 3V7CA 1EV7A 3BROA 3R60A 4EQQA 4Z2YA 4MNUA 1XMAA 4A6DA 4IF5A 1SD5A 2HUZA 2B5GA 1KU9A 2KRFA 4BHCA 2ZNZA 1O3TA 3V8IA 5D5UB 2G7UA 2VOPA 3DFGA 2FSWA 2H27A 5FVJA 3FZVA 2P5VA 3U1DA 1TW3A 3R95A 3KE2A 3SZPA 1KZFA 4I09A 3N4MA 5EEGA 4L18B 3GKRA 3W91A 1YIOA 3L7WA 1R7JA 1R5GA 1X3UA 1M4DA 2A4NA 1S7NA 5CNPA 1YX0A 4BNCA 3JTGA 3OWCA