3TO7A

Crystal structure of yeast esa1 hat domain bound to coenzyme a with active site lysine acetylated
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
276
structure length
275
Chain Sequence
EVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title MYST protein acetyltransferase activity requires active site lysine autoacetylation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords Histone acetyltransferase ESA1
total genus 79
structure length 275
sequence length 276
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2011-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3to7A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 3to7A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3to7A02
1MJBA 1H0MA 2LF8A 4F0YA 4ETSA 5FLXK 3DNSA 4I98B 5LEKA 2JTVA 2VONA 4Q48A 3IKTA 1PDNC 5ICGA 2DT5A 4HW0A 2IPQX 4G94A 2IVMA 1XCVA 2L3DA 4B5PB 2R7HA 2KJBA 3HRMA 4LB5A 4KOSA 4YFKF 4E2AA 3DR6A 3HRUA 3GEZA 3DEUA 3T90A 3FMQA 3KP7A 5LHIA 3GFIA 1O3SA 1FSEA 1IN7A 2D2WA 4KUAA 2P4WA 2GAUA 1KYZA 2RDPA 1G4DA 1B59A 1XSXA 3KP2A 3HIFA 1YFHA 3F23A 5EEHA 2QENA 1LRZA 2MLGA 2Z33A 1YYVA 3K1NA 3HSFA 1FBQA 2KJCA 4KIFA 1XDUA 4RB2C 4OIPF 3J81K 5BQTA 3IHUA 4LLNA 2DTRA 4JXRA 4BYYA 3WE2A 3FRMA 1HXDA 3KP5A 1K7AA 1UB9A 5CVJA 2XRNA 2I79A 4CZZA 4OMZA 3TO7A 3DP7A 2QBYB 2ZMEB 3RIRA 3COAC 1SD6A 2LSOA 1MD0A 2OBPA 4XRFA 3GWZA 1LEBA 1FT9A 4L89A 1ZHFA 1IN5A 2P5VA 1TW2A 1Z6RA 3MZYA 4EJVA 2E1NA 4KT5C 3F8FA 4F6AA 4HAMA 3O6BB 3P9IA 5F47A 2Z11A 3HSEA 4IF5A 1LDJA 1XN7A 1R57A 3BDDA 5D4RA 3WTXC 2H6CA 1J0RA 1B4AA 2DI3A 1S3ZA 2FIAA 1KQ9A 2MC3A 1J4JA 3R6SA 2RQPA 1I6XA 4R3LA 1ZARA 5H6QA 1J9IA 5FD6A 3EXNA 4K30A 2MD5A 5D6FA 5FD5A 2CW0F 5HVQC 3HOTA 4A12A 3S6GA 1KU2A 3NE7A 4XLPF 2FEZA 2G3AA 2JSCA 3W91A 5L3GA 2RKHA 2JPCA 5AONA 3LQRA 3JVNA 1BI0A 2P6FA 2PRBA 3QPTA 3E5UA 3E6MA 1REPC 4UWIA 3FF5A 1U78A 1CM0A 3HHGA 3NQOA 4IF4A 1FY7A 3DV8A 3QP5A 4BH9A 3S6HA 3S6KA 3HHHA 1W4MA 2ZO4A 4M71A 3P9CA 2A6HF 1P92A 2BYVE 4MEYF 1TW3A 3ECOA 3HTSB 2V1UA 3OWCA 1YVKA 5DEQA 3IKVA 3ZMUA 3RI4A 3QP6A 2EFNA 4M9ZA 4BHCA 4JJXA 1MDMB 2VXKA 3TFYA 4B5OA 3K1PA 2PR1A 2F2EA 4M74A 5L3BA 2O0YA 1FLIA 1DP7P 3HYIA 4KOVA 1IIDA 3KETA 2K4JA 2BEOA 2FSRA 2H6BA 4MBUA 1TQMA 4GCVA 4UXNA 1HSTA 3EC4A 2OU2A 5DV5A 3F3XA 1IYLA 4OIQF 1FSHA 2XIGA 2FBKA 2JDDA 1LVAA 3EYIA 4EVYA 2F5IA 2WPXA 3K1MA 3JTGA 1R5HA 5C82A 2G9WA 2LF7A 2HR3A 1AWCA 4K2EA 2FQ3A 2AS5F 4L0ZB 4FD4A 4ZH4F 3CO7C 2CWEA 4LX9A 3KFWX 5L3FA 3SQNA 1V0CA 1PP8F 5IT3A 4KYWA 4M85A 1XB4A 2KKOA 2OZ6A 5K5OA 4ONUA 4GGGA 1ZYRF 4AIKA 3CTAA 1BC7C 1IZ1A 2FE3A 1KZFA 4XPDB 1SD7A 2CSOA 2A61A 3BLNA 1B87A 4AG7A 4R3KA 4UA3A 1J2XA 4YFNF 1QSNA 1SMYF 2PMUA 3M9AA 1WKMA 2IRFG 2O3FA 1XCBA 3VOEA 2WC2A 3RKYA 3FB3A 1N71A 2HOEA 3FNCA 4IUSA 1WWZA 1KA8A 2P0WA 1R1VA 5FGMA 2HS5A 3Q9VA 5D5VB 2E1CA 4RGSA 2RC4A 3OOPA 2E7WA 4FX4A 1AOYA 2FA5A 2QYOA 2STWA 1WSUA 4P96A 1U5TA 4UVAA 1YK3A 2Q44A 2DAOA 4UV8A 3V8LA 1LEAA 4I49A 2CQKA 4KN7X 3MWMA 2A4NA 2VI7A 3R95A 5L3CA 5JHUA 4I0BA 4PGHA 4KFCA 4Y49C 1QPMA 3S2WA 1M44A 3EO4A 3T0YA 3E6BA 4P5OA 1YTYA 4G9YA 4WWCA 3VEPA 4XNHB 4KIGA 1PU9A 2ARHA 2P6SA 2OB0A 3JSOA 3B8GA 1E2XA 5CVVA 5E8GA 1XMTA 1QZYA 4PSXA 3IWFA 5D4SA 1J7KA 1P4AA 1ON2A 2H5MA 2Z99A 3KLNA 3TDZC 3GFJA 3DSBA 2OQRA 4R57A 2NRAC 3GF2A 3WGGA 1IRFA 2L4MA 5J6XA 5LGTA 2JLMA 2CYYA 3J81Z 4S05A 1R00A 4FHTA 4BNCA 1Z4RA 2FU4A 2H09A 2M87A 2DBBA 2CG4A 1L3LA 4HZFA 1FX7A 4PK3A 1NHAA 3B02A 4KOTA 3FXQA 1W7PA 2A5YB 4LLGF 3TDUC 5C88A 3DPLC 1R22A 3QOPA 3NRVA 3GFLA 1OYWA 4FT8A 2HQRA 2V6CA 5KTAA 1S7OA 4BAYA 4L9JA 4Y15A 2HQYA 5F46A 1LB2A 2EA2A 3FXUA 4XNHC 4R1HA 2AJ6A 2Q4VA 4MY3A 2K86A 1BI2A 1Z05A 1GXQA 4CXFA 4BQAA 4KICA 4RI1A 1JXSA 3GYAA 1V4RA 1O3TA 2ZNZA 3BPXA 1G3YA 4RAYA 3R0AA 4LG0A 4WXDA 5FFZA 3VB2A 2MA3A 3DFGA 2F5DA 1YW7A 4IXAA 3BPVA 2K5TA 2F5FA 2R1IA 4HNWB 2MH9A 1O3RA 3HRSA 4MEXF 2W24A 1QBJA 2JZYA 5H6RA 4A0XA 2BEIA 3F6VA 2VBXA 2PDOA 3T1BA 3IL2A 3EUHA 3E0KA 2DQRA 1P0HA 3IWZA 2D4OA 3ULQB 2JRTA 4G8XA 1TTYA 2IT0A 4PV6A 5E18F 4MJ8A 3GXOA 1KUXA 4KVME 3F8MA 2CNTA 2VEZA 2B58A 3ZMSA 4CDGA 3DPTA 2G0BA 2A3SA 2CGPA 3J7AO 5DYMA 4H6ZA 5LLQA 3N7ZA 2NNYA 4FD5A 1J5YA 2FCKA 1TLHB 3ELKA 5K5QA 4KLWA 5HS9A 3I5UA 5FFXA 1PP7U 3DF8A 4KN4X 3LAPA 1A04A 3ZN1A 3V7RA 1Q2CA 4O3MA 4HX4A 1XE4A 3MZHA 1RNLA 2K27A 1G3WA 1LJ9A 4UVBA 1EH8A 3T8RA 1FPQA 3TOBA 2EWNA 4ESBA 3FM3A 2VE8A 1DDNA 1XD7A 1ODDA 2EFPA 1RUNA 4EJWA 2PQ8A 1BOBA 4M6YA 3EYYA 1FZPB 2XGXA 1YS6A 1ZGAA 4GYIA 1Y9WA 2ESNA 4HOBA 3SXOA 4G6DA 1H9TA 4S04A 5D8KB 1SD5A 3LFKA 2CFXA 1P2FA 2ZKZA 2REEA 4JLYA 4HDVA 5L3EA 5ILSA 2VBQA 4M9XA 4D0PA 3Q5FA 3ZPLA 5J8FA 2ZPAA 2LNBA 2M1BA 4HV5A 2C6YA 2CNMA 3VODA 1R23A 2ZCWA 1T2KA 4YFJA 5E1ZB 4WCGA 5F49A 1HKSA 3K69A 5F64A 2BL1A 4BHPA 3D2MA 4JWPA 5EBVA 2Z9OA 1FNNA 5LRRA 1RIOH 1WI9A 4BXUA 1YO5C 4PGGA 1WK4A 3FIXA 2RNJA 5HS7A 1R58A 4KLVA 3I9SA 3LA3A 4LLLA 1S7KA 1HQCA 1RXTA 1PUAA 2PC1A 3GVAA 2VQYA 4JXQA 4QB9A 5ED4A 4MQ9F 2A07F 2XAGA 2PSWA 3CLOA 1FP1D 4RS2A 1BN5A 5HLHA 3BWGA 1XGNA 4R9MA 3VWDA 2XROA 3MCZA 2ZW5A 3TOAA 2FSWA 3MEXA 3TKYA 4MNUA 2PMHA 4PZJA 2Z10A 4KIBA 1KGSA 2O61A 2VE9A 3H92A 5ICCA 4NF1A 4EM0B 2Z5UA 1Z9UA 1OYIA 4ENKA 1SFUA 2HUZA 4XPDC 2DU9A 4PK2A 2R98A 4AWXB 3TGNA 5CVIA 5E1XA 4U5YA 2Z3YA 1P6RA 5TJJA 5E20A 5BMZA 2VZZA 3TO6A 4NXYA 2GA1A 2NYXA 3KEQA 1JHFA 1V3FA 2GZWA 4M73A 1YW8A 1B6AA 2H27A 1S6LA 1TQIA 2PG4A 4MTDA 1U3EM 2HFHA 1USSA 3CDHA 4L8AA 3KP4A 2X4HA 5BPDA 4TV7A 1YQAA 3P2HA 4MQVA 3OV8A 5DCMB 1I1GA 3N97A 1OMIA 2DK8A 2J8NA 1O7FA 2COMA 2P5KA 2B4BA 2DFIA 2OH1A 1B9NA 4MI4A 1LDKB 2GXGA 3TCVA 1YREA 2VC1A 3DKWA 3R9FA 2V9VA 3I58A 2OQGA 1HBXG 2HTSA 3L09A 4Y17A 5JQ4A 3GLXA 4II9A 4YGOA 3T8TA 2QECA 1Z1DA 3B73A 1YGHA 1XGSA 2KRFA 5FO5A 1S29A 2R8VA 2JDCA 3K0LA 3RTRA 3G3ZA 3LA7A 3I0TA 1T38A 1Z7UA 4KOWA 2QIRA 4BHBA 5DUKA 2H94A 5L3DA 1W5SA 1OPCA 3HOSA 1B6BA 2I00A 3JW4A 3SFZA 4ENMA 1IXSB 4CHUA 1XDSA 2K02A 1S8NA 3BJOA 3ZQ7A 1Z4EA 4DNCA 3PFIA 2IJLA 4NSQA 2GXBA 1B1BA 3FXRA 5DCFA 1NMTA 2VC0A 1JHHA 2WV0A 1YLEA 1FC3A 1O7LA 3EDPA 4WX9A 3EETA 3I59A 5AIQA 4LGWA 2YX4A 4OOIA 2FL4A 4ZYEA 3D3SA 2Q0YA 4B5PA 4HNYB 3KZZA 1SFEA 4NB5A 3FWEA 3KCCA 5GCNA 4E0AA 3V7SA 1ZN2A 1S3JA 2ZW4A 1GHCA 3BJAA 1HW2A 2B5GA 2W57A 4UNOA 1TNSA 4QUSA 2PJPA 3CXQA 3SZPA 4A2UA 4Q5SF 4L9VA 2DQLA 2PFBA 1D5VA 3ROUA 2Q4YA 1I5ZA 3DDDA 5F6FA 2EFWA 2B0LA 3MGDA 3R60A 2XASA 5DD4A 5TRDA 2CNSA 3R0JA 1RZ4A 1S60A 2BUEA 4CRYB 5KK1A 4CYDA 1IN8A 2RV8A 3SXYA 2ZW6A 4ZZDA 2VXZA 3S6FA 3FMRA 3WODF 4J3GA 3GUDA 4ZYDA 3GKRA 4LB6B 4LK1F 2V79A 4ESFA 3SHFA 3C26A 1BI3A 4LG0B 1Y7RA 1K79A 4IHTA 1S7AA 2Q0OA 1T6SA 3V8JA 2D1VA 5D5UB 3RDIA 4AD9A 3KE2A 3VFZA 3ABTA 1BIBA 5LGNA 3TTHA 3FYNA 3T9YA 4A5NA 2VOOA 5KVRA 3F72A 1QZZA 2QMLA 5HLGA 2STTA 1M4IA 1FYKA 5HDKA 3RPQA 4JBAA 3FMSA 4OLLA 5A2QK 3SZTA 1I1DA 3H4QA 4XBFA 4N0BA 5FB2A 4KOXA 5IX3A 3M1EA 3FM5A 2UXNA 3I64A 2FMYA 4ON0A 1BOAA 1ULYA 4Y49B 2ESHA 1U5TB 2HDCA 1M1DA 3TE4A 3D0SA 1FP2A 4H0EA 1DPUA 3WGIA 1U8RA 1F4KA 1K4JA 3GYHX 2HZTA 2UXXA 2M45A 4JD6A 3IGRA 2CO5A 5LRSA 3I54A 2BSWA 5EEGA 3R61A 1W7PD 1YG2A 3WTVC 1IB1E 2FIWA 3F8NA 1UFHA 1FOKA 2Q7BA 2VBYA 1D8JA 4OAEA 3N4MA 4A0YA 1HW1A 2YU3A 1BIAA 1IUYA 5HMNA 3HSRA 4EVIA 3ERED 4AVBA 3KP6A 1ZLKA 3W6XA 1J75A 2Q2EA 3U9GA 3UY5A 2PEXA 2V1DA 1QSTA 3LWFA 4HYEA 2VZYA 1RI7A 1BBYA 4U9YA 2JEVA 3QU3A 1XSDA 5E96A 1D8KA 4H89A 5BOXA 2QM3A 2ZXJA 3KEOA 3HTUA 4GO1A 5LEJA 2K7LA 5ILVA 4P9UA 1FYMA 3L2CA 3CUOA 1I12A 3AAFA 4MTEA 2OA4A 2P5LC 2ADUA 3FZVA 4YFXF 2G3TA 4OIRF 4CICA 4KVOE 4L5JA 3ZN0A 4ESJA 4WXHA 2J8RA 4HA8A 4BMHA 4OINF 3IC7A 2M8EA 2ELHA 4RB3C 1SFXA 2E7XA 4A6DA 3F8BA 1S5KA 5DWMA 4FD6A 2O6GE 5IB0A 3IWGA 5D5WB 3GY9A 1HKQA 4KUMA 5DD8A 2VOPA 4MY0A 1H9GA 4IHSA 2BGCA 3BJ8A 1HSJA 5E17F 3D2PA 2FE7A 1KQ8A 4IRGA 4Q47A 2O28A 2KIMA 3DR8A 5E8IA 2OZUA 1S7LA 3KKWA 3P9KA 3G3SA 4HV6A 2KIUA 4U88A 3V4GA 4HNXB 1LQ1A 2J8MA 2J5PA 1UFMA 1R36A 1OZPA 1KU7A 4UWJA 2EFQA 4HLYA 2VN2A 1WWXA 4MHGA 2FXAA 2F5CA 1M4DA 3IRRA 2IA0A 4A6EA 2OD5A 2LDUA 3VWEA 2EUIA 3F6OA 1IN6A 4KOYA 2X0LA 5JI6A 3C3WA 3GZ5A 3PP9A 1XGOA 3ZP5A 4ZBGA 1I21A 5DUIA 4XPLA 3WU0A 3ZMVA 1KU3A 2WPWA 5HDNA 2QZ8A 5IV0A 4HF2A 2GE3A 1DUXC 1XMKA 4RAZA 1ZREA 4EJOA 2O8XA 2W85A 4JK1X 1UHMA 2P6TA 1F1ZA 2GA2A 4PCQA 2R3SA 2EB7A 2C27A 2RGVA 3GW2A 2F5EA 1K6OA 3QB8A 3FX3A 3ABUA 2ISZA 5CVUA 1QSMA 5BPIA 4R79A 4EJUA 2ATRA 1RUOA 1R7JA 4R87A 4AVAA 1LNWA 2V1XA 1BM9A 3L00A 4E70A 1YIOA 3L9FA 4I02A 1ZG5A 1UHWA 4QC6A 2ZJ2A 5HS8A 4O6JA 4EM2A 3RYPA 2FXFA 4A5MA 1W7PB 3H3ZA 1IF1A 1PUEE 2PLYA 3ZJ0A 3K2ZA 4U0VA 2HYGD 2EVNA 5FVJA 4KUBA 4CGZA 1TIQA 2B3UA 2XHKA 2IL4A 2Z0ZA 1U2WA 4HDUA 2ZBKA 2GWRA 1STZA 1XSVA 2M30A 5JR3A 2Y75A 3CUQA 2VODA 4ZZLA 5EC4A 2GIVA 2A69F 4UUVA 1WQ2A 3E5QA 2L4AA 3TQNA 2NAZA 5F48A 5H84A 4WF2A 1Y0UA 4UV9A 2MBFA 1DPRA 2D1HA 1QGPA 1YW9A 4HF0A 4XLNF 3WTZA 2JT1A 1Q2DA 5DWNA 4ENJA 4L9NA 5CJ9A 2FNAA 4ORFA 1U6GA 2EV6A 2DLLA 2VT3A 3E6DA 3WE3A 4CRZB 1T39A 1ZGJA 2FBHA 4MGRA 1R1UA 2UZKA 4HQEA 4FX0A 3E6CC 2QVOA 4YIIA 4UBRA 2EV5A 1XF8A 3L7WA 2PBIA 3FBUA 5DCMA 3PQJA 4KORA 1OYYA 2OZGA 5DDGA 1KUVA 2ISYA 3V7CA 3LSTA 1USTA 5F1RA 3JSPA 2XKOA 5ICEA 3JTHA 2QBYA 5H86A 3G8WA 1QNTA 1GHEA 2L02A 1K78A 1Z6TA 3W6SA 4ZYHA 2DW4A 2YPRA 3O3KA 2B3VA 1SD4A 4RGRA 4CAXA 2BV6A 3O2PE 1ZRCA 5LHHA 4KNYA 4M72A 4P55A 5IT9Z 2XV4S 2G7UA 3CJNA 2QUFA 2NNNA 5HDGA 3WGHA 2HKOA 6PAXA 5HLIA 4L0YB 3F22A 3KZYA 5LGUA 4KA4A 4G7OF 2REFA 1MJAA 1F5TA 5HOOA 3WR7A 4M9SA 1M4GA 4PSWA 2WWYA 3R96A 4KZTA 1R1TA 1W5TA 2BE5F 3RJPA 1QSRA 3EQLF 4QVTA 4QBJA 3GX4X 2IP2A 5CYVA 4UVCA 3GO5A 1SAXA 4XSZF 3R1KA 2Q04A 1YR0A 2D4PA 2Y0MA 3E3VA 4HKFA 5JPHA 1IXCA 4AVCA 4I01A 4H6UA 5LBQA 4IPAA 4LD5A 2R7FA 3R9GA 2DXQA 2A68F 4B09A 1E17A 2P8TA 3EFAA 2IW5A 4NQWA 4E8OA 4Y13A 1VKCA 1G6NA 3RPUA 3V8KA 2P6EA 3BROA 1FBUA 5ICFA 4Z2YA 3EY5A 1CJWA 1YLFA 1BJAA 3I53A 4I7HA 2GANA 4GYGA 3KLOA 1MZBA 3ECHA 3W6JB 4IJAA 4EV0A 2FRHA 3MQ0A 3M8EA 1VTNC 4ENNA 1EH6A 1EH7A 1JGSA 4GXOA 3RKWA 5ILUA 4KDPA 2AXLA 2JPBA 4G7HF 3CXSA 3WTWC 3Q9SA 1NSLA 4B8XA 2XUBA 3F5BA 2IA2A 4X5KA 2FBIA 3JUWA 1Z9CA 3RYOA 2LKPA 1F9NA 4U9ZA 5K5RA 4QWQA 3D5LA 1HW5A 3DQVC 4O5VA 4HX8A 3ZMZA 4XSXF 1JE8A 1YS7A 3E97A 3GZ6A 1FWZA 1MDMA 3H3UA 1O3QA 3FHZA 4KOUA 1X3UA 5FLXZ 3I4PA 2NS0A 1XEBA 2UWMA 2HV2A 5D5XB 1IRGA 2FNPA 2M5WA 1C0WA 2B4DB 2X7BA 2YX7A 4EMSA 3M8FA 2R7DA 3WTTC 3I59B 2HGCA 4AB7A 1J59A 3ZMDA 5KTCA 5BS6A 1B9MA 4LJZF 3BP8A 5D6EA 3BY6A 2KIFA 2W25A 1MKMA 1VHSA 3PQKA 4KMFA 5ERIA 3WTUC 4G7ZF 3ZZIA 2FT0A 4MHDA 4UHTA 3K9UA 2L01A 1L0CA 3CUQB 2XAJA 5E1WA 1BO4A 3CO6C 1SMTA 3MFKA 1U5TC 1KYWA 1WRJA 2QLZA 5CVRA 2MH2A 1Q1HA 1FYLA 1L0OC 2A6EF 3I71A 4U0WA 2YSRA 2VBWA 4HLXA 4AG9A 1CF7A 3J80Z 4YG2F 1QQIA 5A2QZ 4KVXA 2P6GA 4M3SA 4HF1A 2O03A 5CLSA 5D8LB 1XGMA 4CAWA 4EGYA 2EJRA 4EM1A 3C18A 3CUQC 3LAJA 2ZMEA 3LODA 1SQHA 1TQPA 1ZG3A 4M6XA 1RO5A 3D8PA 3LD2A 3ISPA 3F21A 1KUYA 1NE9A 4HX7A 2IA1A 4WK8F 1GXPA 1G3TA 3T5XA 4IRHA 2PI0A 3R4KA 4RB0A 3E5XA 4U0YA 3G73A 4DQ2A 2EA4A 2NMTA 1UCRA 2B4DA 1MK4A 3SXNA 4OIOF 1IW7F 3HRTA 3QU6A 3QAHA 3DXJF 3ZMTA 2Q8KA 2ZNYA 2WTEA 1I27A 1GVJA 2XAFA 2D45A 3BOQA 4P9FA 2QQ9A 4I2OA 4ASNA 3F8CA 1P4XA 1CF7B 4XPKA 1MJ9A 3QPHA 2EFOA 3I3GA 4LK0F 1S7NA 3NEUA 4CO8A 2FS5A 1KQ0A 4L9TA 4EGZA 4R8HA 4U7BA 1HKTA 1ZAOA 3LA2A 4LUAA 3CXPA 1S7FA 1XMAA 4I09A 3WG9A 4YIFA 2L54A 1D3YA 2HYFA 3WTYC 2CY2A 3TO9A 3KP3A 2EK5A 3W6KB 2TDXA 1CGPA 2DO7A 2ZW7A 4FD7A 3C1DA 3QRFF 3REOA 4GS4A 2Y48A 1Q2YA 5LHGA 1OKRA 1T98A 4G6QA 1IICA 4RGUA 2OAZA 5HH1A 3RYRA 4L5IA 1ZG1A 2MLKA 1R5GA 2ETHA 1IXRC 1LDDA 1YVOA 2P7CB 4NHJA 2HEOA 4CS0B 3WU1B 4RB1A 5JVTA 2P7VB 2ZFWA 3ML6A 1P4NA 1T0FA 4NEXA 2FF4A 4RGXA 1Y9KA 3TT2A 3HUGA 1ON0A 1G3SA 4HQMA 3WTSC 2G7HA 3PGPA 1QO0D 4I0AA 3BJ6A 3K9TA 4OADA 1YX0A 1TNTA 3RKXA 2FMLA 4LFUA 4A0ZA 1P4WA 1ZRFA 1MGTA 2XAQA 2RN7A 2BBYA 4L18B 1KU9A 1ZRDA 1ZLJA 1I1SA 1OR7A 2HKXA 3J80K 1BC8C 3P7NA 4N9IA 4OU0A 2K4BA 1IN4A 5J8CA 2FOKA 1IAWA 4CAVA 3JAMZ 2KCWA 4AIHA 4YRHA 2XVCA 4LMYA 2DPUA 2XKPA 3R9EA 2QQBA 3SHPA 1Z91A 5H20A 4ZYGA 2AE6A 2J5OA 3IRQA 1QSOA 5AIPA 4NCZA 2DK5A 1XIXA 2QQAA 3BZ6A 3U2RA 1ZH5A 3BJ7A 5KTDA 3M7GA 3JAMK 2GQQA 3GFMA 1TBXA 1IYKA 2RVCA 3F0AA 2QWWA 4AIJA 4PDKA 2DPDA 2ACJA 3PZJA 5JFRA 2XAHA 5CNPA 4IVNA 4QLCU 2W84A 3MAJA 4EQQA 2OZHA 5ISVA 1ONVA 2HWVA 2PN6A 1O57A 3LQQA 2B5GB 4EJTA 3F8KA 2ZXVA 4RS8A 1U6MA 1ON1A 1FBSA 1BI1A 2VT2A 2HTJA 3P2FA 2PR8A 4HBLA 2YR2A 4N9HA 5IT9K 4AVPA 4F7ZA 3V8IA 1K78B 4Q4ZF 5I0CA 2VBZA 4JQFA 3U1DA 4KMUX 2HQNA 1EV7A 4WXCA 3C7JA 3FXTA 2EV0A 4OMYA 5K1YA 4IRIA 4U7DA
chains in the Genus database with same CATH superfamily
1MJBA 1Z8TA 1H0MA 3LWUA 2LF8A 5CQGA 4G6TB 4ETSA 5FLXK 1R79A 3DNSA 4I98B 1MH3A 3HGGA 3D5RC 1MNDA 2JTVA 5LEKA 2MC4A 2VONA 1A6IA 4Q48A 3IKTA 1PDNC 3D00A 5ICGA 1IY7A 2DT5A 4HW0A 3SYTA 2IPQX 4G94A 5KAIC 2IVMA 1XCVA 4B3XA 2L3DA 4YRVA 2LY2A 4B5PB 3RBUA 4ZX9A 4ZX8A 2R7HA 2KJBA 3HRMA 4LB5A 4ZC3A 4KOSA 4YFKF 4E2AA 3DR6A 2GOXB 2QKMB 3HC7A 3HRUA 2GKVA 1TBNA 3GEZA 3DTKA 2DMQA 2JVHA 3DEUA 3T90A 3MEKA 3FMQA 1FMVA 4L9MA 5CKTA 3KP7A 1UELB 5IY5H 5LHIA 5FKOA 3GFIA 2NVTJ 1LFWA 1O3SA 1FSEA 1IN7A 3OY9A 2D2WA 3KYLA 4KUAA 2P4WA 3CDXA 3DWLE 2GAUA 4XNFA 4UEEA 3QWPA 1KYZA 2RDPA 3RQ4A 4XIDA 5LD2C 1G4DA 1B59A 1XSXA 3KP2A 3HIFA 3VYSB 2F4MB 1YFHA 1CX8A 2ZEMA 1YLOA 2H8WA 3F23A 5EEHA 2QENA 2VQGA 2R7QA 4DYQA 1LRZA 2MLGA 2Z33A 2CV2A 1YYVA 3K1NA 3HSFA 1FBQA 4MLOA 1K7TA 1UUCA 2KJCA 2PE3A 4KIFA 3HEFA 3CCVI 4A3IJ 2I3CA 4MFLA 3W2VA 1XDUA 4RBOA 1MMAA 2JBJA 4C30A 4RB2C 4OIPF 2DA3A 5FUYA 1K83J 2N8GA 3J81K 5BQTA 3IHUA 4LLNA 2DTRA 1QMUA 5EX0A 2QQCA 4JXRA 4XMYA 4BYYA 3BG7A 4XLEA 3IH3A 3WE2A 2C6GA 3FRMA 1HXDA 3H9JA 3KP5A 1UB9A 5CVJA 2XRNA 2DYSH 4CZZA 1K7AA 4OMZA 2I79A 2BCOA 2ID3A 3TO7A 4MFZA 2LD5A 2K9SA 3PBBA 3DP7A 1SFOJ 1Z67A 2DFEA 4NGNA 2QBYB 2CQNA 3SI0A 5J40A 2ZMEB 3RIRA 3COAC 1SD6A 4G1PA 1BUSA 3NFZA 2CMPA 2LSOA 1MD0A 2OBPA 4XRFA 3GWZA 1LEBA 1FT9A 2XRCA 4L89A 1UG0A 2J9AA 3AG4H 3VPRA 2WY7Q 1W0TA 1ETQA 2VUMJ 1ZHFA 1I3QJ 1IN5A 2P5VA 4WJBA 3KX2A 1TW2A 1MBHA 4XONA 3DLLF 1Y8RB 1Z6RA 2ID6A 3MZYA 3U21A 4B48A 4EJVA 1AUGA 2E1NA 4CCOA 1YJ9I 1MMGA 5IOZA 4KT5C 3F8FA 4F6AA 5EEAA 4HAMA 3O6BB 3P9IA 5F47A 4DJAA 2Z11A 3B2YA 3HSEA 4C2YA 2PJRB 3RSNA 4M3DA 1T33A 1H88C 4IF5A 1LDJA 3V42A 1XN7A 4KT6A 4A69C 1R57A 4P1WA 3CCLI 2AFZA 5K8MA 3BDDA 1TT5B 5D4RA 1TKFA 3WTXC 1JKOC 1J0RA 2H6CA 1B4AA 2HVRA 2DI3A 2K40A 3IJ3A 3K4JA 2HPMA 1S3ZA 1TWAJ 4MFDA 2FIAA 1KQ9A 2E1MB 2MC3A 4OWRB 1V1IA 1J4JA 2WZNA 4HRIA 2EK8A 2QYVA 2IJZA 4F0YA 3WHBA 3R6SA 2RQPA 2X6YA 1I6XA 3IAS2 1CGII 2OD1A 1ZARA 3H5NA 2AFMA 4R3LA 5H6QA 2I5UA 1OCTC 1J9IA 5FD6A 3EXNA 4F55A 2MD5A 4UXIA 4K30A 3CC2I 5D6FA 5FD5A 2CW0F 2DYRH 3KASA 2IGKA 4TWEA 4A3FJ 3ZQLA 1V55H 5HVQC 2LY9A 4XRMA 3HOTA 2Z3NA 4A12A 3ZR8X 3QYBA 1OMTA 2NVUB 3S6GA 1KU2A 2MABA 3NE7A 4XLPF 2FEZA 2WAQA 2JSCA 2FJ1A 2G3AA 4TNUA 3W91A 1X58A 3K7AJ 2RKHA 5L3GA 2JPCA 5AONA 3LQRA 3JVNA 1BI0A 4PK4A 4A93J 4BEHA 2P6FA 2PRBA 3FF3A 1A6QA 3QPTA 3E5UA 3E6MA 1S72I 1REPC 1BW5A 1BMOA 2F4IA 4UWIA 3FF5A 4ZI6A 3MN8A 1U78A 5G22A 2JW6A 4UY8I 5GAHJ 1CM0A 3HHGA 2AXTC 3NQOA 4IF4A 2JUGA 1FY7A 3DV8A 3QP5A 4BH9A 3PFEA 2E2HJ 3G6EI 3E0JB 1V54H 2GM4A 3M3YJ 3S6HA 3A02A 3S6KA 5DM6F 3HHHA 1T0FC 1W4MA 2ZO4A 3I3LA 3P9CA 4M71A 3OSGA 2K9MA 1JUSA 1P92A 2A6HF 2BUSA 2BY0A 2BYVE 4MEYF 1VQKI 1Z8WA 1TW3A 2AQFA 4NGRA 3ECOA 1X1DA 3HTSB 2R5ZB 2V1UA 2KMRA 3OWCA 3PNVA 3GTMJ 1YVKA 5DEQA 3IKVA 3ZMUA 1DU6A 1AA7A 3RI4A 3QP6A 2ZJPF 2EFNA 4M9ZA 2PIZA 3P5JA 4BHCA 4JJXA 1MDMB 2VXKA 3TFYA 4B5OA 3K1PA 3S3MA 4X6AJ 3LSJA 4CUGA 2PR1A 1ULKA 2F2EA 4M74A 5TISC 4OC1A 3IU1A 1RETA 5L3BA 2EZLA 2EBJA 4II3A 1R6RA 2O0YA 1FLIA 1SGDI 1DP7P 4IKFA 2NS8A 3HYIA 4KOVA 1PTQA 1WJEA 1IIDA 2BHZA 3KETA 2K4JA 2BEOA 2IGMA 2H1LA 3OOUA 2FSRA 2N17A 2H6BA 1MSFC 4MBUA 1B8IB 1TQMA 1JTXA 1XOVA 3FSXA 2CXAA 4DW6A 4GCVA 4PK2A 2XDVA 4UXNA 1HSTA 3EC4A 2OU2A 1TF8A 4AMLA 5DV5A 3F3XA 2CU7A 1IYLA 3E7LA 4OIQF 1JQGA 3L1PA 1OCCH 1IGBA 5FKMA 1DU0A 2DA6A 2XIGA 3PSFA 1FSHA 2FBKA 1BA5A 2JDDA 1LVAA 4PJJA 2L0KA 3EYIA 2PJ1A 2F5IA 2WPXA 1YITI 2VIXA 3K1MA 3JTGA 1OJLA 2DFFA 1R5HA 5C82A 2G9WA 2LF7A 3FISA 2HR3A 4LQ6A 3L2QA 1AWCA 1FOYA 1APLC 4K2EA 1Z8LA 2FQ3A 1YMEA 4S0HB 3HXLA 3AG1H 3K70C 2AS5F 4L0ZB 4FD4A 4JX5A 4BU2A 4E6KG 2RAEA 4ZH4F 3CO7C 4BGDA 3WC7A 1PYTB 1VQPI 2CWEA 5M5XJ 4LX9A 2ZEDA 4E7HA 2WV1A 2WUUA 3KFWX 1R3NA 2L7FP 5L3FA 3SQNA 3KY9A 1V0CA 3Q0WA 1PP8F 1YRNA 2Z16A 3S93A 5IT3A 2RFHA 2WY8Q 4KYWA 4M85A 3K70D 2XEJA 1XB4A 3FSYA 1CPSA 2KKOA 2OZ6A 5K5OA 2NU1I 5FKKA 2X1EA 4UCNA 4ONUA 2AFWA 4GGGA 4NC6A 4CCJA 2QSHX 4AM3A 2XF6A 1G8XA 1ZYRF 3IEHA 3IWWA 4AIKA 3CCYA 2FQ4A 2M0MA 3CTAA 2L7XA 3KHZA 3UGLA 1BC7C 1IZ1A 1CQTA 3CP2A 2FE3A 4XM3A 5FUXA 1CG2A 1KZFA 4CYOA 4XPDB 1SD7A 2CSOA 5CBMA 5HNHA 3H0GJ 3CCRI 5JGFA 2PMZN 2XPWA 2A61A 4UUTA 3BLNA 3JRGA 1B87A 4AG7A 2DTZA 4R3KA 4B43A 4UA3A 1J2XA 5GPCA 5DS0A 2CWFA 2R5ZA 1HCRA 4YFNF 3GTGJ 1SMYF 1MNMC 3IAM2 2OTJI 1QSNA 2PMUA 3M9AA 1XPXA 1WKMA 4B3AA 2IRFG 3OYDA 2JA6J 3DBHB 4FUUA 2O3FA 1XCBA 2KL4A 4M6VA 2HZDA 3VOEA 2WC2A 3RKYA 3ZRGA 4GRIA 3FB3A 3S32A 2IGNA 2R7WA 1N71A 2HOEA 2EIKH 1WTJA 4DZPA 3B4VC 1HC8A 3FNCA 1W36C 4YEJA 4IUSA 3FIWA 2N1AB 2HOAA 4PJLA 1WWZA 1KA8A 4IQ4A 2P0WA 1R1VA 2MGQA 2NXNB 2ZSIB 4CYCB 1JGGA 5FGMA 2HS5A 4AVZA 1A31A 4ZDOA 1JUMA 4M3FA 3W2WA 3QOEA 2NU4I 3Q9VA 5D5VB 4PJMA 2E1CA 5E3MA 2PVWA 4RGSA 1I6HJ 1MT1A 1EKEA 1S9HA 3BXMA 4JX4A 3R5AA 2M0CA 3PJRA 2RC4A 4F8ZA 3H5ZA 2Z1DA 3OOPA 1V5FA 2E7WA 4Y3OA 5GAEJ 4FX4A 3E59A 1MMDA 2CH0A 1AOYA 2ZOGA 3CZ6A 2FA5A 2QYOA 2DKVA 2STWA 1UAAA 1WSUA 3DU6A 1ZO0A 1T95A 4P96A 2AFOA 2ZEEA 1U5TA 4UVAA 1YK3A 2Q44A 2DAOA 4UV8A 3RCOA 3V8LA 1AKHB 2O5RA 2C1CA 1BR2A 1LR9A 1LEAA 4E1PA 4I49A 3QWLA 4IHVA 2PVVA 1SAUA 2CQKA 2L5QA 4KN7X 1IG7A 4DOZA 3MWMA 3VSKA 2A4NA 3VDUA 2O8KA 2V1CC 4WP4A 2VI7A 2JRMA 3R95A 3FXMA 5L3CA 5JHUA 2HVQA 4B11A 1EJ9A 2SGFI 4I0BA 4PGHA 4KFCA 1YQEA 4Y49C 1BPMA 1WHUA 1QPMA 3S2WA 1M44A 3EO4A 3T0YA 1U0JA 4C3HJ 2KMPA 3E6BA 4R7MA 3JRCA 4P5OA 2RNGA 2OR4A 1YTYA 4G9YA 4WWCA 3VEPA 3LSMA 4KIGA 4XNHB 1PU9A 2ARHA 2P6SA 2OB0A 3JSOA 2JA1A 2ZEGA 1AN1I 3B8GA 1E2XA 2ZFUA 5IP9J 5CVVA 5E8GA 3JRHA 5IP7J 1ZR2A 3BZKA 1XMTA 1QZYA 2DA2A 2EZKA 2V26A 4PSXA 2ELIA 2RIJA 2R7OA 4MFPA 4DYOA 3IWFA 5D4SA 2HB6A 1Y8QB 4FASD 1XMBA 1J7KA 3SJGA 1Y1VJ 5JLXA 3M07A 1P4AA 1ON2A 1X1PA 2WB1N 4V2GA 3FXLA 4BBSJ 1XBTA 2H5MA 2Z99A 1P7IA 3KLNA 3TDZC 3GFJA 3DSBA 2OQRA 4R57A 1FOXA 2NRAC 1WJ5A 2W7NA 3GF2A 2SGQI 3PB6X 2RQQA 3WGGA 1ZTRA 1IRFA 3BR2A 3G2BA 3DEWA 5FRNA 5J1UA 2L4MA 4CGPA 2V1NA 5J6XA 5H2FC 5LGTA 4A94A 3SFIA 2Y0SA 2P81A 4LQGA 1PJUA 2CYYA 2JLMA 1YE9A 5ELYA 2K9HA 2F6CA 4XRSA 3J81Z 4JZ0A 2C6PA 4S05A 1R00A 4FHTA 2DODA 4BNCA 2JWTA 3RQIA 3OYNA 1M8CA 1Z4RA 2FU4A 2H09A 4UUSB 4NNJA 2M87A 2DBBA 1JWQA 2CG4A 1L3LA 4HZFA 1X4SA 3ZQHA 2QQ0A 2XGCA 1FX7A 3H3VK 1IDYA 4F3QA 4PK3A 1ZG7A 4PQAA 1NHAA 3B02A 4QSHA 3CF5F 1CBXA 4KOTA 2KDZA 3FXQA 4ZJZA 1CSOI 1W7PA 2A5YB 3CP8A 3F9KA 4N4NB 1ACIA 3FJUA 3WT4A 5B66C 1F2OA 4LLGF 3TDUC 4CCKA 5C88A 4Q38A 3DPLC 5J4YA 2J9RA 1IOIA 1R22A 3QOPA 2VRWB 3NRVA 1Z5RA 1Y39A 3GFLA 2GREA 2X6OA 1AHDP 4UIBA 1FJLA 1D0ZA 3W2AA 1OYWA 4FT8A 2HQRA 3OSFA 1VFCA 2V6CA 5KTAA 1S7OA 4BAYA 4L9JA 4Y15A 2HQYA 4KSAA 5A28A 5F46A 3B3WA 1LB2A 2EA2A 3FXUA 2KIQA 4XNHC 1PUFB 4R1HA 2E5NA 3FC3A 1R43A 2AJ6A 2QF7A 2Q4VA 4AU7A 4MY3A 2K86A 2CTCA 1BI2A 2QSFX 1Z05A 2KQRA 5J4VA 1GXQA 2BXYA 4CXFA 4BQAA 2F7VA 3CPAA 4KICA 3NH4A 4RI1A 1AMPA 1JXSA 3GYAA 1CGJI 1V4RA 5GAGJ 2DT7B 1O3TA 2ZNZA 3BPXA 1G3YA 4RAYA 2X48A 3LMSA 3R0AA 4XN0A 2OV7A 3BI0A 4LG0A 4WXDA 5E3NA 2WA0A 4IEJA 5FFZA 3VB2A 2MA3A 3D7GA 3B6AA 3DFGA 1ULMA 4O23A 4D7NA 1YW7A 2F5DA 3H1CA 2V8DA 4IXAA 3KHXA 3BPVA 2K5TA 5FKLA 1SFKA 2F5FA 4FKDA 2R1IA 4HNWB 2MH9A 2VASA 2AFSA 3H5RA 1O3RA 3HRSA 2XSDC 2W24A 4MEXF 1QBJA 5E3RA 2JZYA 3TEDA 5H6RA 4A0XA 2R92J 1YX0A 4HNUA 3F6VA 2BEIA 2ZC2A 2VBXA 2PDOA 3T1BA 1ZELA 4G12A 2CJJA 4QTRA 4IZZA 3KQXA 3IL2A 3EUHA 3E0KA 2OUMA 2DQRA 2POKA 1WJDA 3OYBA 1P0HA 3SJMA 4F91B 2BVMA 2DA1A 1RR8C 2AQEA 3IWZA 5IYDJ 1OCPA 1GT0C 3A2KA 4CCNA 3ULQB 2D4OA 2PJ0A 1I50J 1S5LC 1I3AA 2JRTA 4G8XA 1TTYA 2IT0A 2OPTA 1S20A 5E18F 1UVFA 2AFXA 4MJ8A 4PV6A 2Q51A 3GXOA 1KUXA 1H89C 2XF5A 3K4CA 3KI9A 4KVME 1TUSA 3F8MA 2CNTA 2VEZA 2B58A 1DE4C 3ZMSA 4CDGA 3DPTA 2G0BA 1DGRM 1NG7A 2A3SA 2HDWA 1JKQC 5F09A 2CGPA 1OCZH 3J7AO 5DYMA 1XX5A 5LLQA 3N7ZA 4H6ZA 4F9VA 3OYHA 2NNYA 5E3QA 1S7EA 1J5YA 4FD5A 2FCKA 1TLHB 4UF4A 3ELKA 5K5QA 4NGTA 4KLWA 5HS9A 3L2VA 3I5UA 3H5AA 5FFXA 4BINA 4MCPA 1PP7U 3DF8A 1IW4A 4KN4X 3LAPA 1AKHA 1A04A 4ABZA 3ZN1A 3V7RA 1Q2CA 4O3MA 4HX4A 4A38A 1O4XA 1XE4A 3MZHA 4P4JA 3BCAA 1RNLA 2A20A 3RPUD 4AC0A 3K2AA 1WJBA 2K27A 1G3WA 1LJ9A 5IB9A 2X52A 4E7IA 4UVBA 1EH8A 3T8RA 1FPQA 3TOBA 2EWNA 1FEXA 4ESBA 3FM3A 2VE8A 1DDNA 1XD7A 1FAQA 2ERWA 1ODDA 2VPRA 4NC8A 2EFPA 4OC5A 4A3LJ 1RUNA 4EJWA 3MKLA 1HPTA 2PQ8A 1LKXA 1OBRA 2ZEHA 1BOBA 3OXLA 2E1MC 4M6YA 2BY1A 2YUUA 3BI1A 3EYYA 3H9QA 1FZPB 1ZQ3P 2V6EA 2XGXA 4DYCA 4JYWA 2JJ7A 1YS6A 5C3EJ 1ZGAA 4GYIA 1Y9WA 2ESNA 4HOBA 3SXOA 3ABLH 6CPAA 4G6DA 2R5YA 1H9TA 4S04A 4C2UA 5D8KB 1SD5A 2OJED 3LFKA 2CFXA 1P2FA 3A0HC 4HEA2 1TWGJ 2ZKZA 3S9NA 1R71A 2REEA 3S1RJ 4JLYA 3RZOJ 4HDVA 5L3EA 1VQ4I 2JBKA 5ILSA 2VBQA 4M9XA 4D0PA 3Q5FA 4OC0A 3ZPLA 5J8FA 1WGXA 2ZPAA 4I99C 1WH5A 5AG6A 2LNBA 2EIMH 2M1BA 4HV5A 1HDDC 2C6YA 2CNMA 1R23A 3VODA 2ZCWA 3SDBA 4KITB 2ZELA 1T2KA 2CWGA 3HG9A 4YFJA 1YRNB 5E1ZB 4WCGA 3TL4X 5F49A 3ZGKA 3GTKJ 4A3KJ 1HKSA 1DP3A 3OXGA 2QVPA 3DGVA 1XS9A 4Y33A 1QHGA 4CYCA 3K69A 1X2NA 3DCFA 5F64A 1H0ZA 2BL1A 2NVQJ 2LREA 4BHPA 2JSPA 4IHXA 1IUFA 2JN6A 3K4LA 3D2MA 1RFHA 4JWPA 2CUFA 2VQHA 2B9SA 5EBVA 2Q1ZB 2Z9OA 3L2WA 3PB9X 1FNNA 2IGOA 3TC8A 4RAFA 1MH4A 1TKHA 3ONQA 5LRRA 2QQEA 3S9MA 1RIOH 3OVOA 1WI9A 2XB0X 4BXUA 2YNDA 1YO5C 4SGBI 4NGPA 1LUJB 4PGGA 4CA0A 3S8PA 5K8OA 1VQ6I 1WK4A 3FIXA 3B3SA 2Y30A 3UEJA 2RNJA 5HS7A 4XL9A 1R58A 4KLVA 3GB0A 2BOLA 4CH7A 1W3SA 3I9SA 3HH2C 1X3ZB 3LA3A 3KR4A 1EF4A 3DBLB 4LLLA 3S14J 1DS2I 3CESA 1S7KA 3FBNB 4OC4A 4C7HA 1HQCA 5HVFA 3PBEA 1RXTA 3VH9A 1PUAA 2PC1A 3OYKA 3GVAA 2W0TA 3PIPF 2MW8A 1KWMA 2L8EA 4ZY1A 3OL4A 2ICWG 3CCUI 2ZXWH 2DDAA 4KISA 2EINH 2VQYA 4JXQA 4QB9A 2HU9A 4AXVA 5ED4A 2XGEA 4MQ9F 2A07F 1PJRA 4BS9A 2ME6A 2XAGA 3I56I 2PSWA 3K2KA 4A3CJ 3CLOA 1FP1D 3OYAA 4RS2A 1BN5A 5HLHA 3BWGA 2E2IJ 1XGNA 4N4OB 2EILH 3CMAI 1GV2A 4R9MA 1K61A 3VWDA 2XROA 3MCZA 5K7FA 2MD0A 1MMSA 2ZW5A 3TOAA 3OYGA 1X3WB 3BT9A 3GZNB 4DBRA 2MYSA 3S2DJ 2FSWA 1KBFA 1LOKA 1TKJA 4K3NA 4A3MJ 2DN0A 3MEXA 5GPAA 5EGOA 3TKYA 2F5VA 4MNUA 1Y0RA 2PMHA 4PZJA 2Z10A 2KDOA 2XF7A 2CQXA 3LACA 1Y7EA 1ETWA 4KIBA 1KGSA 2IS4A 2P6AC 3B6CA 2O61A 1DS3I 3LSIA 3OYFA 2VE9A 1XG1A 1Y56A 3BLYA 2YQPA 2ODFA 3H92A 4MXUA 2LYCA 4PXEA 5ICCA 1N13A 4NF1A 4EM0B 2Z5UA 1Z9UA 1OYIA 1W36D 4ENKA 3LSHA 1SFUA 2HUZA 2EPFA 3BR5A 4XPDC 2XPUA 2DU9A 4WWVA 1UHSA 5HLTA 2L2OA 4UB8C 2EWBA 2R98A 4AWXB 3TGNA 5CVIA 5E1XA 1YX5A 3L2NA 2Z3YA 4U5YA 1P6RA 5TJJA 3D5SC 3I9V2 4B6ZA 2BVLA 5E20A 5BMZA 2M5XA 2Z3KA 5EMIA 2CV0A 2VZZA 3TO6A 2ROWA 4YU9A 2JQ7A 1VQ5I 4NXYA 2EBIA 2GA1A 2NYXA 3KEQA 1JHFA 1LANA 4IX7A 1V3FA 2GZWA 4Q36A 3HZJA 3OR1C 4M73A 1YW8A 3HJEA 3BG6A 3MMYB 1B6AA 1LFBA 1UMQA 2H27A 1K7UA 1S6LA 1IV6A 2IAIA 1TQIA 2PG4A 4MTDA 3CCSI 1TURA 1U3EM 3GMEA 1E3PA 2YS9A 1W5CC 4ZYQA 2HFHA 3ASNH 1USSA 3OS1A 2V8GA 3IWEA 3CDHA 4L8AA 3BCBA 2O7OA 3KP4A 2X4HA 1Z7KB 2LEOA 3HOXJ 4A3GJ 1R4MB 1OCOH 5BPDA 1TIHA 4TV7A 1YQAA 1W1WE 3P2HA 5DM7F 3PEIA 3CCJI 4MQVA 3OV8A 5DCMB 1I1GA 3N97A 1OMIA 1ITYA 2DK8A 2FD5A 2O9LA 2K9NA 1O7FA 5CPRB 2J8NA 2COMA 4P4FA 2P5KA 1VQMI 1IJWC 1P7JA 3J7YJ 2B4BA 2DFIA 2OH1A 1YW6A 1B9NA 1PVEA 4MI4A 4CGMA 1LDKB 2GXGA 3UFFA 3RO0A 3TCVA 4BJTA 1YREA 2VC1A 3DKWA 3R9FA 2V9VA 3I58A 1KONA 2OQGA 3D68A 1HBXG 1HDQA 1VQ9I 1TC3C 2HTSA 2I8DA 3L09A 4Y17A 3SZGA 2PIYA 3GLXA 3D7DA 4A3EJ 1X10A 5JQ4A 4II9A 3T8WA 4YGOA 3SJFA 1NG6A 2ODDA 4OP4A 1SGPI 3T8TA 3A0BC 5EZHA 2QECA 1X12A 1Z1DA 2B63J 2R7UA 2EO8A 3B73A 1YGHA 3BQZA 1YTPA 1EA3A 1XGSA 3CF2A 2KRFA 5FO5A 1HDPA 1N78A 3E2IA 1S29A 2R8VA 2JDCA 3K0LA 1X1BA 3RTRA 3W6VA 2K3PA 3CDIA 3G3ZA 3LA7A 4BL0B 2WCYA 1R0RI 3I0TA 1QPIA 1T38A 1Z7UA 4NUBA 4KOWA 2X1DA 2QIRA 4BHBA 4XKBA 2H94A 5DUKA 1W5SA 1OPCA 5L3DA 5EZGA 4BEHB 3HOSA 3A03A 1WGCA 2I00A 4MHYA 2GU2A 1MBJA 4B47A 3JW4A 3PFOA 3SFZA 4ENMA 4DGWB 3FKIJ 4RM2A 4KSFA 1IXSB 4CHUA 3FECA 1XDSA 2M8GX 1X1CA 2K02A 2M7AA 2YU9J 1S8NA 3QYFA 4DZJA 3BJOA 2R7RA 3UGDA 5AG5A 2JVGA 3ZQ7A 3WC6A 1TL8A 1V5GA 1U8BA 4XKVA 4XLCA 3RNZA 5DS9A 2DB6A 1Z4EA 4DNCA 5JVGF 3PFIA 5K8PA 2IJLA 4NSQA 1R4NB 2GXBA 1B1BA 3FXRA 5DCFA 5C4XJ 1NMTA 2WSAA 1Z77A 2ZEFA 2DJIA 2VC0A 1IY6A 1JHHA 2PJRA 4RA2A 4A39A 3WABA 2WV0A 4P45A 1F57A 3KEYA 2CWHA 1YLEA 1YOVB 2GLOA 2EQRA 1FC3A 3F0CA 1O7LA 1QA6A 2NSMA 3PSIA 4P44A 3EDPA 3PM1A 1ELLP 4IHYA 1N77A 2E34A 2ZJRF 3B35A 4WX9A 3EETA 3I59A 5AIQA 4LGWA 2YX4A 4P4DA 4OOIA 2FL4A 4ZYEA 4F52A 3FDYA 3D3SA 2Q0YA 4B5PA 4HNYB 3KZZA 1SFEA 4J19A 4NB5A 4XKCA 1HLVA 3FWEA 2XSJC 1SGNI 4OIDA 3KCCA 5GCNA 1E3OC 4E0AA 2QKLB 3V7SA 1ZN2A 1S3JA 2KPMA 2W00A 4B6DA 1D1BA 2ZW4A 1GHCA 3BJAA 3FXJA 4MO7A 1HW2A 2B5GA 2W57A 4UNOA 1Y1WJ 1TNSA 4QUSA 3W3CA 3M1CA 2PJPA 4IQJA 3RU0A 3GUXA 3CXQA 3SZPA 4A2UA 3G71I 4L9VA 4Q5SF 1AYEA 2DQLA 2PFBA 3OYJA 3TX8A 3EUHC 2Y9ZA 1D5VA 1Y8FA 1YU6C 3ROUA 3PNYA 1I5ZA 5K7ZA 5F6FA 2IS1A 2Q4YA 3DDDA 2EFWA 2B0LA 3MGDA 3R60A 4ZY0A 5EX3A 4FBEA 2XASA 5DD4A 1NH3A 5TRDA 2CNSA 4XR6A 3R0JA 1RZ4A 5EGOB 4LIVA 4IHMA 1S60A 4U87A 2BUEA 4CRYB 5KK1A 4CYDA 1IN8A 2RV8A 3SXYA 2ZW6A 1MBKA 4ZZDA 1ERDA 2VXZA 3S6FA 4ZGYB 3FMCA 3FMRA 4I6ZA 3B7IA 3WODF 2HQ5A 2ZSHB 3GUDA 4J3GA 3TJQA 4ZYDA 2X3TA 1FMWA 4XLFA 4F92B 4B10A 2VXDA 3GKRA 1NSAA 2Z3OA 4LB6B 2UUZA 4C9YA 4RN7A 4B13A 2EZIA 3FK6A 1R49A 5D29A 1TWFJ 4LK1F 2Q4ZA 3BTJA 3UKGA 5D8NA 2V79A 4ESFA 3ZQCA 2VPLA 3SHFA 3C26A 1BI3A 4LG0B 1Y7RA 4D7MA 1K79A 1IOFA 4IHTA 4IHWA 2WGCA 1S7AA 2Q0OA 2PJBA 1T6SA 4GDFA 1M8BA 3V8JA 5JHFA 2Y9YA 4A2ZA 1IGNA 1QU3A 2D1VA 2K3FA 3B3VA 5D5UB 1HEEA 3RDIA 4AD9A 3KE2A 2LRDA 2NOJB 3VFZA 4XQFA 2L9SA 1Y1BA 4W97A 3ABTA 3I1UA 4P4EA 1BIBA 2EIJH 2VLAA 2F48A 5BNGA 2LBFA 5LGNA 3S1QJ 4BJ5C 1VF9A 5M5YJ 1Z2LA 2V9PA 4A95A 3TTHA 1K4SA 3FYNA 3T9YA 4A5NA 3SDGA 2VOOA 5KVRA 2KCXA 3F72A 1QZZA 2X51A 3QTLD 2HXOA 1MW7A 2QMLA 2M9HA 3ASOH 2CV1A 3CQZJ 5DAEA 5HLGA 2STTA 3NWTA 1ETKA 1ETYA 5HDKA 1FYKA 3RPQA 5CCLA 2Y2ZA 4JBAA 2V7FA 3FMSA 4OLLA 1TWHJ 4HG2A 5A2QK 4OAZA 3SZTA 3BG9A 2GKTI 1I1DA 3H35A 4XBFA 2K9QA 3ZQIA 2LB7A 3H4QA 3JRFA 4N0BA 5FB2A 3TP3A 3UEYA 4KOXA 4QPOA 5IX3A 3M1EA 3FM5A 5EG0B 2UXNA 1T8IA 3I64A 5LYFA 1YX3A 2FMYA 3LSGA 3C2BA 4ON0A 1BOAA 1ULYA 3PB8X 3JRIA 3CD6I 4BQOA 2DPSA 4UEFA 1PYVA 4CAEA 4Y49B 4IK2A 3BTCA 1VIXA 2ESHA 1U5TB 4X2TA 2HDCA 1D0YA 1M1DA 3I55I 1RESA 4YWYA 3B3TA 3TE4A 3CT9A 1TZLA 3D0SA 4B1RA 5HODA 1FP2A 4E4HA 2G9DA 1I39A 1FIAA 5FJ8J 1UZCA 4H0EA 1DPUA 1DGWY 5HNFA 2YNCC 4CCMA 3WGIA 1U8RA 1F4KA 1K4JA 3GYHX 2HZTA 3CMEI 2UXXA 5IPAA 2M45A 4JD6A 3IGRA 2CO5A 5LRSA 3H36A 3RZDJ 3I54A 2LOOA 2BSWA 4MHZA 4A24A 5EEGA 2R7TA 1TGSI 3R61A 3D67A 1W7PD 1YG2A 3WTVC 1YHQI 3PFYA 1FT7A 1NXUA 2CRGA 1IB1E 2FIWA 3F8NA 1JKRC 1UFHA 1FOKA 2E35A 2Q7BA 2VBYA 1D8JA 4OAEA 1IC8A 1HDUA 3N4MA 4BXXJ 2LVSA 3LSKA 3S17J 5K8NA 4A0YA 1HW1A 2YU3A 1BIAA 4BE2A 1IUYA 3VDPA 5HMNA 2HOTA 3HSRA 4EVIA 5IYCJ 3ERED 4AVBA 3KP6A 2MSYA 1K4TA 1ZLKA 2GVIA 4XKWA 3W6XA 1J75A 2Q2EA 3U9GA 3UY5A 1TOTA 1OISA 2PEXA 2V1DA 4UCPA 4CAFA 1QSTA 3LFUA 3KQZA 1TP4A 3LWFA 4HYEA 1X74A 1RI7A 4RM3A 2VKVA 3OS2A 2VZYA 1BBYA 3QODA 2XAUA 4P4BA 4U9YA 2JEVA 3QU3A 1XSDA 5E96A 1D8KA 3K4KA 3MKZA 2NOGA 4H89A 3HKZN 5BOXA 2QM3A 2DA4A 2ZXJA 1QZEA 4IOCF 5F1JA 2W1OA 3OYEA 4QIWN 4V2FA 1ORKA 3KEOA 1NK2P 3HTUA 2QQ8A 2E2JJ 4GO1A 5LEJA 2K7LA 5ILVA 4P9UA 5J1YA 1FYMA 1ETOA 3RKQA 3L2CA 3CUOA 3PL8A 4ZDLA 4RUHA 1I12A 3AAFA 5GADJ 4MTEA 1WJAA 1F2PA 2OA4A 2P5LC 1BPNA 2ADUA 2E36A 2GBYA 3FZVA 2LP0A 3A4CA 4YFXF 2G3TA 2ELJA 4OIRF 4CICA 1OQYA 4A33A 4KVOE 4OIWA 2OVOA 2UVOA 2DPTA 3BR3A 4L5JA 1FOWA 3ZN0A 3H0DA 4ESJA 4WXHA 2J87A 2J8RA 3LNQA 3IIBA 1RKWA 2B7EA 4HA8A 4FETA 4PFPA 4BMHA 4OINF 1OR7C 4UXHA 2VJ4A 3IC7A 4W9YA 2DMUA 2KHMA 2M8EA 1SVMA 1WFXA 2ELHA 4RB3C 3A1YA 1SFXA 1HOMA 2E7XA 1MBEA 2DOAA 3CCMI 1ZLHA 2E5RA 3HM5A 3F8BA 4A6DA 1S5KA 2PJ5A 3S1MJ 2V8HA 4FCYA 2D5VA 1DTDA 5DWMA 4FD6A 2O6GE 4MPIA 3IWGA 5IB0A 5D5WB 5AG7A 5C4JJ 1P9GA 3GY9A 4PXBA 2BW3B 2IS6A 1HKQA 2XPVA 2YNCA 4MRIA 1SGEI 4AUXA 1GDTA 2LY1A 3O8GA 4Z6YA 1Z8XA 4KUMA 5DD8A 2VOPA 2JUCA 4MY0A 1H9GA 2DOFA 1G2HA 4IHSA 2BGCA 3BJ8A 1HSJA 2ZMEC 3DKXA 5E17F 3D2PA 2FNFX 4ONWA 2FE7A 1KQ8A 4IRGA 2DOEA 1ARLA 4Q47A 2O28A 2KIMA 3DR8A 5E8IA 1FTTA 2OZUA 1SVLA 2KLOA 1S7LA 2PJ9A 5M5WJ 3KKWA 5M3FJ 4C2ZA 3P9KA 1X4OA 3SI2A 1LVKA 3G3SA 3JTKA 4HV6A 4JCVE 2KIUA 1X19A 2VI6A 4U88A 4A30A 3V4GA 4JX6A 2IEKA 1BL0A 5B3SH 3WG7H 2JMWA 1D1CA 3OYLA 3L2UA 2BHYA 1LQ1A 3PIOF 2J5PA 3SEKC 1Z0XA 2J8MA 3UOEA 4HNXB 4OVOA 3FEDA 1WKXA 1UFMA 1R36A 1OZPA 2EK9A 2QJ8A 4CYQA 2JZMA 4UEZA 3OYMA 4OC2A 3VDXA 3I4MJ 1KU7A 4UWJA 2E73A 2EFQA 5G1ZA 3NA6A 4HLYA 4IOAF 3CC4I 1ELMP 2VN2A 1WWXA 3KPHA 2K85A 4MHGA 4CZCA 5F0HA 1H8LA 2B0UC 3BR6A 1ZG9A 2FXAA 3DPUA 1VQNI 3AKZA 2F5CA 1M4DA 3IRRA 3ABKH 4CYPA 2IA0A 4A6EA 2OD5A 5EG0A 1JJ8C 2KRHA 3HUVA 2LDUA 3VWEA 3EUKL 1WVRA 2R0QC 2EUIA 3GBGA 3F6OA 4FE4A 1IN6A 3QNVA 3KL9A 4KOYA 5IOYA 3PDNA 3PRTA 2X0LA 1CHOI 5JI6A 2PJ8A 2LC2A 3GZ5A 3C3WA 4I76A 3PP9A 2ABZA 1LPQA 1XGOA 3ZP5A 2ORWA 4BQQA 3LSPA 4ZBGA 1LCPA 4A37A 1SEUA 4OMEA 1I21A 4MHPA 5DUIA 4XPLA 2QGUA 3GOXA 3WU0A 3PUFA 3ZMVA 1KU3A 3OL0A 4LOCA 1FARA 1QQ9A 1JTYA 5HDNA 2WPWA 3DTIA 1Z21A 2QZ8A 3ISZA 1RRJA 5IV0A 4HF2A 4GFBA 2GE3A 1ZK8A 1DUXC 1XMKA 2JXDA 4RAZA 1PUFA 1ZREA 4EJOA 2O8XA 2QCOA 2W85A 4JK1X 1UHMA 2P6TA 1F1ZA 2GA2A 4PCQA 5E3OA 3HPGA 2Y31A 2OTLI 1Y6IA 2HXIA 2PJCA 2R3SA 2ZXIA 2EB7A 3D1NI 2C27A 1LAMA 2RGVA 2DT6A 2F5EA 1WCMJ 3GW2A 1K6OA 3FX3A 1VHOA 3MRUA 3QB8A 1TBRR 3ABUA 2ISZA 5CVUA 1QSMA 1KZHA 3HGYA 3S16J 5BPIA 2WAEA 3UGIA 3KGQA 4R79A 2GLJA 4EJUA 1BW6A 4HPQA 4ZDPA 1R7JA 3CCQI 1RUOA 2ATRA 1LNWA 2KT0A 4FQGA 2IMOA 2Q7SA 4R87A 4AVAA 2V1XA 3IV5A 4NJRA 3O8HA 4C2MJ 1M4LA 1BM9A 3L00A 4C3IJ 3WU2C 4E70A 1YIOA 4W1UA 2DIPA 2XEFA 5THWA 3L9FA 4I02A 1ZG5A 1UHWA 4KJZA 2ZJ2A 2DJNA 5B1BH 3ZCOA 3CCEI 2QSGX 2V8VA 4QC6A 3FBIB 2CS3A 3FHNA 4O6JA 4EM2A 3RYPA 2L9RA 5HS8A 3K10A 4A5MA 2FXFA 4D5CA 3KR5A 8CPAA 1BR1A 2GKRI 1NK3P 2R7XA 5KHDA 1W7PB 3H3ZA 3CMYA 1IF1A 1PUEE 2PLYA 4ZYAA 4F93B 3ZJ0A 4NJQA 3K2ZA 4OAYA 4U0VA 2HYGD 2DCEA 2EVNA 3DTEA 4YIRX 5KCMA 5FVJA 2M34A 2ORVA 3KYDB 3HKZA 1HA8A 4CGZA 4KUBA 2QQDA 3PB7X 1TIQA 2B3UA 3I4NJ 1SGRI 2TRTA 2XHKA 3OIPA 3SJEA 3SEZA 2IL4A 1HF0A 3NH8A 2Z0ZA 1U2WA 4HDUA 1YI2I 2X9DA 1D0XA 3BQYA 1MSEC 4P10A 2ZBKA 2GWRA 3HLPA 1STZA 1XSVA 2M30A 5JR3A 1FIPA 3FX6A 5LYIA 2Y75A 2E19A 3CUQA 4QPQA 4ZZLA 2VODA 3AL0B 5EC4A 2GIVA 1D1AA 2A69F 3MN2A 4UUVA 1WQ2A 3E5QA 2Z2SB 1ULNA 1OCRH 4FE7A 3FEEA 2L4AA 3TQNA 2NAZA 5F48A 1ZLIA 5H84A 2WB1A 3SGQI 4WF2A 2LKXA 1G59A 1B72B 1UVGA 1Y0UA 1ETVA 4UV9A 2MBFA 1P9ZA 1DPRA 2D1HA 1JI8A 5JH9A 1GUUA 1QGPA 1YW9A 2HPIA 4JP0A 4HF0A 4XLNF 4V19K 3AG2H 3WTZA 2JT1A 1Q2DA 5B5EC 1VDDA 2LFBA 2Y69H 5KAFC 4GM5A 4ENJA 5DWNA 4L9NA 5CJ9A 5EYRA 2FNAA 2RREA 4ORFA 1U6GA 2EV6A 1XX6A 2DLLA 2VT3A 3E6DA 3Q0UA 3WE3A 4CRZB 1T39A 4BE0A 1M1EB 1ZGJA 2CIJA 4OKOA 2FBHA 4MGRA 1OMUA 2BW3A 1R1UA 2OF7A 3IH2A 5J1RA 2UZKA 2C6CA 2LG4A 4HQEA 1CP7A 4FX0A 3GCMA 4PXDA 4YELA 3E6CC 5J1QA 2QVOA 9WGAA 4YIIA 4UBRA 4A3BJ 2EV5A 3PO2J 2PMZA 1XF8A 4M3BA 3L7WA 3CDLA 2PBIA 1HJAI 5DCMA 3PQJA 1XJOA 1OYYA 3FBUA 4KORA 1TXRA 3IC1A 3KZWA 3BR1A 3J7ZI 3H9GA 4XOPA 2OZGA 5DDGA 4HNTA 1KUVA 3X2QH 2ISYA 3OR2C 3V7CA 3LSTA 4IL6C 4EVYA 1USTA 2X85A 3S15J 3LL7A 5F1RA 3QPLA 3JSPA 2XKOA 4MFEA 2VQCA 5ICEA 2GXAA 3JTHA 4B44A 2QBYA 2N52A 3BR0A 5H86A 2BO9A 3G8WA 1QNTA 1GHEA 2L02A 2M4GA 1AU7A 1K78A 5CPAA 3QAYA 4MFKA 1XRYA 1Z6TA 3W6SA 1R9TJ 3CJRB 2M7BA 4UFVA 3FK7A 4ZYHA 3GTQJ 4B4CA 3LSRA 2GIZA 2DW4A 2YPRA 3O3KA 5EJCA 3HOUJ 2B3VA 2ZENA 1SD4A 4RGRA 3G4SI 3AL0C 2BV6A 3O2PE 4CAXA 1W4RA 1ZRCA 4MIMA 1Z7LA 5LHHA 4M72A 4KNYA 1SGYI 1Q1VA 4P55A 5IT9Z 4UFXA 2JEWA 2XV4S 2ECCA 1IRZA 2LK2A 2G7UA 2MFZA 1CPXA 3CJNA 2QUFA 2DEAA 4MMOA 1XMXA 3ISXA 4MFJA 4E7ZA 2NNNA 5HDGA 1SANA 3WGHA 2DFHA 3K4MA 2HKOA 4RLQA 6PAXA 2Z3MA 2ENZA 3BG3A 1E0EA 5HLIA 2O53A 4UFWA 1TBQR 2ZEOA 4AYBA 3L2RA 4L0YB 3JRAA 4BDYA 3TP0A 1ARMA 2FUG2 3F22A 3BZCA 2ENNA 3KZYA 5LGUA 4KA4A 1JT0A 4NC7A 4G7OF 3D66A 2REFA 3D7HA 3CPXA 1MJAA 1F5TA 5HOOA 3WR7A 4M9SA 1M4GA 4PSWA 2WWYA 1VGYA 3NARA 3R96A 1LR8A 3CJQB 4CCLA 1UHAA 3ZQFA 3A01B 1XFOA 4E1RA 1X1AA 3BC8A 1UJ8A 4OC3A 3KIOA 4CYNA 2M3AA 4KZTA 1R1TA 1W5TA 2BE5F 3RJPA 4CGNA 5F27A 1QSRA 2BY3A 5FLMJ 2XEIA 4HSRA 3M4OJ 3EQLF 4XLAA 1LFUP 4EWTA 4QVTA 1E3HA 4QBJA 3GX4X 2IP2A 5CYVA 2HVSA 3TW6A 3WHCA 4UVCA 2JA7J 3GO5A 1SAXA 4XSZF 2VL8A 3R1KA 3N05A 4C3JJ 2Q04A 1YR0A 2D4PA 4PXCA 3UR3C 2Y0MA 2X1CA 2E5ZA 3E3VA 4BXFA 1B6BA 4A31A 2HQAA 5TGTA 2TCTA 4A32A 1BR4A 2NU3I 4HKFA 5JPHA 4NGSA 1IXCA 3LMMA 1VI0A 4AVCA 1X4PA 1LE8B 4CGOA 5GP9A 3K6GA 4I01A 5LRGA 5A27A 2VKHA 5F08A 5JLWA 1BLLE 4H6UA 5LBQA 4IPAA 2E1OA 4LD5A 1V1HA 2R7FA 4HSTA 3D4UA 3R9GA 2ZJQF 3G1MA 3G1LA 1XC5A 2LLKA 2A68F 2DXQA 4B09A 2Q43A 4BD9A 1NTCA 1CT2I 2VQLA 5EF6A 1E17A 2P8TA 3EFAA 2IW5A 3SGBI 2CTBA 1ZGWA 4NQWA 3HDDA 2VL1A 4E8OA 4Y13A 1VKCA 4H4KC 1BJZA 2JA5J 2FVGA 1G6NA 3RPUA 3V8KA 4X3RA 2P6EA 3BROA 1FBUA 3TMOA 5ICFA 2V53A 4Z2YA 3G1OA 3EY5A 1H8AC 1TWCJ 1YLFA 2EZHA 1CJWA 4KS9A 1BJAA 3I53A 1DQUA 4I7HA 4NQWB 5LFAA 1JKPC 2GANA 3JRUA 3OIOA 4GYGA 3E1SA 3KLOA 1B8IA 1MZBA 3ECHA 5FKNA 5JM6A 3W6JB 4DYRA 3CJTB 5CQEA 1GVDA 4IJAA 4EV0A 2FRHA 4NGQA 2H8RA 3PNTA 2DDBA 3MQ0A 3M8EA 2L7ZA 1VTNC 5B1AH 3VYTB 2R7ZJ 4ENNA 1HEVA 1EH6A 4P4IA 3ZOBA 4DBQA 1EH7A 1JGSA 5FRMA 5M3MJ 1SGQI 4GXOA 3RKWA 5ILUA 3GTLJ 1LFPA 4BE1A 4KDPA 2PJ4A 2AXLA 2JPBA 1R5ID 3EUAA 4FISA 4G7HF 1WZ2A 3CXSA 3WTWC 3Q9SA 1NSLA 4B8XA 2XUBA 3F5BA 1UG2A 2IA2A 4X5KA 2FBIA 3HPHA 3JUWA 1Z9CA 3RYOA 2LKPA 1PCAA 1F9NA 4U9ZA 2CQQA 5K5RA 4NFRA 1FNOA 1ENHA 2NYQA 4BBHA 3IO1A 3FVLA 2QA4I 4X0GA 4QWQA 3D5LA 2ZEPA 5EDNA 1HW5A 3DQVC 4O5VA 4HX8A 2L9NA 3ZMZA 4XSXF 4E7JA 1YS7A 3E97A 3GZ6A 1JE8A 1FWZA 2KFDA 3BTIA 4Z65A 1MDMA 2PJAA 1MIJA 1IU8A 2G0EA 3H3UA 1O3QA 9ANTA 3FHZA 4E7SA 1PTRA 4KOUA 3ZQQA 1X3UA 5FLXZ 3IFEA 4BDZA 2OC6A 2X6WA 3I4PA 3PUBA 4RMNA 2KMOA 2NS0A 1XEBA 2PX9A 2OOTA 2UWMA 2HV2A 3DLJA 2VJ5A 5D5XB 1RPWA 1IRGA 5F04A 1TBOA 3TW7A 3JRBA 2FNPA 2M5WA 1C0WA 2DA5A 2B4DB 2YX7A 1KMAA 4C2TA 2X7BA 4MCQA 4EMSA 5JHWC 3M8FA 4DJLA 2R7DA 1IDZA 1Z3YA 3WTTC 1JUPA 5GTHC 3I59B 1JJ6C 1VQLI 2HGCA 4AB7A 1J59A 3ZMDA 1ZG8A 3LOCA 5BS6A 1B9MA 4BJ6C 5KTCA 4LJZF 2NVXJ 2CUZA 3BP8A 5D6EA 3BY6A 4EATA 3NE8A 1BAVA 2KIFA 2LTPA 4EEFG 2OCCH 2W25A 3AFHA 2VKDA 1MKMA 5E3PA 1A2ZA 1VHSA 2GFQA 2K5CA 3SI1A 3PQKA 3HL2A 3GLJA 3MKWB 4KMFA 2KMUA 4ZTFA 2QPOA 5ERIA 3WTUC 2A6TA 2IXSA 4G7ZF 1SC7A 3ZZIA 2FT0A 4MHDA 5J3LA 3ERMA 4UHTA 1PCEA 3K9UA 2L01A 1L0CA 3CUQB 2XAJA 2NS7A 5E1WA 5IYBJ 1NUBA 3OIQA 2GOMA 2M2EA 1BO4A 3CO6C 4ZY2A 1SMTA 1V5EA 3MFKA 2KISA 1U5TC 2JYYA 1KYWA 1WRJA 2DA7A 2CW7A 4BY7J 2QLZA 2CW8A 4PUSA 5CVRA 4E7LA 2MH2A 4M6HA 1Q1HA 2HI3A 1YSJA 1FYLA 1POGA 2SGDI 1L0OC 3DLAA 3DU5A 2WYRA 1X2MA 2A6EF 1T08B 1B72A 1PPFI 3RZAA 3I71A 4U0WA 2YSRA 3GTJJ 2VBWA 4HLXA 3OYCA 2PJ3A 4AG9A 2LMDA 1CF7A 3J80Z 4B14A 2I10A 3S2HJ 4YG2F 1QQIA 2W48A 4F9UA 1OLTA 2WAQN 1IRXA 2E71A 5A2QZ 2DF5A 4KVXA 2P6GA 4M3SA 3U1KA 4HF1A 2O03A 5CLSA 5D8LB 1XGMA 4CAWA 4EGYA 5F0FA 5G20A 2EJRA 3UNGC 5FLVA 1FTZA 2BOAA 4EM1A 3C18A 2B8TA 2ZB9A 3CUQC 3LAJA 2YNEA 2ZMEA 3ZXSA 3LODA 1SQHA 1TQPA 5HI7A 1ZG3A 2H1KA 4RAGA 1YJNI 4XRSG 4M6XA 4A3DJ 1RO5A 3D8PA 3LD2A 3ISPA 3FKJA 3F21A 1VZ0A 1CP6A 1N25A 4CGLA 1XTAA 2YUSA 1KUYA 1M4IA 2BZTA 1NE9A 1GLNA 4HX7A 4ITVA 4J00A 1VQ8I 2R7VA 2IA1A 2DMNA 4WK8F 1GXPA 2V4JC 1G3TA 2LKSA 1GYTA 1U9OA 3T5XA 3KYCB 4RLFA 2V1CA 4IRHA 2PI0A 3R4KA 3A9LA 4RB0A 3E5XA 4U0YA 3G73A 5BWAB 5I4MA 3MKYB 4DQ2A 3S9LA 4UCMA 4BBRJ 3CMMA 1Q9BA 2EA4A 3S3OA 1A36A 1Y1CA 1F36A 1WJFA 1UCRA 2NMTA 2L7KA 2B4DA 3S3NA 5K7HA 1MNEA 3JR9A 3HOYJ 1MK4A 4M6GA 2R7SA 3SXNA 1RC9A 1CE3A 4OIOF 1IW7F 2CUEA 3JREA 5LYDA 3HRTA 1T56A 5C44J 4C7IA 3C2HA 3QU6A 3ESWB 3QAHA 3DXJF 2CJSC 4C2XA 1TF9A 1LE8A 4MHNA 3ZMTA 3NAUA 1RTQA 4NGMA 2Q8KA 1N75A 3GTOJ 1YW4A 1MMNA 1HDLA 2ZNYA 2A05A 2WTEA 1I27A 2PCUA 3HBLA 1GVJA 2XAFA 4D1QA 2ZOFA 2D45A 3BOQA 5F0CA 4P9FA 2QQ9A 4I2OA 2DMPA 1SVOA 4ASNA 2HNHA 4XLHA 3F8CA 1P4XA 3MZ8A 1CF7B 4XPKA 1MBFA 1ZR4A 1MJ9A 1U9NA 3QPHA 2M4KA 2EFOA 2EH3A 1VQ7I 3I3GA 3FXOA 1P9QC 4LK0F 4R6TA 1WH7A 1S7NA 1WJCA 3NEUA 1FYBA 2VJIA 4CO8A 2FS5A 4DUKA 1KQ0A 1ETXA 4L9TA 3GLLA 4EGZA 2MG4A 1VHEA 4M3GA 4R8HA 4U7BA 2AFUA 1HKTA 1WPKA 1ZAOA 3LA2A 5E79C 4LUAA 3CXPA 1S7FA 3GTPJ 4HPSA 1XMAA 2AO9A 4I09A 3WG9A 4YIFA 2W4SA 2L54A 1D3YA 2HYFA 3WTYC 2CY2A 4MCSA 3TO9A 5KNLA 3KP3A 2EK5A 3W6KB 1OFCX 2TDXA 3MD2A 4IO9F 4FWUA 1CGPA 2DO7A 4JOMA 1UWYA 3KZIC 2ZW7A 1EE3P 2WADA 3OL3A 4FD7A 4R76A 3C1DA 4EMEA 3VYRB 1IY5A 4Q7AA 2HOSA 3QRFF 2XRLA 3REOA 4M3EA 3CLQA 4GS4A 2Y48A 1Q2YA 1WI3A 1YIJI 3S1NJ 5LHGA 2F8HA 1OKRA 1T98A 3IUOA 4G6QA 4LG3A 1IICA 4RGUA 3FH4A 4EFDA 2OAZA 1CT4I 4JYKA 2DMTA 3SJXA 5LYLA 2A5WA 2WAFA 4PFOA 4AIDA 5E3LA 5HH1A 3RYRA 4L5IA 3IH4A 3SEQA 1ZG1A 5AG4A 4IAVA 2MLKA 1R5GA 2ETHA 1IXRC 1LDDA 3H8EA 1YVOA 3K4BA 2P7CB 2HEOA 4NHJA 4CS0B 3WU1B 3QPSA 4RB1A 1XBUA 2XEGA 5JVTA 2P7VB 2ZFWA 2L9VA 3M8JA 3ML6A 1P4NA 4MFQA 1T0FA 2ECBA 1QRYA 3OWTA 2FF4A 4RGXA 4XN3A 1Y9KA 4NEXA 3TT2A 1ZKGA 2FX0A 2JK3A 3HUGA 4FAIA 2R4GA 4UUSA 1K6YA 2VKEA 3OS0A 1ON0A 3NH5A 1G3SA 4B12A 3QYEA 4KSIA 4HQMA 3WTSC 2G7HA 3VYUB 2R5YB 4NDLA 5CCMA 2Y0SN 1F43A 3HOVJ 4XOTA 3PGPA 4XICA 4GI3C 2NVYJ 4P6YA 2F4OB 1QO0D 4I0AA 3BJ6A 2OCEA 3OMYA 3BJIA 2L7MP 3K9TA 3V7ZA 5J47A 4OADA 2E60A 4LITA 5LRKA 1D5YA 4NBQA 1TNTA 2HDDA 3JCUC 2FMLA 4LFUA 3RKXA 3IP4B 4A0ZA 1P4WA 1CT0I 3BHXA 3HOZJ 2UZ3A 4PPZA 1ZRFA 4C68A 3OYIA 4Y52J 5IP6A 1MGTA 2XAQA 2RN7A 3IU2A 2BBYA 5FROA 2K9LA 3DEEA 2PJ6A 3D7FA 4L18B 1KU9A 1ZRDA 2KRCA 1ZLJA 4D5FA 3DBRB 1I1SA 1OR7A 4RDUA 1IV8A 2HKXA 3J80K 3B3CA 1BC8C 3CZXA 3P7NA 7WGAA 2LR8A 4N9IA 3CC7I 2X6XA 4OU0A 2K4BA 2Q2EB 2VB6A 4XK4A 3BTLA 3PO3J 2ZXHA 4AYBN 2HYJA 1IN4A 1A5JA 5J8CA 2YGWA 7CPAA 2FOKA 3VATA 2V77A 1IAWA 4R8FA 2SGPI 2PJ2A 3QQAA 4CAVA 4UB6C 3JAMZ 2KCWA 1OYVI 2XGDA 3WC5A 4AIHA 4YRHA 2O4HA 2XVCA 3N5FA 1VNDA 3MVPA 2ME0A 1QHHD 1IO2A 4LMYA 3ZQGA 4BKXA 3ABMH 3J7AY 2QEXI 2DPUA 1MBGA 2UV1A 4M6IA 2XKPA 3R9EA 2QQBA 2WVJA 4BQNA 4PJ0C 3SHPA 1YJWI 3BG5A 1Z91A 3AG3H 3OXFA 2FOWA 5H20A 1QVTA 5DTDA 4ZYGA 2AE6A 2J5OA 1Y0NA 3IRQA 2IBDA 1QSOA 2CFOA 3VE5A 5AIPA 3GIUA 4NCZA 3VARA 2DK5A 4HGUA 1XIXA 2QQAA 4X8IA 1RR7A 3BZ6A 3U2RA 2BY2A 4Y7NJ 3FXKA 3VWBA 1ZH5A 2Z3LA 2PRQA 1Q7LA 3BJ7A 5KTDA 4L5EA 3M7GA 2LH9A 5HVHA 4LIUA 2R93J 3CXLA 4X1EA 3Q3SA 3JAMK 2GQQA 2RB7A 3GFMA 1TBXA 4DIQA 2KMQA 1IYKA 2RVCA 3DKYA 4Y4RA 3F0AA 2QWWA 4AIJA 1RKTA 2KZGA 2F3CI 3R5CA 3H8GA 1QVUA 3H8FA 4PDKA 1WGTA 2DPDA 2ELKA 2ACJA 2JA8J 1OVOA 1K7VA 1Y0YA 3PZJA 5JFRA 2XAHA 5CNPA 1TT0A 2ARPF 4J01A 4IVNA 4QLCU 4ZTJA 4A3JJ 1Z2IA 2W84A 3HB9A 3PB4X 3MAJA 4EQQA 3R5DA 2OZHA 1GV5A 2N71A 4UXJA 4ANJA 1J09A 4F0XA 2IQ6A 4BACA 1ONVA 2SGEI 2Z3PA 5ISVA 2HWVA 5GTIC 2PN6A 1O57A 2WBMA 3HOWJ 3A01A 5LRJA 1JT6A 3LQQA 2IS2A 4XORA 4CPAA 2B5GB 4EJTA 1W0UA 3F8KA 2LUYA 2AHQA 2ZXVA 4PJNA 2PJ7A 3VSLA 1LAPA 4RS8A 1U6MA 2XC7A 1ON1A 1FBSA 1U5KA 3RAMA 4BUPA 1BI1A 4D9JA 4UIAA 4HNVA 2W82A 3NWSA 2CF4A 2VT2A 2HTJA 3P2FA 2NU2I 2ANPA 5FUWA 2GLFA 2PR8A 5HVGA 4HBLA 3R5BA 2YR2A 4BY1J 4II2A 4N9HA 5IT9K 2DXIA 2KZVA 4GXHA 2CQ7A 2KP6A 4MCRA 3JRDA 4AVPA 2BXZA 4F7ZA 5AGEA 3V8IA 1VQOI 1K78B 4Q4ZF 3K4NA 1KBEA 5FUVA 4E7KA 4H2KA 4FTHA 5HQ8A 3Q0VA 5I0CA 2VBZA 2NU0I 2VJJA 4JQFA 3TBIA 3U1DA 1A35A 4CSWA 4KMUX 3HUGB 5G21A 2CUJA 2HQNA 5HXDA 1EV7A 3C2GA 2V9KA 1Z3XA 4WXCA 3C7JA 3FXTA 3V38A 2XB5A 1LR7A 2EV0A 2COBA 2JA2A 2LBFB 3EPZA 4OMYA 5K1YA 1XA6A 4IRIA 2HC9A 4U7DA
chains in the Genus database with same CATH topology
1MJBA 1H0MA 2LF8A 4F0YA 4ETSA 5FLXK 3DNSA 4I98B 5LEKA 2JTVA 2VONA 4Q48A 3IKTA 1PDNC 5ICGA 2DT5A 4HW0A 2IPQX 4G94A 2IVMA 1XCVA 2L3DA 4B5PB 2R7HA 2KJBA 3HRMA 4LB5A 4KOSA 4YFKF 4E2AA 3DR6A 3HRUA 3GEZA 3DEUA 3T90A 3FMQA 3KP7A 5LHIA 3GFIA 1O3SA 1FSEA 1IN7A 2D2WA 4KUAA 2P4WA 2GAUA 1KYZA 2RDPA 1G4DA 1B59A 1XSXA 3KP2A 3HIFA 1YFHA 3F23A 5EEHA 2QENA 1LRZA 2MLGA 2Z33A 1YYVA 3K1NA 3HSFA 1FBQA 2KJCA 4KIFA 4MFLA 1XDUA 4RB2C 4OIPF 3J81K 5BQTA 3IHUA 4LLNA 2DTRA 4JXRA 4BYYA 3WE2A 3FRMA 1HXDA 3KP5A 1K7AA 1UB9A 5CVJA 2XRNA 2I79A 4CZZA 4OMZA 3TO7A 4MFZA 3DP7A 2QBYB 2ZMEB 3RIRA 3COAC 1SD6A 2LSOA 1MD0A 2OBPA 4XRFA 3GWZA 1LEBA 1FT9A 4L89A 1ZHFA 1IN5A 2P5VA 1TW2A 1Z6RA 3MZYA 4EJVA 2E1NA 4KT5C 3F8FA 4F6AA 4HAMA 3O6BB 3P9IA 5F47A 2Z11A 4C2YA 3HSEA 4IF5A 1LDJA 1XN7A 1R57A 3BDDA 5D4RA 3WTXC 2H6CA 1J0RA 1B4AA 2DI3A 1S3ZA 2FIAA 1KQ9A 2MC3A 1J4JA 3R6SA 2RQPA 1I6XA 4R3LA 1ZARA 5H6QA 1J9IA 5FD6A 3EXNA 4K30A 2MD5A 5D6FA 5FD5A 2CW0F 5HVQC 2Z3NA 3HOTA 4A12A 3S6GA 1KU2A 3NE7A 4XLPF 2FEZA 2G3AA 2JSCA 3W91A 5L3GA 2RKHA 2JPCA 5AONA 3LQRA 3JVNA 1BI0A 2P6FA 2PRBA 3QPTA 3E5UA 3E6MA 1REPC 4UWIA 3FF5A 1U78A 5G22A 1CM0A 3HHGA 3NQOA 4IF4A 1FY7A 3DV8A 3QP5A 4BH9A 3S6HA 3S6KA 3HHHA 1W4MA 2ZO4A 4M71A 3P9CA 2A6HF 1P92A 2BYVE 4MEYF 1TW3A 3ECOA 3HTSB 2V1UA 3OWCA 1YVKA 5DEQA 3IKVA 3ZMUA 3RI4A 3QP6A 2EFNA 4M9ZA 4BHCA 4JJXA 1MDMB 2VXKA 3TFYA 4B5OA 3K1PA 2PR1A 2F2EA 4M74A 3IU1A 5L3BA 2O0YA <