3TO7A

Crystal structure of yeast esa1 hat domain bound to coenzyme a with active site lysine acetylated
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
276
structure length
275
Chain Sequence
EVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histone acetyltransferase ESA1
publication title MYST protein acetyltransferase activity requires active site lysine autoacetylation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 79
structure length 275
sequence length 276
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2011-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3to7A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 3to7A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3to7A02
1HW1A 4AWXB 3R0AA 2JEVA 3DR8A 3V8IA 3CTAA 3SZTA 4KLVA 3TO9A 2B58A 4FD6A 3C26A 1BI3A 5BPIA 5L3GA 4IVNA 3W6XA 4HDUA 3PGPA 2OZ6A 3LA3A 4LB6B 2O61A 3KP7A 1A04A 3CO7C 3WU1B 3R9GA 1R00A 3TQNA 4KUMA 1P4NA 1UFHA 3VFZA 2TDXA 5E18F 3EQLF 3WE3A 4L89A 2IW5A 2EFOA 4M9SA 2XV4S 1J4JA 1MKMA 3ZMTA 1B9NA 4G6QA 2QIRA 2Z10A 3IKVA 3FBUA 5HLHA 1JE8A 4E8OA 1SFEA 1MDMA 1RUOA 6PAXA 2MC3A 4HF2A 2XAGA 4MEYF 2OQRA 2PSWA 1SD5A 2KIFA 4KUBA 2A69F 1R7JA 3F3XA 4U0WA 4KICA 2F5CA 4JD6A 1J59A 3BROA 3D0SA 3HHHA 2WC2A 2XRNA 4UA3A 2C27A 2R7DA 4J3GA 2DBBA 1K79A 4AVBA 2VT2A 1F9NA 3RYRA 1W5TA 3RJPA 1B6BA 3SZPA 1TLHB 5H86A 2EV5A 3ZN1A 3RKYA 2NAZA 2STTA 3MZHA 4U0VA 3H3UA 3MGDA 2E7WA 2EB7A 4M71A 3E6BA 3F8CA 1PP8F 3TGNA 2DXQA 1F5TA 5DWMA 4Y15A 4JWPA 4IRHA 2ARHA 1QNTA 3BZ6A 3ERED 1Z91A 3I4PA 3G73A 1K4JA 2FCKA 3M7GA 1T6SA 3K0LA 2VBWA 1FSHA 3COAC 1KU3A 3LWFA 4UWJA 1BOAA 2Z5UA 3WGGA 2Z9OA 2LDUA 4MBUA 2VOOA 1IYKA 1BC8C 3RYPA 4P5OA 1FYKA 2K5TA 2VE9A 2OD5A 2HUZA 2VXKA 2P6EA 2K4BA 2CY2A 1USTA 1BM9A 5A2QK 3LD2A 4N0BA 3T5XA 4PK3A 2G7UA 2X0LA 4H89A 1J0RA 3ECHA 2BBYA 1QBJA 3DQVC 4HLYA 4A0YA 4KVXA 3EUHA 2ZKZA 1RZ4A 2OA4A 3KETA 2FA5A 2XKOA 3CDHA 1Z6TA 3O3KA 4BXUA 4G94A 1DUXC 1TBXA 3KEOA 3RYOA 4RGXA 5DYMA 2V1DA 2Q44A 2FIWA 3N7ZA 4XSXF 4AG9A 4RB0A 1IF1A 4KN7X 2G7HA 2Y0MA 4EGZA 3F8NA 1T39A 2ZNZA 5D4RA 1Z4RA 4N9IA 3WTVC 2YU3A 3FZVA 4A0XA 4RGSA 4NB5A 4AIHA 3VODA 1H0MA 4G8XA 4M72A 3LAPA 2A6HF 2C6YA 1YW9A 2HEOA 2FSWA 2CNSA 1WSUA 3TT2A 2JTVA 2IJLA 4KN4X 1FYLA 1R1VA 1REPC 2ADUA 1M1DA 4FD7A 4NEXA 4A2UA 3SQNA 2Z33A 5F1RA 2EJRA 4RGUA 4CYDA 3SFZA 4XPDC 5JHUA 2VBXA 3HRSA 5H6RA 1FOKA 1CF7B 4Y49B 4IRIA 2Q04A 3T0YA 1IXCA 5H20A 1ZG1A 4MTDA 2H09A 3IL2A 4BAYA 1OMIA 3QB8A 1QZZA 2L4MA 4EJWA 5ILUA 4RB1A 4YFNF 1UFMA 5KK1A 3SXNA 2BUEA 5F64A 5K5QA 5D4SA 4L8AA 2BEOA 3SHPA 5K1YA 2ZW5A 2X7BA 1STZA 5DD8A 4BYYA 1KUXA 3E5QA 4HX4A 1LDDA 3RI4A 1E2XA 2XAFA 3KLNA 1V0CA 2D45A 2VE8A 3ECOA 3QPTA 2R8VA 4OAEA 4QWQA 4KVME 3MQ0A 4GYGA 1BIAA 1FX7A 2HYGD 2EWNA 1U6GA 1QQIA 2HV2A 5IX3A 1U3EM 3T90A 4M9ZA 3LAJA 1S7AA 4NCZA 5F47A 3K1MA 1OYYA 2LF7A 2ATRA 5DUIA 3G8WA 3MAJA 2K4JA 5LBQA 3JSOA 3CUOA 5DV5A 3V7RA 3IWZA 4U7BA 2FF4A 3I5UA 3ZN0A 4R57A 1K7AA 3L00A 2J5PA 5IT9K 2FOKA 3LA7A 4YIIA 2DK5A 4L9JA 1DPUA 1Q2YA 5K5RA 2RNJA 3D2PA 3I54A 4AD9A 2B3VA 1YFHA 1S7KA 1KA8A 5AONA 4HYEA 3EY5A 4KIFA 5TRDA 1FY7A 1G3SA 2K86A 3LA2A 4OINF 1FBQA 1PUEE 1MDMB 5CVRA 3LQQA 5HLGA 2ZFWA 3T1BA 2ESNA 4XPDB 3GXOA 4KNYA 2D1VA 3ZMUA 2IRFG 1LB2A 2Y48A 4GGGA 1E17A 4EVIA 1IYLA 2R7FA 1Q2DA 3JTHA 2IA2A 4LLLA 3LSTA 4XSZF 4EM1A 4RB2C 5FLXK 4MQ9F 2OZUA 3KP4A 3H4QA 3W6SA 3REOA 1XCBA 4JK1X 2NNYA 4U9YA 2YSRA 3JTGA 4U88A 1QO0D 2BYVE 1BC7C 5C88A 3DXJF 3WTWC 2G0BA 2P6GA 5BMZA 3N97A 3RTRA 1S60A 3V7SA 2RDPA 4ENKA 1FZPB 3NE7A 1GVJA 4LJZF 3KEQA 2XVCA 4RI1A 4PSWA 3O6BB 3ZMVA 3D5LA 1D8JA 3TTHA 2FIAA 4I01A 2K27A 3S6KA 5LHGA 3WTYC 5TJJA 2EA4A 4KLWA 4WX9A 5IV0A 1W7PA 4HA8A 4QUSA 2PFBA 1U2WA 4PGHA 2DAOA 1YGHA 4QC6A 2DQLA 2LSOA 1TQIA 1XMKA 2DLLA 2P5LC 3P9IA 1R5HA 4KOVA 4RAYA 1G4DA 2PN6A 3T8TA 2CO5A 1QZYA 3G3ZA 2HKOA 4A5MA 3CJNA 1GHCA 2D1HA 1HW2A 1XGNA 3TFYA 2QMLA 5DDGA 3FIXA 4KIBA 3MEXA 4M6XA 1ZLKA 1YTYA 4R87A 1WWZA 1P6RA 3ZMZA 2EVNA 3FNCA 1HXDA 4OLLA 1EV7A 3GYHX 3RKWA 1R58A 4IRGA 3DDDA 5HOOA 2F2EA 4FHTA 1WWXA 3B02A 3J81K 4ETSA 4BQAA 2AE6A 3DPTA 1YYVA 3KP3A 4I7HA 3R60A 3KP5A 3E97A 4RB3C 1JHFA 3ML6A 3O2PE 5F48A 3R9FA 2LF8A 3T9YA 2J8MA 3LODA 2PJPA 1KQ9A 4RS8A 4UNOA 5ILSA 1R57A 2XIGA 4ORFA 2IPQX 1RI7A 2QWWA 2PG4A 2ZPAA 3TOBA 2QVOA 2XGXA 1CGPA 3R6SA 4KOXA 1V3FA 2YPRA 4CRZB 5JR3A 2EUIA 3EXNA 3F23A 2XUBA 2B5GA 1P4AA 1ZN2A 1IN7A 3C18A 5E20A 1P0HA 4F6AA 2ESHA 4M74A 5KTCA 1VHSA 3BP8A 2VC1A 4A6EA 5FFZA 4CICA 1XB4A 1SFXA 3D8PA 2ZXJA 4ENMA 4PV6A 4AVPA 1IZ1A 2O3FA 2QQBA 1W4MA 5DUKA 3F6VA 1FWZA 2DO7A 3W6KB 4WWCA 5D5VB 4YFJA 2B3UA 2MA3A 2RV8A 4R3LA 3ZP5A 1LDKB 2M45A 1MJ9A 4CAWA 3Q5FA 4LG0A 4NQWA 3FXTA 1LEBA 1U6MA 5F6FA 2A6EF 4CDGA 1OPCA 4M3SA 2P7VB 4PSXA 2GQQA 2HGCA 3WTUC 1ODDA 2XROA 1IXSB 3M1EA 3R61A 4M85A 1AOYA 4KOUA 3VEPA 2H27A 1Y7RA 1USSA 2R3SA 2E1CA 2IP2A 3H92A 2QQ9A 1EH8A 2O6GE 4R79A 4HV6A 2O8XA 5D6FA 1G6NA 4BH9A 4AG7A 4B09A 4G6DA 3WTZA 4ZYGA 3SXOA 4RAZA 5DEQA 4GXOA 1FYMA 5JI6A 3DEUA 1WQ2A 4II9A 3F8MA 4ZZLA 2V1XA 3GFIA 4ZZDA 2LNBA 3L2CA 1D3YA 5D5UB 3SHFA 2VOPA 4PCQA 4P9FA 2HR3A 2OZHA 3QRFF 1D8KA 2P6FA 2GA2A 3JVNA 1NHAA 1OKRA 4PDKA 3B8GA 4MI4A 4XBFA 3HTUA 1DPRA 1ZYRF 1XN7A 1I21A 4IF4A 5KVRA 2XHKA 2F5IA 1B9MA 1ZG5A 4WCGA 3I53A 2P6TA 4AIKA 2MLGA 2PQ8A 2V9VA 2F5FA 3U2RA 3HSRA 4A5NA 2KIUA 4CRYB 1RIOH 1T2KA 1K6OA 2WPWA 2DW4A 4HF1A 3VWDA 1HKSA 3MCZA 4HV5A 2QQAA 1SD4A 4EM2A 2G9WA 4P55A 2PC1A 4L5IA 1S5KA 4I09A 4CXFA 2ZW4A 4WXDA 3Q9VA 3JW4A 2F5DA 4ON0A 5LGNA 1YVOA 2FBKA 2Q7BA 2IA1A 1SAXA 3QPHA 2PR1A 1GXPA 4LD5A 1M4GA 4UVCA 1QSOA 3GLXA 5L3DA 3V8JA 1PUAA 5F49A 2A5YB 3P9KA 4OU0A 3F6OA 3AAFA 4B5OA 4NHJA 1Z05A 2FE3A 3RKXA 3HRTA 1R23A 1XMAA 3WE2A 2Y75A 3ABUA 4H6ZA 4XPKA 5ILVA 2I79A 4JQFA 2RKHA 2FXFA 2R1IA 2JDCA 3HSEA 3FRMA 3S6HA 3R96A 1Z6RA 2VONA 3TO6A 2WPXA 1W7PB 3JUWA 1TW2A 1IW7F 3KFWX 4HNXB 2P7CB 5CYVA 3ABTA 2P6SA 3K9UA 4H6UA 4I0BA 1J9IA 4LB5A 3FM3A 1ZRFA 5CNPA 3GUDA 2EV6A 5LRSA 2D2WA 1G3WA 5AIQA 5HDNA 4M6YA 5FB2A 2GZWA 1QSRA 4ESBA 5E96A 4EJUA 2JZYA 2M1BA 1XSVA 2PEXA 3EC4A 1I6XA 2OU2A 4I02A 1FC3A 5HS7A 2I00A 2WV0A 4M73A 1IRGA 1HKQA 3JAMK 2VC0A 4BHCA 2BEIA 2PMHA 4KIGA 3RIRA 1YQAA 5JFRA 2J8NA 3CLOA 3MWMA 1HW5A 2BV6A 4KOSA 1R5GA 3JSPA 1I1DA 3QOPA 4UHTA 2D4OA 3OWCA 1S6LA 3FXRA 4MTEA 2VI7A 4R9MA 2REEA 1LDJA 3I59A 1B4AA 5CVJA 2GXBA 2JRTA 4LFUA 5H6QA 2L3DA 2HDCA 3BPVA 4EM0B 4ZYHA 2FXAA 1S3JA 1Y0UA 3R0JA 5D5XB 2REFA 3ULQB 4LLGF 3E6MA 4JXQA 3GEZA 2CQKA 2B5GB 4MY3A 2VT3A 4MHDA 1SD6A 1G3YA 3GWZA 1P4WA 4G7OF 3DSBA 5GCNA 2Q8KA 1PU9A 3GZ5A 1UB9A 2Q0OA 3QU6A 1QSTA 1B59A 4HNYB 1W7PD 1B6AA 2FBHA 3KLOA 4YGOA 5CVVA 3P9CA 1T98A 3TOAA 2BSWA 3BLNA 2H6CA 1YR0A 2LKPA 4ZYDA 4KZTA 2BL1A 3W91A 2GIVA 3CXPA 2R7HA 4AB7A 3BJAA 2W24A 3IKTA 2VBZA 2OZGA 2ZJ2A 5L3EA 4GYIA 4UVAA 4EJVA 3P2HA 4E2AA 1XDSA 1J75A 2H5MA 3QAHA 4WXHA 1CM0A 4LG0B 3IWGA 4I98B 5HVQC 3D3SA 4MQVA 2ZCWA 5FO5A 5HS9A 1M4DA 1FPQA 1JGSA 1XGSA 1ZH5A 2FL4A 3FWEA 4N9HA 4HW0A 2PMUA 3N4MA 1KGSA 2MD5A 3G3SA 4HF0A 1O7LA 3E0KA 1YVKA 4O3MA 5D6EA 1G3TA 1KUVA 1XF8A 1T38A 1TNTA 4ENNA 4HDVA 1BJAA 2Q4YA 2K02A 3F8BA 4L9NA 2CWEA 4A0ZA 5IT9Z 4KVOE 1M44A 2Z0ZA 1DDNA 3VB2A 2Z11A 1V4RA 3IC7A 3RDIA 2GA1A 2RQPA 1SQHA 2BGCA 3ELKA 3KP2A 4PZJA 5ICGA 2V79A 3EFAA 1VKCA 5IB0A 2FMYA 5F46A 1IAWA 1P2FA 1Y9KA 2AS5F 2P5VA 3FYNA 1FP2A 1EH7A 1ZARA 2J5OA 4K2EA 3FXUA 1YW7A 3FMSA 3BY6A 4WXCA 1YREA 1O7FA 3R95A 5D8KB 1Q1HA 2HQNA 2FBIA 5E17F 2OBPA 1F4KA 1R36A 5HLIA 2FRHA 2E1NA 2HTSA 3M8EA 5EEGA 3FMRA 5E1ZB 3HOSA 3BJOA 2CG4A 3GW2A 1S7OA 4KFCA 5FLXZ 1KU9A 1LVAA 1YIOA 1IN5A 3HRMA 2RN7A 3V8LA 1P4XA 2PI0A 2P4WA 3DR6A 2ZMEA 2V1UA 1UHMA 3TDUC 3IRRA 4AVAA 4OMYA 1YLEA 3GO5A 3KKWA 5JPHA 2EFNA 1J2XA 3H3ZA 4R3KA 4UUVA 3FB3A 1KQ0A 3BJ7A 2KJBA 1HBXG 2B4DA 3M8FA 3DPLC 3J80Z 1YS6A 2XAJA 1QGPA 2UXXA 3K69A 5E1XA 5LGUA 5HDGA 3WTSC 2XAHA 4MGRA 2QLZA 1MD0A 3FF5A 3CO6C 4A6DA 1TW3A 1OZPA 2M5WA 4YRHA 2FS5A 4MHGA 4EJOA 1XCVA 2O03A 2ZW6A 3KP6A 1Z7UA 1WRJA 3HUGA 1BI2A 1D5VA 1I1SA 4IUSA 3I64A 3GFMA 2EFWA 3I58A 4AVCA 3B73A 4D0PA 4NXYA 4UWIA 2ZO4A 4DNCA 2HWVA 4KYWA 4CHUA 2O28A 2VBYA 2W57A 3WTTC 5EEHA 1KU7A 5FD6A 1OYIA 3HSFA 3W6JB 1RNLA 3CXQA 2L54A 5EBVA 3HYIA 5LEKA 4LGWA 2HTJA 4ESJA 2AJ6A 1W5SA 4Y17A 5H84A 2FU4A 5AIPA 1IN8A 1BI1A 2E7XA 2HYFA 1O3RA 3F8KA 4OOIA 5I0CA 1BOBA 3FM5A 2P0WA 4PK2A 3ZMSA 4GO1A 1J7KA 1O3QA 1LJ9A 4HZFA 3CXSA 2XASA 2RC4A 3OOPA 2FSRA 2O0YA 1L0OC 1ON2A 5LEJA 3F21A 3J81Z 2L4AA 1HSJA 1SFUA 2J8RA 4HKFA 4LX9A 4Q48A 3HTSB 1FLIA 1SMTA 2JT1A 3FXQA 3WG9A 3I59B 1ONVA 4QVTA 3GFJA 4WK8F 2ACJA 5FVJA 1IUYA 2H94A 4ZBGA 4P96A 2PDOA 4CS0B 5ISVA 5ICCA 2QZ8A 2KIMA 1S3ZA 3MZYA 2OQGA 5L3BA 3WR7A 2M8EA 3V4GA 5ED4A 3F8FA 1YO5C 2ELHA 2ISYA 2X4HA 3BWGA 1S8NA 1ZREA 1S7NA 4CO8A 3KZZA 4TV7A 2QBYA 1I5ZA 2PBIA 2HQRA 1YS7A 2DPDA 5CVUA 2WTEA 2FE7A 4FX0A 4E70A 2UZKA 4KOWA 5KTDA 2ZXVA 2IVMA 2NNNA 5LHIA 3S6FA 2FMLA 1ZGJA 4NF1A 3L9FA 1I1GA 4KT5C 2DI3A 4LMYA 1MJBA 2CFXA 5IT3A 2CW0F 1I12A 2VZZA 1XE4A 3IRQA 2CSOA 2JPCA 2HS5A 1YW8A 4U5YA 4UXNA 4Q47A 3PQJA 1S29A 2L01A 2CNTA 4HX7A 3BJ8A 3U1DA 2PLYA 1P92A 4CAXA 1ZGAA 2EFPA 2HQYA 4B8XA 1BO4A 2A3SA 2CNMA 4JLYA 3CUQA 2GE3A 1TQPA 1ZRCA 1XGOA 2DQRA 2D4PA 1M4IA 2VODA 2IA0A 1I27A 1SMYF 2DPUA 1XD7A 5CJ9A 5ICEA 2RGVA 4ESFA 4AIJA 1HQCA 3EYYA 2P8TA 4HOBA 5DWNA 1O57A 1B87A 2HFHA 1U8RA 5LHHA 4LLNA 1ZRDA 5BQTA 4U9ZA 1IN6A 1C0WA 4RGRA 1EH6A 4Z2YA 4JXRA 3HRUA 3L7WA 1RUNA 4ENJA 4Y49C 2M87A 3UY5A 4U0YA 4CAVA 3GYAA 5FFXA 4FD5A 1L3LA 3T8RA 4R1HA 5DD4A 4PGGA 3FHZA 4KMUX 1Z4EA 3KZYA 3EYIA 1K78A 5DCMA 4K30A 1FT9A 3BDDA 4MEXF 2KJCA 3GX4X 4G9YA 4CZZA 5L3CA 2OAZA 2EA2A 2FEZA 2CYYA 1U78A 1U5TC 3K9TA 3KCCA 1WKMA 2QYOA 1ZAOA 2M30A 2ZMEB 5JQ4A 3DFGA 4GS4A 1VTNC 1R22A 2YR2A 3F5BA 5BOXA 5A2QZ 2GWRA 5FD5A 1TNSA 3NEUA 1GXQA 1WK4A 5HMNA 5ERIA 3I71A 4L9VA 2DT5A 3TKYA 3P7NA 4HLXA 2B4DB 3ZZIA 1ZLJA 2ETHA 4BNCA 3ZJ0A 5E8GA 1KQ8A 1L0CA 4B5PA 5C82A 3R4KA 2ZNYA 3FX3A 3DP7A 3BPXA 2KCWA 4KUAA 2GAUA 3IGRA 3WGHA 1FBUA 3GVAA 1RXTA 4CGZA 4KORA 3ZQ7A 4BHBA 3LQRA 3PFIA 1Z1DA 3F0AA 4QLCU 2FQ3A 4UV9A 5BS6A 3J7AO 1TQMA 2QENA 1KUYA 5BPDA 4EGYA 4IF5A 2A4NA 1ON0A 5L3FA 3DKWA 5J8CA 1GHEA 1X3UA 2WWYA 1IXRC 4XPLA 2H6BA 3QP6A 1QSNA 2JPBA 1RO5A 3V7CA 3E5XA 4LUAA 1MK4A 4S05A 1IIDA 4OIRF 1LQ1A 4DQ2A 3TDZC 4XLPF 3NRVA 4L5JA 1O3TA 4Y13A 4WF2A 2IT0A 4KMFA 3JAMZ 1YG2A 3CUQC 3F72A 4Q5SF 2UWMA 1O3SA 4YIFA 2NS0A 5FGMA 4ONUA 3ZMDA 1MZBA 3S6GA 4OIOF 2NYXA 2VN2A 1KZFA 2B0LA 2CGPA 3BJ6A 1FNNA 2VBQA 5DCFA 4I2OA 3C7JA 2GXGA 4G7ZF 2PR8A 4L0YB 1U5TB 2KKOA 2IL4A 4S04A 2R98A 1WI9A 3VOEA 5J8FA 2W25A 3IWFA 1ON1A 3HIFA 3K1PA 1ULYA 4ZH4F 3TCVA 5LGTA 3F22A 1NMTA 1XIXA 4JJXA 4LK0F 4IXAA 3DNSA 1Z9CA 4EVYA 3C3WA 1UHWA 1PDNC 3I3GA 4QBJA 3TE4A 3E6DA 4RS2A 1BN5A 2AXLA 2QM3A 1IICA 2ISZA 2MBFA 5JVTA 4KA4A 4XNHC 5E8IA 2Z99A 2QBYB 3IHUA 3E6CC 2QUFA 3D2MA 2ZW7A 2Q2EA 4IJAA 3HHGA 4O5VA 1XSXA 4I49A 3HOTA 4YG2F 3TO7A 4R8HA 1BIBA 3I9SA 3GY9A 4YFKF 1JHHA 3OV8A 4ZYEA 4IHTA 3I0TA 2K7LA 2XKPA 4KOTA 4OADA 4IHSA 1LRZA 2A07F 4HQMA 2W84A 4X5KA 2HKXA 3WODF 4EQQA 4MNUA 2L02A 1AWCA 2FNAA 2YX4A 5CVIA 5LLQA 1H9GA 2VEZA 3BOQA 4M9XA 2OB0A 3CUQB 2QECA 2A61A 1FSEA 2STWA 2YX7A 3K1NA 2G3AA 4KDPA 1OYWA 2RVCA 4HX8A 5HH1A 5K5OA 1BI0A 4EJTA 5KTAA 4OIQF 5E1WA 5D5WB 1MJAA 2V6CA 5D8LB 1JXSA 4XRFA 1N71A 4IPAA 1FBSA 2NRAC 3EETA 1TIQA 3L09A 2HZTA 2BE5F 3QU3A 3C1DA 1XSDA 3R1KA 3NQOA 2UXNA 1TTYA 5J6XA 1Y9WA 2XAQA 5CLSA 2COMA 3U9GA 3J80K 4H0EA 3QP5A 1Q2CA 1S7FA 3LFKA 3GKRA 4BMHA 1B1BA 3S2WA 4MJ8A 1T0FA 4GCVA 1NSLA 4Q4ZF 1SD7A 2W85A 4HBLA 1HSTA 1K78B 5DCMB 1BBYA 1YK3A 3R9EA 1QPMA 4XNHB 4EV0A 1UCRA 4BHPA 2DFIA 3EDPA 1XDUA 1XEBA 5EC4A 2Q0YA 1J5YA 4EMSA 2VZYA 2ZBKA 4E0AA 3ISPA 2VQYA 3E5UA 1R1TA 1S7LA 4QB9A 2MLKA 2VXZA 1F1ZA 4L9TA 1YX0A 4FX4A 3Q9SA 3RPQA 1NE9A 4P9UA 1KYWA 4OIPF 2P5KA 1HKTA 2EFQA 4L18B 1MGTA 3EO4A 3E3VA 1CJWA 2EV0A 2OH1A 2DK8A 1OR7A 1QSMA 4U7DA 2B4BA 1KU2A 4KOYA 1PP7U 3VWEA 2F5EA 2KRFA 4B5PB 2JLMA 2DU9A 1IB1E 4O6JA 2A68F 2HOEA 1ZG3A 3MFKA 4NSQA 4L0ZB 3DF8A 4F7ZA 4G7HF 1CF7A 4HQEA 4HNWB 4XLNF 3K2ZA 4JBAA 4UV8A 3P2FA 4ASNA 3M9AA 4FT8A 5ICFA 3GFLA 1ZHFA 1R1UA 3PP9A 3GZ6A 2FNPA 3V8KA 2JDDA 1LNWA 3PQKA 5HDKA 3ZPLA 1XGMA 1DP7P 2GANA 2EK5A 2JSCA 1U5TA 1H9TA 3WGIA 3WU0A 2G3TA 2NMTA 2DTRA 1KYZA 5HS8A 4A12A 3WTXC 3ROUA 4FD4A 4I0AA 3GF2A 3KE2A 2FT0A 4HAMA 4F0YA 4UBRA 4YFXF 1IRFA 4MY0A 1FP1D 2MH9A 4LK1F 1YLFA 1IN4A 3SXYA 2Q4VA 1LEAA 2MH2A 4OMZA 1XMTA 5LRRA 2Z3YA 4UVBA 3PZJA 3FMQA 1Z9UA 3RPUA 2PRBA 3DV8A
chains in the Genus database with same CATH superfamily
3K7AJ 3ESWB 3PUBA 1HW1A 2X3TA 5GTIC 4AWXB 3R0AA 3RU0A 2JEVA 4NGNA 3IUOA 3DR8A 3V8IA 1ZELA 2BXZA 3CTAA 3SZTA 3OYMA 3W2AA 1YW6A 3D4UA 3TO9A 4KLVA 3WG7H 2B58A 2YGWA 4FD6A 2E1MB 1CSOI 3C26A 1BI3A 5BPIA 2SGFI 1AKHA 4F9UA 5L3GA 4IVNA 1QMUA 1SVMA 1ITYA 3W6XA 1IW4A 1QU3A 3S8PA 4HDUA 3PGPA 2X85A 2OZ6A 3LA3A 4LB6B 2C6GA 2O61A 2IGNA 3KP7A 1A04A 3CO7C 2AFUA 3RZOJ 3WU1B 1NG6A 2VIXA 3N5FA 2EWBA 3R9GA 3D00A 1TP4A 1F57A 4C7HA 1R00A 3GMEA 3TQNA 4KUMA 2PMZN 1IOFA 1P4NA 1PUFB 1Z3XA 2VPRA 3DTKA 2TDXA 3VFZA 1IDYA 5E18F 4BJTA 2L7XA 1UFHA 4ZX8A 3EQLF 1TZLA 1TURA 2PJRA 3WE3A 1ACIA 1AU7A 4UFXA 3OYCA 5FRNA 4L89A 2IW5A 2EFOA 4M9SA 2XV4S 1V5FA 1J4JA 1MKMA 4CYNA 4E1PA 4FAIA 3ZMTA 1WVRA 1VHOA 4PJNA 1T0FC 1B9NA 2ROWA 3RO0A 4G6QA 4OVOA 5EZHA 4M3FA 2JA1A 2QIRA 2JA2A 2IEKA 3IKVA 2Z10A 5HLHA 2BHYA 5IYBJ 3FBUA 3AL0C 1FIPA 2H8WA 1JE8A 4PXCA 4P4EA 4E8OA 1SFEA 1MDMA 1RUOA 3PEIA 1K7TA 1WCMJ 2PRQA 4IHMA 2QKMB 2MC3A 6PAXA 3QAYA 4HF2A 1RETA 2XAGA 3I1UA 3IH3A 3PNTA 4MEYF 2OQRA 1Z8XA 2ZFUA 3LFUA 4DW6A 2PSWA 1SD5A 3FXMA 2KIFA 3TW6A 4ZY2A 4C30A 2PCUA 1XRYA 1NTCA 4KUBA 2A69F 1R7JA 3F3XA 3BR5A 2KPMA 4U0WA 5GADJ 2JJ7A 4KICA 1VQ7I 2F5CA 4JD6A 4Q7AA 2Q2EB 3A01B 3GTOJ 1J59A 3BROA 4XLCA 3D0SA 1B8IA 3LSJA 1M1EB 3HHHA 2WC2A 4HNVA 4C2MJ 2XRNA 4UA3A 2C27A 2R7DA 5E3MA 1CT0I 4J3GA 1V55H 3VDUA 2DBBA 2HQAA 3MD2A 1K79A 4AVBA 5M3MJ 2VT2A 1F9NA 1V1HA 3PRTA 2JUCA 3RYRA 1W5TA 3RJPA 1B6BA 3SZPA 1TLHB 3VYTB 3ERMA 5H86A 1IU8A 4B3XA 2EV5A 2XGCA 3CQZJ 2Q4ZA 5FKKA 3ZN1A 3RKYA 2XF6A 4F52A 3UGLA 4M3BA 2NAZA 2LRDA 2STTA 3MZHA 1JT6A 2VQCA 4U0VA 2CUFA 3H3UA 2NU4I 2E7WA 2EB7A 2ELJA 3EPZA 4M71A 3MGDA 3H9GA 3E6BA 3H8FA 2WAQN 1TXRA 3F8CA 3LNQA 3K70D 2DT6A 1PP8F 4IEJA 2NU1I 3TGNA 2GIZA 1BPMA 1OR7C 2DXQA 1F5TA 5DWMA 4Y15A 4JWPA 2J9AA 5CQEA 4IRHA 2ARHA 1QNTA 3BZ6A 3ERED 3SGBI 4DOZA 1Z91A 4NC6A 4NNJA 3I4PA 1VIXA 2NSMA 4QSHA 3G73A 1K4JA 2FCKA 3M7GA 1T6SA 3D67A 1MBKA 1SGDI 2EBJA 4F9VA 2R7XA 1U9OA 3K0LA 4Q36A 2L7ZA 2VBWA 1UHAA 1FSHA 2QSGX 3COAC 3KZIC 3KL9A 2V8VA 1KU3A 3LWFA 4UWJA 3JRCA 3OS2A 3B4VC 1CP6A 2IJZA 1BOAA 2L9RA 2Z5UA 3WGGA 1IV6A 2Z9OA 1PCEA 2E2JJ 2LDUA 4MBUA 3BJIA 4AVZA 1MNMC 1V1IA 3LACA 3JTKA 2VOOA 1IYKA 1O4XA 1BC8C 2EK9A 3OYBA 3RYPA 4I6ZA 4P5OA 1SC7A 1FYKA 2K5TA 1FTTA 2VE9A 1MBHA 2OD5A 3AFHA 2HUZA 2P6EA 2VQLA 2VXKA 3H35A 2K4BA 2CY2A 2XSJC 3HEFA 4BDZA 4V19K 3K2KA 1YRNB 4L5EA 1USTA 2OUMA 1X2NA 3OWTA 1FEXA 1Z7LA 1BM9A 5A2QK 4D7NA 2JA5J 2CV2A 4N0BA 4PJLA 3T5XA 3LD2A 5LYIA 1SGPI 3BTCA 4PK3A 2G7UA 3PO2J 2X0LA 4XONA 2NOGA 1XFOA 2Q1ZB 4H89A 1J0RA 4RLFA 3ECHA 2BBYA 1QBJA 5DTDA 3DQVC 4LIVA 4A0YA 4HLYA 3EUHA 4KVXA 4OC4A 1T33A 2ZKZA 1RZ4A 1K6YA 2OA4A 3KETA 1APLC 2FA5A 3TP0A 2XKOA 3CDHA 1MIJA 1Z6TA 3GZNB 2CW7A 3B6AA 3O3KA 4BXUA 2ZEHA 3EUAA 3H3VK 4G94A 1DUXC 4E7LA 2R7TA 5LYFA 3AL0B 1TBXA 3KEOA 3RYOA 3FXJA 4RGXA 2KMRA 5K8OA 5HNHA 3C2BA 5DYMA 2V1DA 5J40A 2Q44A 4KSAA 2V8DA 3CCVI 3V7ZA 1X1AA 4XOTA 1T8IA 2FIWA 3N7ZA 4XSXF 4AG9A 4RB0A 4WWVA 1IF1A 2QF7A 1SANA 4KN7X 5TISC 1LCPA 4W9YA 2CJJA 2JYYA 3FSXA 2G7HA 2Y0MA 3G71I 4EGZA 1NUBA 2JBJA 5EX3A 2WY7Q 2DA1A 2X48A 4BEHA 3CCJI 3F8NA 2DMNA 1T39A 2ZNZA 3DLLF 5D4RA 1OLTA 4XIDA 1Z4RA 1ZLHA 1NK2P 4N9IA 1WKXA 3WTVC 2YU3A 3SDGA 5EX0A 1XG1A 3FZVA 4A0XA 4P4DA 2VI6A 4RGSA 4NB5A 4AIHA 1BAVA 3VODA 2JVGA 4G8XA 4M72A 3LAPA 1H0MA 1DTDA 2PJBA 4BE0A 2A6HF 2C6YA 1YW9A 2HEOA 2PIYA 1EKEA 3ISXA 2FSWA 4A33A 2QGUA 4F92B 2HVSA 1X10A 1Y8RB 3TL4X 1WSUA 4A24A 1BA5A 2CNSA 1N78A 4ZTJA 3TT2A 2AXTC 2JTVA 5K7FA 4DYQA 1BR4A 1Z8TA 3K2AA 4XLHA 2BY3A 1HDQA 1PJRA 2IJLA 3OSGA 4KN4X 3SJGA 1FYLA 1R1VA 1U0JA 2ADUA 1REPC 1M1DA 5ELYA 4FD7A 4FQGA 4NEXA 1YMEA 3A1YA 4A2UA 3TP3A 4FKDA 4IHYA 2HI3A 5HNFA 1Z7KB 3SQNA 1NH3A 3BQYA 2Z33A 5F1RA 1AUGA 3BZCA 2EJRA 4AXVA 2M9HA 5FUVA 3I55I 3SI1A 4RGUA 2M7BA 1CPSA 2GU2A 4CYDA 5HODA 3SFZA 4XPDC 2Z3MA 2N1AB 3UEJA 5JHUA 2VBXA 3HRSA 5H6RA 1FOKA 1CF7B 2ZJRF 3E2IA 2VL1A 4IRIA 2Q04A 4OP4A 3M3YJ 1Q1VA 3T0YA 2X51A 1A2ZA 1IXCA 2NS7A 5H20A 4NBQA 1F36A 1ZG1A 1R49A 2V6EA 4MTDA 5TGTA 3OR2C 5BNGA 4BE2A 1JKRC 2H09A 3IL2A 4BAYA 1OMIA 4A3EJ 1QZZA 2L4MA 2XPUA 4EJWA 5ILUA 4RB1A 3QB8A 4YFNF 1UZCA 2DXIA 1UFMA 5F1JA 3CMYA 5KK1A 4Y33A 3WU2C 2RIJA 4E6KG 1TBRR 3SXNA 2BUEA 5EYRA 4BQOA 4JYKA 5F64A 5K5QA 5D4SA 4L8AA 4PJ0C 1RKWA 2BEOA 2ZELA 1X19A 4KJZA 4X0GA 3SHPA 5K1YA 1ENHA 1QHHD 2PJ6A 2X7BA 2ZW5A 3A9LA 1STZA 1X1PA 3J7AY 1E3PA 1WJFA 5DD8A 3LSGA 5AGEA 2DPTA 1FARA 1E0EA 4BYYA 4R7MA 1KUXA 1N77A 3RZDJ 2WA0A 1RTQA 3B7IA 3IU1A 2UUZA 2VKHA 2EQRA 1HDPA 1LANA 3LSHA 3E5QA 2YQPA 4HX4A 1PYTB 1LDDA 3RI4A 5LRGA 1E2XA 4MPIA 4XKCA 1X58A 2MYSA 2XAFA 3R5CA 3KLNA 2Z2SB 2PIZA 2H1LA 3W2WA 1V0CA 2D45A 3HZJA 2LEOA 3HKZN 2VE8A 3ECOA 1A5JA 2NU3I 2ZC2A 3QPTA 3H9QA 2R8VA 1MH4A 2QSFX 3QPSA 5CCLA 4FWUA 4OAEA 4QWQA 1DU6A 2ABZA 2ICWG 4KVME 3MQ0A 1CT4I 1VDDA 4GYGA 1HC8A 1BIAA 2EZKA 3VWBA 4IHVA 1FX7A 2HYGD 2GKRI 4MFKA 1D1CA 2EIJH 1D0ZA 2HYJA 4BKXA 2EWNA 1U6GA 3OXGA 2P6AC 1QQIA 2HV2A 5IX3A 3CC2I 1K7UA 4ABZA 1U3EM 3T90A 3OIOA 4M9ZA 1ZQ3P 1KBFA 3SJEA 4XMYA 4AIDA 3LSRA 2XAUA 3LSIA 3LAJA 1R79A 1S7AA 4NCZA 5F47A 3H5AA 5F08A 3K1MA 1OYYA 2L7FP 2LF7A 3I9V2 2ATRA 5DUIA 2R7WA 3FBIB 3G8WA 3MAJA 1ZLIA 2K9NA 2K4JA 3ABKH 5LBQA 3CUOA 3JSOA 4IX7A 5DV5A 3V7RA 1Y6IA 3IWZA 3QODA 4U7BA 4D5CA 1CP7A 2V53A 2FF4A 1BMOA 3I5UA 3ZN0A 4R57A 4G6TB 1K7AA 3L00A 2J5PA 5IT9K 2FOKA 3LA7A 2WYRA 1X3WB 1PVEA 4YIIA 3A01A 2J87A 2DK5A 2CWGA 4UIBA 4NJQA 4CYPA 4L9JA 1DPUA 4W97A 1Q2YA 5K5RA 2RNJA 3D2PA 4W1UA 2DA7A 3KYLA 3I54A 4AD9A 2B3VA 3UNGC 1OCRH 1YFHA 2Z3KA 2WB1A 1S7KA 3FEEA 1KA8A 3EUHC 5AONA 2PJRB 4HYEA 2LKSA 3N05A 3DKXA 1ETYA 3ZR8X 3EY5A 4C2ZA 4KIFA 5TRDA 1GLNA 1FY7A 1G3SA 2K86A 3LA2A 1TKJA 4OINF 4C3HJ 1OCZH 3PM1A 3CC7I 1FBQA 2OV7A 1PUEE 1MDMB 2R0QC 1Z2LA 5CVRA 3LQQA 5HLGA 2QVPA 5LRKA 4CYCA 2ZFWA 1JTYA 3T1BA 5J1QA 4F3QA 2ESNA 2CRGA 1VQ9I 4XPDB 3GXOA 2VXDA 3I3LA 2LVSA 4KNYA 4YU9A 2D1VA 2XDVA 2LY2A 4QPOA 3ZMUA 4YELA 2IRFG 1H8LA 4B3AA 2L2OA 2WAEA 3G6EI 1LB2A 2OCEA 2Y48A 4A39A 4GGGA 1VZ0A 4J19A 1E17A 4ANJA 3DKYA 4EVIA 3RKQA 5LD2C 1X1DA 2WADA 1IYLA 5GP9A 2R7FA 2EZIA 1Q2DA 1YX3A 3JTHA 1B8IB 3HPHA 3PDNA 2IA2A 2Q43A 4LLLA 3LSTA 4OIDA 4XSZF 5E79C 4EM1A 2V4JC 4RB2C 5FLXK 4MQ9F 5JHWC 2XEJA 4E7KA 4PXEA 2OZUA 4IHXA 1VGYA 3KP4A 1T08B 3H4QA 3W6SA 3REOA 5EF6A 1XCBA 4JK1X 4K3NA 4P10A 3S9NA 4RN7A 2NNYA 4U9YA 2YSRA 2QQDA 2M0MA 3M1CA 5IYCJ 1QVTA 3JTGA 2KZVA 4U88A 4YWYA 3GB0A 1QO0D 3D7GA 2BYVE 3IAS2 1Y0YA 4MFDA 1Z0XA 1BC7C 3CJTB 5HVGA 2CJSC 2DFEA 3DCFA 5C88A 3DXJF 3WTWC 5M3FJ 3H5RA 2SGDI 3D5SC 2G0BA 2P6GA 3QQAA 3F0CA 4XK4A 3PB4X 3DEEA 3QWLA 5BMZA 3N97A 3RTRA 4A3FJ 1S60A 3A4CA 4ZYAA 5B3SH 3V7SA 2RDPA 4ENKA 1AHDP 1FZPB 2MD0A 3NE7A 4B12A 1GVJA 3M07A 4LJZF 4BGDA 3KEQA 2GOXB 4UCPA 2XVCA 4RI1A 3FC3A 1X4SA 2Y2ZA 2X6YA 3BG7A 4PSWA 1SGYI 2ZEFA 3O6BB 3ZMVA 3LSPA 3D5LA 1D8JA 3TTHA 3I4MJ 2FIAA 4M6IA 4I01A 4ZDOA 2BY0A 3L2WA 2L8EA 1FT7A 2K27A 2BY1A 3HGYA 3S6KA 2WUUA 1A6IA 2Y9ZA 3CJRB 5LHGA 4IHWA 3WTYC 2HVQA 1BUSA 4CGLA 5TJJA 2EA4A 3G4SI 2ARPF 3LMSA 5J4YA 3R5BA 3JRUA 4KLWA 2DDBA 1OCCH 4WX9A 5IV0A 2DTZA 1Z21A 4F0XA 1W7PA 2DA6A 4HA8A 5AG4A 4NGQA 4QUSA 3IO1A 1SFOJ 2PFBA 1U2WA 1GYTA 4PGHA 3OYKA 2DAOA 1YGHA 4IK2A 2DOFA 1ULNA 4QC6A 3DTEA 2DQLA 2LSOA 1TQIA 4D1QA 4OWRB 1XMKA 2DLLA 2G0EA 4D5FA 3ZQIA 2P5LC 1VQKI 4OC3A 3P9IA 4ZY1A 5HLTA 1R5HA 4KOVA 4RAYA 1G4DA 2PN6A 3T8TA 1ETKA 2CO5A 1QZYA 2KMQA 1RC9A 4ZX9A 2XGDA 3G3ZA 1X2MA 2HKOA 3TJQA 4A5MA 3CJNA 1GHCA 3VYUB 2D1HA 1HW2A 2Z3PA 4HPSA 4NGTA 1XGNA 3BTLA 3TFYA 3WHCA 2BXYA 2QMLA 5DDGA 3DGVA 4A38A 3AKZA 3FIXA 4KIBA 1J09A 4A3GJ 3MEXA 4M6XA 1ZLKA 1AMPA 1YTYA 1RFHA 1LFWA 3HH2C 4R87A 3S9MA 1WWZA 1P6RA 3ZMZA 2EVNA 1LUJB 2JMWA 3FNCA 3K4MA 1W5CC 1HXDA 2IXSA 1OCOH 4OLLA 3JRHA 2H8RA 1EV7A 2L9VA 4J00A 4ZI6A 2VRWB 3D7FA 2GKVA 3FISA 1UUCA 4TWEA 2HNHA 1TWAJ 3GYHX 3SEKC 3RKWA 1R58A 4IRGA 3WT4A 3DDDA 5HOOA 5EZGA 2E71A 3IAM2 2MFZA 2ENZA 5G20A 4MIMA 2F2EA 4FHTA 1WWXA 3B02A 3BR6A 3J81K 4ETSA 4BQAA 4BJ5C 3OYFA 3BQZA 3IWWA 2AE6A 3DPTA 1YYVA 2OTLI 3KP3A 4I7HA 3R60A 2YNCA 1XX6A 3KP5A 3E97A 2K9SA 3NH8A 4UCMA 4RB3C 1JHFA 1JKQC 5A27A 2VLAA 1IRXA 3S14J 3ML6A 3IU2A 2F5VA 3O2PE 2N52A 5F48A 3R9FA 2LF8A 2ENNA 2CFOA 3T9YA 1QA6A 2J8MA 3LODA 2PJPA 1KQ9A 1XA6A 3FX6A 4RS8A 4UNOA 4ZGYB 5ILSA 5IYDJ 4Y52J 4XKWA 1R57A 2AHQA 1Y8QB 2XIGA 3GTJJ 2IPQX 1XMBA 4ORFA 1RI7A 2QWWA 2PG4A 1YI2I 2ZPAA 3E0JB 3TOBA 2DOEA 2QVOA 1TBNA 2XGXA 1CGPA 3VATA 2HB6A 1ZTRA 3R6SA 2R93J 4KOXA 1V3FA 3KYCB 2CV0A 2YPRA 4CRZB 5IOYA 5FKNA 5JR3A 2EUIA 3EXNA 3F23A 5FKLA 4JX6A 3HXLA 2L0KA 2XUBA 2VJJA 3F9KA 2KFDA 3ASNH 9WGAA 5J1YA 3O8GA 2B5GA 1P4AA 2Y31A 1YSJA 1ZN2A 1IN7A 1LR9A 3C18A 5E20A 3H0GJ 1P0HA 4B44A 1OISA 4UEFA 4F6AA 2ESHA 4M74A 5KTCA 2JZMA 1VHSA 3BP8A 1T95A 2QQ8A 2VC1A 3G2BA 4NC7A 4B10A 4A6EA 5FFZA 1JGGA 4CICA 1XB4A 5CQGA 2X52A 1RKTA 3OYNA 2JA8J 1TBQR 1YITI 1SFXA 3SEZA 2ZXJA 4ENMA 3D8PA 4PV6A 4AVPA 1IZ1A 2O3FA 4B6ZA 2QQBA 1W4MA 1HPTA 5DUKA 2PJ1A 1Y56A 3F6VA 1FWZA 4Y4RA 1KBEA 2DO7A 3W6KB 1FOYA 4WWCA 3OYGA 5D5VB 5CKTA 5H2FC 2LYCA 4YEJA 1IV8A 3S3OA 3PFOA 4YFJA 2A5WA 2RAEA 2R4GA 3E59A 1LAPA 2B3UA 4NFRA 2B0UC 1HEEA 1ELLP 1F43A 2MA3A 3IH4A 2I10A 2RV8A 2VASA 5FLVA 2M34A 3CT9A 3BG9A 3MMYB 4JZ0A 3VDXA 2WCYA 4R3LA 3ZP5A 1LDKB 2M45A 4BACA 1MNDA 1ORKA 1PPFI 1MJ9A 4MHZA 4CAWA 2OJED 3Q5FA 4LG0A 2O8KA 2FVGA 4ONWA 1ZG7A 4NQWA 3FXTA 1LEBA 1U6MA 3BI1A 2M5XA 5F6FA 2A6EF 2ID6A 2VJ4A 4CDGA 1OPCA 4XLEA 5FRMA 2P7VB 4M3SA 4IZZA 5D29A 3BXMA 4PSXA 5DS9A 2W4SA 2GLOA 2GQQA 3RCOA 2DMQA 4MFQA 3S15J 1WJCA 1CX8A 4UFVA 3RNZA 2HGCA 3WTUC 2FUG2 2F7VA 1ODDA 1R3NA 4MFEA 2XROA 2M0CA 1IXSB 2R7OA 3JREA 3HUVA 2LBFA 4DBQA 1HDLA 3M1EA 4HNTA 3R61A 4CYOA 2KHMA 4M85A 1AOYA 3SEQA 4XN3A 3VEPA 4KOUA 2H27A 1K4SA 1USSA 2R3SA 1Y7RA 2E1CA 2CIJA 1QQ9A 1MSFC 2HDWA 2JSPA 1CQTA 2IP2A 3H92A 2WAFA 5GPCA 4DYCA 2QQ9A 1IC8A 1XS9A 2OCCH 3FF3A 1EH8A 1IUFA 3K4CA 2MSYA 2O6GE 1IGBA 3B3WA 3B3TA 4R79A 1MMAA 3K4NA 4HV6A 2O8XA 3LOCA 1G6NA 5D6FA 1TL8A 3SGQI 3FVLA 3IV5A 4BH9A 4AG7A 4JP0A 4B09A 4G6DA 3WTZA 4ZYGA 5EGOB 3MKYB 3SXOA 5DM7F 3CCRI 4RAZA 2V77A 5DEQA 1YOVB 2Z1DA 4GXOA 1FYMA 5JI6A 2DMPA 3DEUA 2IS2A 1WQ2A 4II9A 3F8MA 4ZZLA 2V1XA 2GLJA 3GFIA 2XF7A 2LNBA 4ZZDA 3L2CA 3Q0WA 1LAMA 2O53A 4CCJA 1D3YA 2VQGA 5D5UB 3SHFA 4RAFA 2SGPI 2VOPA 2ID3A 4PCQA 4P9FA 2HR3A 4X3RA 2OZHA 4OC1A 4BDYA 1TUSA 3TW7A 3QRFF 1D8KA 2N71A 2P6FA 2GA2A 4RLQA 4BQQA 3JVNA 1NHAA 3A0HC 2GOMA 4Y49B 2IS4A 2WSAA 1OKRA 4PDKA 3WC7A 2BVMA 3B8GA 4MI4A 4XBFA 4A2ZA 5AG6A 3HTUA 1DPRA 1Z77A 1ZYRF 5F0HA 2ZJPF 1XN7A 4DZJA 4A32A 2GKTI 4IF4A 1I21A 5KVRA 3PBBA 2DDAA 2XHKA 2JA7J 2F5IA 4A3JJ 1B9MA 3H0DA 1P7JA 1ZG5A 4WCGA 1VNDA 3I53A 2P6TA 2JVHA 4CYCB 4AIKA 1R6RA 1GDTA 2MLGA 1GT0C 2PQ8A 2V9VA 2F5FA 3U2RA 2XB5A 3BCBA 1HOMA 4MCSA 3HSRA 4A5NA 2KIUA 1GUUA 3PUFA 1WGTA 4CRYB 1RIOH 4RM2A 1T2KA 1K6OA 1CPXA 2WPWA 4R76A 2DW4A 4HF1A 3VWDA 1HKSA 3MCZA 3MN2A 4HV5A 4EFDA 2QQAA 1SD4A 4EM2A 3MKLA 1DP3A 4M6GA 2C6PA 2G9WA 4P55A 1PJUA 4L5IA 4HEA2 2PC1A 3PO3J 1S5KA 1XC5A 2F4OB 4I09A 4CXFA 4UB6C 2N17A 2A05A 4WXDA 2ZW4A 1ARMA 3Q9VA 2YNCC 3JW4A 2F5DA 3I56I 4ON0A 2AFZA 2K5CA 4A30A 5LGNA 1YVOA 3FXLA 2FBKA 3ZQCA 2CV1A 4XKBA 2Q7BA 2IA1A 1BJZA 1AN1I 1SAXA 2E5ZA 2JN6A 4CGPA 3KPHA 2KISA 1WFXA 4ZJZA 3QPHA 3R5AA 2PR1A 4MHNA 4BINA 1GXPA 2EZHA 4LD5A 1M4GA 2C1CA 4UVCA 1QSOA 3GLXA 5L3DA 4P45A 4KSIA 3V8JA 3MEKA 1PUAA 2DEAA 1KONA 2Y0SA 4LIUA 2B63J 2DYRH 5F49A 2A5YB 1N25A 4CAFA 2R7VA 2M8GX 3P9KA 2LY1A 4OU0A 3F6OA 2NVXJ 3JRGA 3AAFA 2HOSA 2GXAA 4B5OA 4BE1A 4NHJA 2Z3OA 1Z05A 2FE3A 4P1WA 3RKXA 3HRTA 3CD6I 1R23A 1XMAA 3WE2A 2Y75A 3ABUA 5JHFA 4B1RA 4QIWN 4H6ZA 4XPKA 2DFFA 5GTHC 5ILVA 2I79A 4JQFA 1Z3YA 2KLOA 2RKHA 1BPNA 3OYDA 1TWCJ 4IOAF 5KAFC 5E3NA 1XMXA 2FXFA 2ZSIB 2K40A 3S1NJ 2R1IA 1W4RA 2JDCA 2E5RA 3HSEA 3FRMA 5LFAA 3R96A 1Z6RA 3CP8A 4BJ6C 3S6HA 2VONA 3TO6A 2WPXA 4C2YA 1MMSA 1HLVA 2G9DA 5C4JJ 4F55A 1VFCA 4WP4A 1S5LC 2ZEDA 1W7PB 2YU9J 4CCKA 1W3SA 2WBMA 2QYVA 4KT6A 3JUWA 1HCRA 1TW2A 1QVUA 2NVUB 1IW7F 3HG9A 2H1KA 2FJ1A 3KFWX 4HNXB 2CMPA 2P7CB 5CYVA 3ZQHA 3ABTA 2NVTJ 2ZXWH 3IFEA 4BBHA 1BR2A 2P6SA 4V2GA 3K9UA 4H6UA 3UGDA 4I0BA 1J9IA 4LB5A 2R5ZA 3FM3A 1ZRFA 5CNPA 7CPAA 3GUDA 2EV6A 5LRSA 2Z3NA 2RFHA 3Q3SA 2D2WA 1G3WA 2ELIA 5AIQA 5HDNA 4M6YA 2AFXA 2QSHX 4M3DA 5FB2A 2GZWA 4UUSA 1UG2A 1QSRA 4ESBA 2V8HA 5E96A 3IJ3A 4UIAA 4BBRJ 3PL8A 4BL0B 4EJUA 3BCAA 4F8ZA 1XPXA 3IIBA 3ABLH 2JZYA 3P5JA 2OD1A 1DQUA 2M1BA 5CCMA 1XSVA 3BHXA 1ZO0A 2PEXA 3K4LA 3EC4A 1I6XA 2QCOA 2OU2A 1MBGA 4I02A 1K83J 1FC3A 1D1AA 5HS7A 1JKOC 1R0RI 2I00A 2CUZA 3K10A 4PK4A 2WV0A 3E1SA 1GVDA 2VKEA 4M73A 1IRGA 3CDXA 1HKQA 3JAMK 3BR1A 2VC0A 3JRAA 3GTKJ 4BHCA 2BEIA 3OS0A 2LR8A 2PMHA 3CPXA 4KIGA 1BW6A 3RIRA 1YQAA 3L2VA 5JFRA 2X9DA 2J8NA 3CLOA 1A36A 2A6TA 3MWMA 5M5XJ 4A3DJ 4ZTFA 1HW5A 2BV6A 4KOSA 1R5GA 3JSPA 3LMMA 1I1DA 1MW7A 3QOPA 4UHTA 2WV1A 2D4OA 2JEWA 3OWCA 4TNUA 3SDBA 1S6LA 1Z5RA 3FXRA 2LUYA 4MTEA 2L5QA 2VI7A 2FOWA 4R9MA 3KZWA 2REEA 1I50J 2GBYA 1TIHA 1LDJA 3I59A 3D68A 1B4AA 5CVJA 4GI3C 4UXHA 2GXBA 2JRTA 4U87A 4LFUA 2ME6A 5H6QA 1CGJI 2L3DA 2HDCA 3BPVA 2WGCA 1Z2IA 2KRHA 2KP6A 2TRTA 3OR1C 4EM0B 2PJ0A 4ZYHA 2FXAA 1S3JA 1Y0UA 3NWTA 4IAVA 3AG3H 3R0JA 5D5XB 1XJOA 2REFA 4AM3A 3PSFA 3ULQB 4UFWA 4LLGF 3E6MA 2EPFA 4JXQA 2ZXIA 1SGNI 3GEZA 2CQKA 3U21A 1W36C 1M8BA 2B5GB 2VT3A 4MY3A 2NS8A 4MHDA 2E73A 1SD6A 4FTHA 2PJ7A 3UFFA 4AC0A 1G3YA 3GWZA 1P4WA 4G7OF 5B1BH 3DSBA 5GCNA 2Q8KA 3QYEA 1PU9A 3GZ5A 1UB9A 5IP6A 2HC9A 2Q0OA 1SGQI 3QU6A 1NG7A 2CH0A 1VQ6I 1QSTA 1B59A 4R8FA 4HNYB 3LWUA 1ZR4A 3C2GA 1W7PD 1B6AA 2FBHA 1KWMA 3KLOA 3GBGA 2FD5A 1LFPA 2M4GA 1W0UA 4YGOA 5CVVA 3P9CA 2DKVA 3ZCOA 1T98A 2MW8A 3TOAA 2BSWA 2ECCA 2KMUA 3BLNA 2H6CA 1YR0A 2LKPA 4ZYDA 4KZTA 2BL1A 5I4MA 3W91A 2GIVA 3CXPA 2R7HA 4AB7A 2CXAA 2N8GA 3BJAA 2OC6A 3CJQB 2W24A 4QTRA 3IKTA 4RDUA 4CPAA 3O8HA 2VBZA 2OZGA 4E7JA 4BXXJ 2ZJ2A 5L3EA 1MMGA 1SFKA 2E5NA 4GYIA 1IOIA 5E3PA 4OIWA 2XGEA 4UVAA 4EJVA 2W0TA 4UXJA 3P2HA 2R7UA 4E2AA 1HDUA 1XDSA 5EGOA 3HOZJ 1RR8C 1PTRA 1WJBA 1J75A 2HOAA 2H5MA 3VDPA 2JW6A 2HZDA 4XRSA 4BUPA 4X6AJ 1I6HJ 3QAHA 4WXHA 2OTJI 4LG0B 1CM0A 3IWGA 4I98B 5HVQC 4NQWB 3D3SA 1Y1BA 4MQVA 2ZCWA 3OYAA 1CE3A 5HVFA 2VJIA 5FO5A 5HS9A 2LP0A 4CCOA 3FJUA 1M4DA 4NGPA 3G1MA 1CG2A 1Q9BA 2DF5A 2XPWA 1QPIA 1FPQA 1LR7A 1JGSA 1XGSA 1ZH5A 1DS3I 2FL4A 3FWEA 5AG7A 3KQZA 4N9HA 4HW0A 1JJ6C 3UKGA 2R92J 2LBFB 2DIPA 2R5YA 1H0ZA 2PMUA 3AG2H 3N4MA 1KGSA 2MD5A 4GRIA 3G3SA 3OXFA 4HF0A 1O7LA 2V26A 4UB8C 3E0KA 3NA6A 1YVKA 3JCUC 1ERDA 4O3MA 5D6EA 3NAUA 2BHZA 3FECA 1G3TA 2D5VA 1KUVA 4CA0A 1XF8A 1T38A 1TNTA 4ENNA 2X6XA 4HDVA 1BJAA 4DUKA 1E3OC 2DA4A 2Q4YA 5IB9A 2K02A 3F8BA 4L9NA 2DYSH 2CWEA 4A0ZA 5IT9Z 4KVOE 3IEHA 1P9QC 3S1MJ 1M44A 1OYVI 2Z0ZA 1ETOA 3NFZA 2QKLB 1DDNA 4XN0A 2GREA 3VB2A 5F0CA 1H88C 1VQ5I 2Z11A 2VUMJ 3DBRB 1W0TA 5EEAA 1V4RA 3IC7A 2MG4A 3RDIA 4P4BA 2GA1A 3G1OA 2RQPA 3BLYA 4A94A 1SQHA 2BGCA 3ELKA 3KP2A 2OVOA 1G8XA 4PZJA 3DWLE 2V79A 5ICGA 3EFAA 2Z16A 3CMEI 1VKCA 1OFCX 2ZEOA 1KZHA 2LD5A 2LOOA 2FMYA 5IB0A 5F46A 4XRSG 4P44A 3FXKA 3SFIA 1P2FA 3VSKA 1IAWA 4YIRX 1Y9KA 2JXDA 1IJWC 3KASA 4ITVA 2AS5F 2P5VA 2PJ5A 3FYNA 1SVOA 2EZLA 3JRFA 5CPRB 3BC8A 1FP2A 1EH7A 3SZGA 4RBOA 1G59A 3GIUA 1ZARA 3FKJA 5KNLA 2J5OA 1JKPC 4K2EA 2AFSA 3UGIA 3FXUA 1YW7A 3ZQLA 3FMSA 3V38A 3BY6A 3CZ6A 4WXCA 1YREA 4S0HB 1O7FA 1ZR2A 3R95A 5D8KB 4AYBA 1Q1HA 4B14A 2HPIA 3A2KA 1IG7A 2W7NA 2HQNA 3RPUD 5JGFA 3JRBA 4II3A 2RB7A 3B35A 4DGWB 3BG6A 2FBIA 4Q38A 2X1CA 3L2UA 5E17F 3IWEA 4XICA 3WC6A 2OBPA 1F4KA 4C9YA 1R36A 5HLIA 2FRHA 2E1NA 2HTSA 3M8EA 1X12A 3H5NA 2ZSHB 1MBEA 3HGGA 3FMRA 5EEGA 5E1ZB 5FJ8J 3HOSA 3HM5A 2CQQA 3BJOA 3OY9A 3SYTA 2X1DA 2BW3A 1R9TJ 2CG4A 3RQ4A 3GW2A 1S7OA 3CF2A 4KFCA 8CPAA 4F91B 5FLXZ 1KU9A 1LVAA 4NC8A 4R6TA 1YIOA 1IN5A 2E19A 2DMUA 3HRMA 1LE8A 4NGSA 4ZYQA 5K8MA 2JBKA 2RN7A 1OBRA 3V8LA 1P4XA 2PI0A 5THWA 3S1RJ 2P4WA 2QA4I 4B13A 3DBHB 3DR6A 2ZMEA 3GTMJ 1Y0RA 4ZY0A 5DM6F 2V1UA 4H4KC 4RM3A 3OL0A 1RESA 1UHMA 3TDUC 1ULMA 2WVJA 3IRRA 2TCTA 4AVAA 4OMYA 3QOEA 2SGQI 1YLEA 3PBEA 3GO5A 3NWSA 3KKWA 4BY1J 4UCNA 2NXNB 4C2XA 5JPHA 2EFNA 1J2XA 3KY9A 2Y30A 2NOJB 3H3ZA 4R3KA 1Y1VJ 2PMZA 4RMNA 1K4TA 2QJ8A 3QYBA 4UUVA 4PFOA 3FB3A 3ASOH 4MFLA 4O23A 1KQ0A 3K70C 1HJAI 2V8GA 1TT0A 3BJ7A 2KJBA 1HBXG 2B4DA 3WC5A 1ETXA 3M8FA 3DPLC 1LKXA 1UELB 4EEFG 3J80Z 3PB9X 1IRZA 1YS6A 4UEEA 1PTQA 2XAJA 1QGPA 2UXXA 3K69A 5E1XA 5LGUA 5HDGA 3WTSC 2XAHA 4MGRA 2QLZA 1MD0A 3FF5A 4GDFA 4MCRA 4X8IA 4XRMA 2XEFA 3CO6C 2PE3A 2HU9A 2DB6A 5LYDA 4A6DA 1EF4A 1TW3A 1OZPA 1WPKA 2M5WA 2LG4A 2EILH 1IGNA 2L7KA 2FS5A 4YRHA 4MHGA 4EWTA 4EJOA 1XCVA 1XOVA 4XORA 2LLKA 2O03A 2ZW6A 4MCQA 4Z65A 3T8WA 3KP6A 1Z7UA 2BZTA 3LL7A 2IMOA 1WRJA 3HUGA 2KT0A 1BI2A 1D5VA 2EIMH 1NK3P 1I1SA 4IUSA 2O7OA 3I64A 5GAGJ 1HEVA 4GM5A 3GFMA 2ZEMA 2EFWA 3I58A 3QTLD 4AVCA 2L9SA 3B73A 4PJJA 4D0PA 3SI0A 5DS0A 2HQ5A 4IKFA 3BZKA 4NXYA 1WGXA 1TC3C 4LITA 2R7SA 9ANTA 4UWIA 2MC4A 2ZO4A 2JQ7A 1XX5A 4DNCA 2HWVA 2WB1N 4AU7A 3JRDA 4CHUA 4KYWA 3MN8A 4P4FA 3B6CA 2I3CA 5M5YJ 2O28A 2VBYA 3OYEA 1X1BA 2W57A 3WTTC 5EEHA 1KU7A 2CQXA 5FD6A 1OMTA 2VB6A 1OYIA 2R5ZB 3HSFA 3W6JB 1RNLA 3CXQA 1LR8A 2M2EA 1QHGA 1ETVA 1WHUA 2L54A 4EATA 1TBOA 5C3EJ 5EBVA 2IBDA 3HYIA 4DJLA 5LEKA 4MFZA 4OAZA 4LGWA 2HTJA 5K7ZA 4UUSB 4ESJA 5F0FA 3HLPA 2AJ6A 1W5SA 4Y17A 5H84A 1MH3A 2FU4A 2RNGA 4FISA 3DU6A 5AIPA 1IN8A 1BI1A 2E7XA 2HYFA 3RQIA 1O3RA 4OOIA 3F8KA 5I0CA 1BOBA 3LSMA 3UEYA 3FM5A 1MSEC 2P0WA 4PK2A 3KHXA 1YE9A 2E2HJ 3ZMSA 4GO1A 1J7KA 2CUEA 1WTJA 2KMPA 1O3QA 2YUUA 1LJ9A 1YHQI 4A3BJ 4Q5SF 4HZFA 3CXSA 1ELMP 2XASA 2RC4A 3OOPA 5IY5H 2Y69H 2CWHA 2F48A 2FSRA 2O0YA 1L0OC 1ON2A 3OXLA 2PJ4A 1FNOA 5D8NA 4HRIA 4Z6YA 5LEJA 2BVLA 3F21A 3J81Z 2L4AA 1HSJA 4BU2A 1SFUA 4HGUA 1HA8A 4GFBA 2IGMA 2J8RA 4HKFA 4LX9A 1W1WE 4CZCA 5A28A 4Q48A 1YJ9I 2K9LA 1ETQA 3HTSB 3CESA 1FLIA 1F2PA 2OR4A 1SMTA 1UAAA 2DA3A 2JT1A 3FXQA 3WG9A 2ORVA 3L2QA 3I59B 1IY6A 3CXLA 1T56A 1M8CA 1ONVA 4QVTA 1WJ5A 5JM6A 3GFJA 2W00A 4WK8F 2ACJA 5FVJA 1IUYA 2H94A 1KMAA 4ZBGA 4P96A 2PDOA 3U1KA 4CS0B 3SJFA 5ISVA 2GVIA 2HXOA 5ICCA 2QZ8A 3HB9A 4A3KJ 2KIMA 2ZOGA 1WZ2A 4ZC3A 1S3ZA 3MZYA 3ZGKA 2GFQA 4JOMA 1HDDC 2OQGA 1TKFA 1WJAA 5L3BA 3WR7A 2M8EA 3V4GA 4HG2A 4X2TA 5ED4A 2CTCA 3BR2A 4CCNA 2IQ6A 3G1LA 4KSFA 1BW5A 3F8FA 2VKDA 4D9JA 1YO5C 1DGWY 2ELHA 2ISYA 1Y0NA 4CH7A 1FIAA 4UY8I 2ZJQF 4BS9A 4JCVE 2X4HA 3BWGA 1VQOI 2DT7B 4JX4A 1S8NA 2E2IJ 1ZREA 2MABA 2COBA 4QPQA 1P9GA 4MHPA 1S7NA 4CO8A 3KZZA 3FK6A 4TV7A 1Y8FA 2QBYA 3K6GA 1I5ZA 1OMUA 2PBIA 5EG0A 3ZXSA 2HQRA 1ULKA 3CMMA 1ZG9A 3FSYA 1YS7A 2DPDA 5CVUA 2WTEA 1SGRI 2FE7A 3H8EA 2F6CA 4FX0A 4E70A 2UZKA 2A20A 1Y7EA 1YX5A 4KOWA 5KTDA 2QECA 2IVMA 2NNNA 2ZMEC 4NUBA 5LHIA 2NU2I 4PUSA 2ZXVA 3S6FA 2FMLA 1ZGJA 4NF1A 3L9FA 2WY8Q 1I1GA 4KT5C 2DI3A 4LMYA 1U5KA 3WHBA 1MJBA 3FBNB 2CFXA 2O4HA 1BR1A 3W2VA 1D5YA 5IT3A 2CW0F 4E7IA 1I12A 4B47A 2VZZA 4A69C 2ODDA 1XE4A 3IRQA 1CT2I 2CSOA 2JPCA 4A37A 2BCOA 2HS5A 1YW8A 4U5YA 3FK7A 1A6QA 4UXNA 1EE3P 4OAYA 4Q47A 4HSRA 1DE4C 3PQJA 1S29A 4XR6A 3SJXA 2L01A 3VYRB 2CNTA 4HX7A 3BJ8A 3U1DA 2DA5A 5C4XJ 1JT0A 2PLYA 2IS6A 1M4LA 1P92A 4XM3A 3GLJA 4CAXA 2P81A 1ZGAA 2EFPA 1RR7A 3CCYA 3IH2A 2HQYA 2KQRA 4B8XA 3OIQA 2R5YB 1B72A 5LYLA 1HF0A 1BO4A 2A3SA 2CNMA 4JLYA 3CUQA 2EO8A 2GE3A 1TQPA 1ZRCA 1XGOA 2DQRA 2D4PA 3HOVJ 4E1RA 1M4IA 2VODA 2IA0A 3D66A 1H8AC 3HDDA 1I27A 1JUSA 1SMYF 1OCPA 5E3QA 1IO2A 4E4HA 2OOTA 2BOLA 5J47A 3S3MA 2K9HA 2DPUA 2O5RA 1XD7A 2DFHA 1ETWA 3CCUI 4XL9A 3CCLI 2BY2A 2O9LA 2KL4A 3GTGJ 5CJ9A 2YS9A 1TWGJ 2RGVA 3HC7A 4ESFA 5ICEA 4AIJA 1POGA 3ZQGA 1HQCA 1X3ZB 3EYYA 2P8TA 4HOBA 1WGCA 5DWNA 3X2QH 1AA7A 1O57A 1B87A 2W48A 1TT5B 3Q0VA 2E35A 3AG1H 1TF9A 2HFHA 1U8RA 2DCEA 5J1UA 5LHHA 2PX9A 4LLNA 4M6VA 1ZRDA 5BQTA 4U9ZA 1IN6A 3MKWB 5HQ8A 1C0WA 4RGRA 4B11A 1EH6A 3OSFA 3PNVA 4Z2YA 4JXRA 3HRUA 4CGOA 3GOXA 3L7WA 2R7RA 1RUNA 4ENJA 3OVOA 2X1EA 4M6HA 3DEWA 3HOUJ 4Y49C 1JWQA 2KZGA 2M87A 3UY5A 3B3SA 4U0YA 4CAVA 3HKZA 3GYAA 5HXDA 5FFXA 4FD5A 1TKHA 3UR3C 1L3LA 3T8RA 1GV5A 1VQ8I 1YIJI 2DODA 4R1HA 5DD4A 1FJLA 2B8TA 3PIPF 4PGGA 4A3MJ 3FHZA 4KMUX 4PQAA 2XRLA 1YQEA 4CAEA 3PB7X 1Z4EA 3KZYA 3EYIA 3J7YJ 2JA6J 1K78A 5DCMA 4K30A 5BWAB 1UWYA 1FT9A 5GAEJ 2IGKA 1UHSA 3BDDA 3GUXA 4MEXF 2KJCA 2DJIA 3H8GA 3GX4X 1DU0A 2HOTA 2X6WA 3GTPJ 2IS1A 2BW3B 4G9YA 1F2OA 4CZZA 4GXHA 4KS9A 4CGNA 2QPOA 5F27A 5L3CA 2OAZA 2EA2A 4CYQA 2FEZA 2CYYA 3AG4H 1U78A 4P6YA 1IY7A 1U5TC 3K9TA 4D7MA 2Y9YA 1LE8B 4XNFA 3KCCA 5KAIC 1WKMA 4M3GA 5B66C 1VI0A 3KR5A 2QYOA 1ZAOA 3KQXA 2M30A 2ZMEB 5JQ4A 3DFGA 2ME0A 4M3EA 3RBUA 2EBIA 3BT9A 4GS4A 1VTNC 1R22A 2YR2A 3F5BA 2KDOA 2L9NA 2BUSA 2B9SA 4BXFA 4A3IJ 2PJCA 4DYRA 5BOXA 5A2QZ 2GWRA 5FD5A 4FUUA 1TNSA 3NEUA 4CSWA 1GXQA 1YU6C 1V5GA 4IOCF 1X74A 1WK4A 5HMNA 3KIOA 5ERIA 3I71A 4L9VA 1BL0A 4C2TA 1JI8A 2DT5A 3ZQQA 3TKYA 3P7NA 4HLXA 5IOZA 2B4DB 3ZZIA 2QQCA 1ZLJA 2ETHA 4BNCA 1TWFJ 2LMDA 3ZJ0A 1P9ZA 1ZK8A 5E8GA 3KHZA 1KQ8A 4LG3A 4FETA 3JRIA 1L0CA 4B5PA 3DTIA 2E36A 3OMYA 3IP4B 5G21A 5C82A 4LUAA 1D1BA 3MKZA 3D5RC 3TEDA 3R4KA 2ZNYA 1YJWI 3CC4I 3FX3A 3DP7A 3BPXA 2VPLA 3DLAA 4RAGA 5IP7J 1VQNI 2KCWA 4B6DA 4KUAA 2GAUA 3IGRA 5F09A 3WGHA 3KX2A 4C3JJ 1FBUA 3GVAA 1RXTA 3S17J 2Q51A 3VH9A 4CGZA 2K85A 2KCXA 4C7IA 4KORA 3ZQ7A 4CCLA 3HUGB 1ZKGA 2PJ2A 2HXIA 3H1CA 3OOUA 1NSAA 2IAIA 4BHBA 3LQRA 1VQPI 3PFIA 2DN0A 1Z1DA 4N4OB 3F0AA 1Y1CA 4QLCU 1X1CA 1H89C 2JUGA 1RRJA 2FQ3A 4UV9A 5BS6A 3H36A 1I39A 1LPQA 3J7AO 2EINH 2ZEEA 2LTPA 1BLLE 1QZEA 3HOXJ 2V9KA 1TQMA 2QENA 2QEXI 4J01A 5IP9J 3GTQJ 1KUYA 5BPDA 2AFMA 2PJ3A 2RQQA 3GLLA 4DBRA 4EGYA 1CHOI 4IF5A 1ZGWA 5K8NA 4A3LJ 2A4NA 1ON0A 5L3FA 3DKWA 3QPLA 5K7HA 5J8CA 3WABA 5C44J 2K3PA 1GHEA 1X3UA 5FROA 2WWYA 1IXRC 3ONQA 2CQNA 1FMVA 4XPLA 2XRCA 2OPTA 3L2RA 2H6BA 3QP6A 3H9JA 1QSNA 2JPBA 1LFBA 1WI3A 1RO5A 1OQYA 3S9LA 3V7CA 5JVGF 2W82A 3E5XA 3GTLJ 1MK4A 2K9QA 4S05A 1IIDA 2E1OA 4BY7J 4OIRF 1Z8LA 2CTBA 1U9NA 5FUWA 3A03A 1LQ1A 4DQ2A 3PFEA 2K3FA 2ZEGA 2KRCA 3TDZC 1JTXA 4NGRA 4XLPF 3NRVA 4L5JA 1O3TA 4DJAA 4FCYA 4Y13A 3B2YA 4WF2A 1VF9A 2IT0A 4KMFA 2ZEPA 3JAMZ 1YG2A 5J1RA 2VKVA 1XTAA 3CUQC 3F72A 3FXOA 3TMOA 1YJNI 1O3SA 1LVKA 3K4JA 1TWHJ 2NVQJ 4PJMA 4YIFA 2UWMA 1MT1A 3OIPA 1S20A 3D7DA 2NS0A 5FGMA 1XBUA 4ONUA 3ZMDA 2ODFA 1MZBA 3S6GA 2EH3A 3BG3A 2AQFA 2NYXA 2VN2A 5FLMJ 4OIOF 2B0LA 4DZPA 2CGPA 1KZFA 2POKA 3Q0UA 1PYVA 2M4KA 3BJ6A 1FNNA 3L1PA 4E7HA 2VBQA 5DCFA 3S93A 3FHNA 2HDDA 3HPGA 4I2OA 2PJ9A 3C7JA 2GXGA 2B7EA 5FKOA 4F93B 4G7ZF 2PR8A 4L0YB 1U5TB 1N13A 2KKOA 2IL4A 2AO9A 4S04A 4YRVA 3UOEA 2R98A 3IC1A 1WI9A 3CF5F 3VOEA 5AG5A 4DIQA 5J8FA 1MMNA 5HI7A 2W25A 1R71A 5F04A 4KISA 3IWFA 3KI9A 3S16J 1EJ9A 1ON1A 3HIFA 3K1PA 1ULYA 2CU7A 3JR9A 2M7AA 4MLOA 3J7ZI 1Y39A 4ZH4F 4MHYA 3CZXA 4AMLA 3TCVA 2I8DA 4OMEA 5LGTA 1PUFA 1OJLA 3L2NA 4BD9A 3F22A 1FMWA 1WJEA 2KIQA 1CGII 1IY5A 5G22A 2ELKA 1NMTA 2UV1A 4PFPA 5KHDA 1XIXA 3FH4A 1S72I 3VARA 4UXIA 2Y0SN 3EUKL 2CUJA 2M3AA 4JJXA 1CBXA 4H2KA 4LK0F 3I4NJ 1E3HA 3H5ZA 1D0XA 4IXAA 3DNSA 1Z9CA 3M4OJ 4EVYA 3C3WA 1UHWA 1PDNC 3I3GA 3BR3A 3S3NA 5CBMA 3HOYJ 3ISZA 1WJDA 4CGMA 4V2FA 1R43A 4QBJA 3TE4A 3CDIA 3E6DA 1UJ8A 3CMAI 2ORWA 4RS2A 3NH5A 1I3AA 3OYIA 4DYOA 2K9MA 1MBFA 2QQ0A 1BN5A 1V5EA 2AXLA 2QM3A 3S2DJ 1IICA 2ISZA 2QQEA 2MBFA 3BG5A 5JVTA 2CW8A 2E60A 3NARA 3DBLB 4KA4A 4I99C 1FTZA 1A35A 1AKHB 4XNHC 5E8IA 1Y1WJ 1G2HA 2Z99A 3CLQA 2QBYB 3IHUA 3E6CC 2QUFA 3D2MA 2V7FA 2C6CA 2ZW7A 2Q2EA 5EG0B 4IJAA 3HHGA 2I5UA 2F3CI 4O5VA 1XSXA 3CCEI 3PNYA 3ABMH 4MCPA 4I49A 1GV2A 4FE4A 2BOAA 4CCMA 4B43A 1OVOA 3HOTA 4C2UA 4P4JA 2CWFA 1R5ID 4YG2F 3TO7A 2VJ5A 1SAUA 4MMOA 5E3OA 4R8HA 1BIBA 3I9SA 5FKMA 1A31A 2ECBA 1AYEA 3GY9A 3NH4A 3FEDA 2LY9A 2V1CA 4CUGA 4ZDLA 1PCAA 4YFKF 2CS3A 2L7MP 1SGEI 1JHHA 3OV8A 3B3VA 4ZYEA 4IHTA 4MFPA 5E3RA 3I0TA 3PJRA 2K7LA 3OYLA 1Z8WA 4NJRA 4PPZA 2XKPA 2YUSA 4KOTA 4A31A 1R4MB 5M5WJ 4OADA 4IHSA 1LRZA 2Q7SA 5EDNA 3FMCA 4RA2A 4HNUA 2A07F 2GM4A 4HQMA 2NYQA 2W84A 4X5KA 3SI2A 2HKXA 3TBIA 3WODF 1YLOA 4EQQA 4MNUA 2L02A 2HPMA 4HPQA 3D7HA 1AWCA 2DA2A 3MRUA 4OC5A 4P4IA 2ZB9A 2KDZA 3TX8A 3CPAA 2FNAA 4BQNA 2LB7A 4XQFA 2X6OA 2YX4A 5CVIA 2DPSA 4IQ4A 5LLQA 1B72B 3CCSI 3HOWJ 1H9GA 3ZOBA 2VEZA 3BOQA 4OKOA 4M9XA 1UMQA 2XF5A 3CUQB 2OB0A 4G12A 3S2HJ 2A61A 4IL6C 1FSEA 2STWA 2YX7A 3K1NA 4XLAA 2G3AA 4KDPA 1OYWA 3MVPA 2RVCA 3FKIJ 1I3QJ 4MO7A 4N4NB 4IO9F 1K61A 4HX8A 2F4IA 5HH1A 2AFWA 4C68A 5K5OA 2YNEA 1BI0A 5IPAA 4EJTA 1OCTC 5KTAA 4OIQF 5E1WA 2LC2A 5J3LA 5J4VA 1NXUA 5D5WB 1MJAA 2V6CA 5D8LB 1DS2I 1JXSA 4XRFA 2PJAA 1YRNA 4IPAA 1N71A 1JJ8C 1FBSA 1N75A 2MGQA 2NRAC 2ZOFA 1JUMA 4WJBA 2EK8A 1IDZA 3EETA 6CPAA 1TIQA 3L09A 2LFBA 2HZTA 3A0BC 2BE5F 3QU3A 4HSTA 3BI0A 2NVYJ 3C1DA 3PIOF 3HL2A 1XSDA 3R1KA 3NQOA 2UXNA 1DGRM 1TTYA 5J6XA 2LKXA 1VQMI 1UVGA 2XEIA 1VQLI 5JH9A 5GAHJ 1Y9WA 2VL8A 1Q7LA 4Y7NJ 1WH7A 1TGSI 2XAQA 5CLSA 2OF7A 2COMA 3U9GA 3J80K 4H0EA 4PXDA 3QP5A 1Q2CA 1MBJA 1S7FA 2CF4A 3LFKA 3GKRA 3OYJA 4BMHA 1B1BA 3GCMA 1VHEA 2DMTA 3BTJA 3S2WA 2FNFX 4SGBI 4G1PA 4MJ8A 1T0FA 4UUTA 3V42A 2R7QA 4GCVA 5KCMA 3CCQI 3BTIA 3QYFA 3QNVA 2JRMA 2LREA 1NSLA 3KEYA 4OC0A 1YTPA 1JQGA 2LH9A 4Q4ZF 4Y3OA 4LOCA 1SD7A 5K8PA 3S32A 2W1OA 2F4MB 2W85A 4HBLA 2HVRA 1HSTA 3RAMA 1K78B 3SJMA 5DCMB 1BBYA 1YK3A 1FOWA 2EIKH 4UEZA 3R9EA 3OYHA 2E34A 2R7ZJ 1QPMA 4MFJA 2LK2A 4XNHB 4XOPA 4EV0A 1UCRA 4BHPA 2DFIA 3EDPA 4IQJA 1XDUA 1XEBA 5EC4A 4X1EA 2Q0YA 1J5YA 2PVWA 4BBSJ 4OC2A 2V1NA 4EMSA 1X4PA 2BO9A 2VZYA 5CPAA 2FQ4A 1X4OA 3M8JA 1SVLA 2E1MC 4ZDPA 3W6VA 2ZBKA 4FBEA 2XSDC 4E0AA 4KITB 4LQGA 3CCMI 3ISPA 2VQYA 3NE8A 3E5UA 1R1TA 5HVHA 1S7LA 5E3LA 4B4CA 3PSIA 4NGMA 1XBTA 2PJ8A 4EMEA 4QB9A 2RREA 3D1NI 2MLKA 1VQ4I 2DOAA 5B5EC 2VXZA 1R4NB 4MXUA 1F1ZA 4L9TA 3CP2A 1FYBA 4FX4A 2CQ7A 1V54H 3E7LA 5DAEA 1YX0A 3BR0A 3Q9SA 3RPQA 4A3CJ 2Z3LA 3A02A 4MRIA 1NE9A 3K4KA 1TF8A 4P9UA 1KYWA 4OIPF 2P5KA 1HKTA 2EFQA 3OS1A 2XPVA 3R5DA 5FUXA 2JWTA 3B3CA 2DJNA 5EMIA 1Z67A 4L18B 1MGTA 2UVOA 3EO4A 3KGQA 4FE7A 3E3VA 5JLWA 1CJWA 1D0YA 1FOXA 3W3CA 4E7SA 2EV0A 3HJEA 4NDLA 1ZG8A 2OH1A 2DK8A 1OR7A 2FX0A 1QSMA 4C3IJ 4U7DA 2B4BA 1KU2A 4KOYA 1PP7U 3DU5A 3VWEA 1U8BA 2F5EA 2KRFA 1W36D 2ANPA 1LOKA 4B5PB 1UG0A 2PVVA 2JLMA 2DU9A 1RPWA 2ZXHA 3OL3A 4O6JA 4FASD 2A68F 1IB1E 3OL4A 2HOEA 2UZ3A 4BEHB 1ZG3A 3PB8X 4I76A 2WAQA 4PXBA 3MFKA 4NSQA 2JK3A 3DF8A 4L0ZB 4AUXA 4F7ZA 3PB6X 1ARLA 4RUHA 4G7HF 1CF7A 4HQEA 1JUPA 4HNWB 3K4BA 5JLXA 4XKVA 4XLNF 3K2ZA 3MZ8A 2AQEA 4JBAA 4B48A 3VSLA 4UV8A 2YNDA 4ASNA 3P2FA 2IGOA 2WZNA 3M9AA 4FT8A 2V9PA 3VYSB 2F8HA 4UF4A 5ICFA 3DPUA 5G1ZA 3VPRA 3GFLA 1ZHFA 2SGEI 3DLJA 1R1UA 3PP9A 3GZ6A 2FNPA 4II2A 3V8KA 2JDDA 3TC8A 1LNWA 3PQKA 5HDKA 4A95A 3ZPLA 1K7VA 1XGMA 3KR4A 2GLFA 2NU0I 1DP7P 2GANA 2V1CC 2EK5A 2JSCA 4JYWA 3S1QJ 4E7ZA 1U5TA 3CDLA 1H9TA 3WGIA 3PFYA 3WU0A 2XEGA 2ZENA 3FIWA 3C2HA 1S7EA 5EJCA 2G3TA 1P7IA 1MNEA 1YW4A 2NMTA 3ZQFA 3VE5A 2DTRA 1KYZA 5HS8A 4A12A 3WTXC 3ROUA 4FD4A 4I0AA 1LFUP 3QWPA 3FDYA 7WGAA 3RZAA 5LRJA 3GF2A 3KE2A 2FT0A 4HAMA 4F0YA 4JX5A 5GPAA 4UBRA 3ZRGA 4YFXF 1IRFA 4MY0A 1FP1D 2MH9A 4XLFA 4LK1F 3RSNA 1YLFA 1IN4A 3LSKA 1WH5A 2XC7A 4LQ6A 4AYBN 3SXYA 1SEUA 2KMOA 1MMDA 2Q4VA 1UVFA 1LEAA 2MH2A 4OMZA 1QRYA 1S9HA 2ERWA 4L9MA 1XMTA 5LRRA 2Z3YA 4UVBA 2XB0X 3PZJA 3FMQA 2J9RA 5B1AH 3HBLA 1Z9UA 1EA3A 3RPUA 2AFOA 2PRBA 1FAQA 2VQHA 3DV8A 4A93J 1TOTA 3KYDB 5FUYA
chains in the Genus database with same CATH topology
1HW1A 4AWXB 3R0AA 2JEVA 3DR8A 3V8IA 3CTAA 3SZTA 4KLVA 3TO9A 2B58A 2YGWA 4FD6A 3C26A 1BI3A 5BPIA 5L3GA 4IVNA 3W6XA 4HDUA 3PGPA 2OZ6A 3LA3A 4LB6B 2O61A 3KP7A 1A04A 3CO7C 3WU1B 3R9GA 4C7HA 1R00A 3TQNA 4KUMA 1P4NA 1UFHA 3VFZA 2TDXA 5E18F 3EQLF 3WE3A 4UFXA 4L89A 2IW5A 2EFOA 4M9SA 2XV4S 1J4JA 4CYNA 1MKMA 3ZMTA 1B9NA 4G6QA 2QIRA 2Z10A 3IKVA 3FBUA 5HLHA 1JE8A 4E8OA 1SFEA 1MDMA 1RUOA 6PAXA 2MC3A 4HF2A 2XAGA 4MEYF 2OQRA 2PSWA 1SD5A 2KIFA 4KUBA 2A69F 1R7JA 3F3XA 4U0WA 4KICA 2F5CA 4JD6A 1J59A 3BROA 3D0SA 3HHHA 2WC2A 2XRNA 4UA3A 2C27A 2R7DA 4J3GA 2DBBA 1K79A 4AVBA 2VT2A 1F9NA 3RYRA 1W5TA 3RJPA 1B6BA 3SZPA 1TLHB 5H86A 2EV5A 3ZN1A 3RKYA 2NAZA 2STTA 3MZHA 4U0VA 3H3UA 3MGDA 2E7WA 2EB7A 4M71A 3E6BA 3F8CA 1PP8F 3TGNA 2DXQA 1F5TA 5DWMA 4Y15A 4JWPA 4IRHA 2ARHA 1QNTA 3BZ6A 3ERED 1Z91A 3I4PA 3G73A 1K4JA 2FCKA 3M7GA 1T6SA 3K0LA 4Q36A 2VBWA 1FSHA 3COAC 1KU3A 3LWFA 4UWJA 1BOAA 2Z5UA 3WGGA 2Z9OA 2LDUA 4MBUA 3JTKA 2VOOA 1IYKA 1BC8C 3RYPA 4P5OA 1FYKA 2K5TA 2VE9A 2OD5A 2HUZA 2VXKA 2P6EA 2K4BA 2CY2A 1USTA 1BM9A 5A2QK 3LD2A 4N0BA 3T5XA 4PK3A 2G7UA 2X0LA 4H89A 1J0RA 3ECHA 2BBYA 1QBJA 3DQVC 4HLYA 4A0YA 4KVXA 3EUHA 2ZKZA 1RZ4A 2OA4A 3KETA 2FA5A 2XKOA 3CDHA 1Z6TA 3O3KA 4BXUA 4G94A 1DUXC 1TBXA 3KEOA 3RYOA 4RGXA 5DYMA 2V1DA 2Q44A 4KSAA 2FIWA 3N7ZA 4XSXF 4AG9A 4RB0A 1IF1A 4KN7X 2G7HA 2Y0MA 4EGZA 3F8NA 1T39A 2ZNZA 5D4RA 1Z4RA 4N9IA 3WTVC 2YU3A 3FZVA 4A0XA 4RGSA 4NB5A 4AIH