3TO7A

Crystal structure of yeast esa1 hat domain bound to coenzyme a with active site lysine acetylated
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
276
structure length
275
Chain Sequence
EVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title MYST protein acetyltransferase activity requires active site lysine autoacetylation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords Histone acetyltransferase ESA1
total genus 79
structure length 275
sequence length 276
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2011-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3to7A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 3to7A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3to7A02
3E6BA 4U0VA 3U1DA 2KIMA 2OAZA 3WGHA 3P9CA 3F8FA 2VBYA 4TV7A 1IW7F 3BZ6A 2ZPAA 1ZH5A 4K30A 1R36A 2EFQA 1GVJA 3ZP5A 2CNMA 2JRTA 1FZPB 4XRFA 1JGSA 1R00A 2EA2A 1FLIA 1MD0A 4QB9A 1Z9CA 3VODA 1LDKB 5DYMA 1QBJA 2VI7A 1S3JA 1U78A 3D2MA 3REOA 1GHEA 2Z11A 3F8KA 1FOKA 4I49A 1P4WA 1U5TC 2KKOA 2OQRA 4QC6A 5A2QZ 1XB4A 1PU9A 2JPCA 1OYIA 3GO5A 4EVIA 4KVME 1KQ9A 3BDDA 3PFIA 1IRFA 2Q4VA 1R23A 1W7PB 2WC2A 4XLPF 2H94A 2PG4A 3JVNA 2QQ9A 5HH1A 5JPHA 2XUBA 1YYVA 2E1NA 2B5GB 1ON2A 1R1VA 2MC3A 2D4OA 3ABTA 3DFGA 3S6GA 3F23A 3R95A 4OAEA 4JK1X 4BAYA 4AD9A 3EETA 3IC7A 1ZHFA 4MY0A 3ECOA 5AONA 3FNCA 2RV8A 4EM0B 2BEOA 1R22A 3WG9A 4NHJA 2EUIA 4GXOA 2WV0A 1FYKA 3O3KA 5JFRA 1TW3A 4MHDA 1F1ZA 2GWRA 1BM9A 1Z91A 1OPCA 4KLWA 3TE4A 4EV0A 3I53A 1VHSA 5KK1A 1QQIA 5DEQA 1FX7A 4BXUA 3C18A 2IL4A 3R9EA 1ZG1A 5ILVA 1ZRCA 1IIDA 2GAUA 3W6XA 4HKFA 2L01A 3GFLA 3EQLF 1D3YA 1YS7A 2CW0F 2J5OA 3DXJF 5E17F 2R1IA 4JQFA 1OZPA 4BHCA 1UCRA 1I12A 5E8IA 3SXNA 2QMLA 4XPKA 5H6RA 1Z4RA 4XPDC 3S2WA 2Q0YA 1KQ0A 1BOAA 1HW5A 1RO5A 1USSA 3GFIA 1UFHA 3QPHA 4LFUA 4L5IA 3LAPA 4HNWB 3WTYC 1V4RA 3QRFF 3KP2A 3LWFA 4GS4A 1ZAOA 2FSRA 1OYYA 1LB2A 4WCGA 5L3DA 3SHPA 3W91A 2FCKA 3AAFA 1LRZA 2W25A 4FX0A 1PDNC 4F6AA 3F0AA 3ML6A 2YPRA 2KCWA 1FBSA 1ZLJA 4P9FA 2RKHA 2ZMEA 5FB2A 2EB7A 5ICGA 2I00A 2HYFA 2FE7A 3DKWA 3L2CA 4QWQA 2VZZA 1HKTA 4ENKA 1D8KA 5L3FA 5CVRA 3WTWC 3TQNA 2M30A 3KE2A 2OD5A 2XRNA 4OU0A 5A2QK 3HTUA 3WU1B 5D5WB 1U6MA 5HDNA 4LB5A 5D4SA 3ZZIA 4GGGA 1WK4A 2X0LA 1SFUA 2NNYA 4NF1A 3ULQB 3E0KA 2DO7A 2JEVA 4B09A 3G73A 4EJTA 3E6DA 1IN7A 2VE9A 3HRSA 3KP7A 1KUXA 2BV6A 2ARHA 3IL2A 4M74A 1ZREA 4KUBA 2AXLA 2H09A 1ZGJA 4MNUA 1VTNC 1KZFA 4EMSA 1U8RA 2RNJA 5D4RA 1Q1HA 2B4BA 1HQCA 1BI0A 5DDGA 3TFYA 4U88A 2OBPA 1O7LA 3F22A 2WTEA 5CVUA 1TQMA 5E18F 1RNLA 3EY5A 5ICCA 1OR7A 4JLYA 2VC1A 5FFXA 2PDOA 1QSNA 1LEAA 2ADUA 3T0YA 3TDUC 2H6BA 2CY2A 2F2EA 2PFBA 2FXAA 4CDGA 2H5MA 1IRGA 5EBVA 3WU0A 1YVOA 1QSOA 4KN7X 3QP6A 3F6OA 2FSWA 4R57A 3KKWA 4KLVA 4YFJA 3M1EA 4P9UA 2HS5A 4R3LA 4YG2F 3TOAA 1KA8A 2HQRA 3MAJA 2F5EA 2QYOA 5EC4A 1HW1A 2OA4A 2CSOA 4UBRA 4KT5C 3N7ZA 2HFHA 5K5RA 3T8RA 5LGUA 5HDKA 3JUWA 3CLOA 2W24A 4AVCA 5F48A 5EEGA 3I0TA 3TO6A 2PQ8A 4M85A 2ZW6A 3FWEA 2KJBA 4KMFA 5BOXA 3L00A 3B02A 3F8CA 1K6OA 3D3SA 1U5TA 3SFZA 2QM3A 4WXHA 1T39A 1TTYA 1MJBA 3FM3A 2ZNZA 3R9GA 4LX9A 2UXNA 3HSFA 2LDUA 5E8GA 1KQ8A 2QLZA 4LG0A 5DWNA 2QVOA 5H84A 1YTYA 3M9AA 3JTHA 5L3EA 4XBFA 1BN5A 1O3RA 1ON0A 4ENJA 5DWMA 4FX4A 2ZW4A 1CF7B 4RAYA 4FD6A 1E17A 2P6EA 3FXTA 4KOUA 4N0BA 4MGRA 3IWZA 3DSBA 2VOOA 2ZJ2A 2GE3A 1XN7A 1JHFA 3KP3A 4G7HF 2B4DA 1DDNA 4R3KA 1GXQA 1USTA 3F8NA 1PP7U 2B3VA 2XKOA 4B5OA 5DD8A 4LMYA 2O3FA 4U0WA 4LGWA 2HOEA 3GZ6A 1G3TA 4OIQF 3DF8A 1P2FA 1QO0D 3OV8A 1RUNA 4WF2A 5JHUA 5ISVA 5K1YA 1TQPA 3IGRA 2ZXVA 3N97A 3K9UA 3Q9VA 3RI4A 1XF8A 2CFXA 2HUZA 1LVAA 1TW2A 2HV2A 3W6KB 3ERED 4H89A 3FMRA 1EV7A 4KFCA 4ORFA 2EV6A 1IXCA 3CUQC 1I5ZA 3EFAA 5HLIA 4WXDA 3I64A 1K79A 2EFPA 3DPTA 1HXDA 3QU3A 4F7ZA 4UV9A 3F5BA 2IA2A 4A0YA 1I1DA 1B6AA 2L54A 1WI9A 3HIFA 1TBXA 1FPQA 4HDVA 5HOOA 2FF4A 1YQAA 3ZMZA 2LKPA 3WTZA 3VWEA 1O57A 2A6HF 1P6RA 3WGGA 4M9ZA 3FIXA 3HOTA 5DUKA 4J3GA 2L3DA 2HZTA 4CO8A 4M71A 3K1MA 2EK5A 3GYAA 3O2PE 2CG4A 3JAMK 3WTXC 4KN4X 4YFXF 1O3TA 2VOPA 2HQNA 3TTHA 3IKTA 2FEZA 1S7KA 1HSTA 2O28A 3T8TA 2O6GE 4UHTA 4PK2A 4II9A 5E96A 1XCVA 4ENMA 2ZCWA 3DNSA 3LA7A 4X5KA 1E2XA 2VXZA 4UVAA 2E7WA 2KRFA 1LJ9A 3GXOA 4FHTA 4OIRF 4M6XA 5ILUA 3MWMA 5D6FA 3VB2A 1IF1A 3DR8A 2X4HA 1TIQA 3JAMZ 1B87A 3G3SA 2A68F 2VN2A 3EDPA 4EJOA 2XKPA 2NS0A 2QQBA 4ENNA 3LA2A 4L9VA 4RI1A 3TGNA 3NE7A 4G9YA 5JQ4A 1SMYF 1W7PD 3SZTA 4JD6A 1J9IA 1O3SA 2BUEA 3RYRA 4ASNA 2DT5A 4YRHA 1Q2CA 3J80Z 1Y9KA 2EWNA 3FX3A 2IRFG 4L8AA 1Q2DA 4IHTA 4ZYDA 4RB1A 3GFJA 4AIKA 4LLNA 4HNYB 3E6CC 2F5IA 4E70A 4XSZF 4EVYA 3FXQA 3QP5A 5AIPA 3GLXA 1R58A 3MGDA 3K1PA 2K27A 4B5PA 4MEXF 2IA0A 5DCMB 2R8VA 1L0OC 4UVBA 2VXKA 2GQQA 3IHUA 4M3SA 2D4PA 2QWWA 3W6JB 1CJWA 4ZYEA 4OINF 3S6KA 1IN8A 5H20A 1O7FA 3RYOA 1YVKA 4MHGA 3SXYA 2DQLA 4LK1F 2IW5A 3QPTA 1GHCA 1S7NA 3MQ0A 3FBUA 4ZYGA 1YW9A 2XAFA 3LSTA 1I1SA 4L89A 3HYIA 5K5QA 2XASA 3T5XA 2FMLA 3WE2A 3ROUA 3I59A 1R1TA 2WPXA 1QNTA 4U9ZA 4HOBA 4PSXA 4G6DA 3WODF 2V79A 3IRQA 3M8FA 1F4KA 1YW8A 4N9IA 1B59A 3BY6A 4L9JA 3WTVC 1AWCA 5CVJA 5IB0A 2J5PA 3FRMA 3E97A 4HDUA 3I54A 1W5TA 2ZFWA 1SD4A 5LRSA 1YREA 3ZMVA 4IF4A 2K5TA 4NQWA 2O8XA 1S8NA 2IP2A 4HV6A 2VBWA 1M4IA 2PLYA 5DUIA 1WRJA 1IN4A 1QGPA 3ZN0A 3V8JA 2W57A 1WSUA 1QZZA 1WWZA 3R96A 4I2OA 1OKRA 3HOSA 3ISPA 2E7XA 5LEKA 2EFOA 4MI4A 3N4MA 1Z4EA 3MEXA 1XMTA 2YSRA 2GA1A 2PMHA 4HYEA 4ON0A 2D45A 1XIXA 4AG7A 1BBYA 2DPDA 2P5KA 2BGCA 3JW4A 1RXTA 4YGOA 4OADA 4U5YA 1YLFA 3ZMDA 4YFNF 1BIBA 4G7ZF 1KU7A 4BHPA 2CQKA 3C1DA 3D0SA 5IT3A 1XGNA 3I71A 4UWJA 2HDCA 1D5VA 3F72A 2FXFA 1ZRFA 3ZJ0A 3T90A 2JPBA 3V4GA 1D8JA 4HF2A 1ON1A 1SD5A 5HS7A 4S04A 4B5PB 2FS5A 2ESHA 2UZKA 1KU3A 5E1WA 5BS6A 2FOKA 2GANA 1TLHB 2OZHA 1MZBA 1XCBA 3P2FA 5LEJA 1Q2YA 4I98B 4F0YA 3TT2A 2MLGA 3T1BA 2C6YA 5LHHA 1S3ZA 2IPQX 2HEOA 2G7UA 5CVIA 1XD7A 1BC7C 3I58A 5HDGA 3RKWA 3RJPA 4OIOF 2YX7A 2KIFA 3KEOA 3IRRA 3FMQA 2L02A 1F9NA 4XPLA 2FIAA 4HBLA 4M9SA 1HKSA 1A04A 1HKQA 2XVCA 3GY9A 3RPQA 5TJJA 5FFZA 4IUSA 2HYGD 4L0ZB 3LODA 1YS6A 1J4JA 4Q5SF 3D2PA 2MH2A 5GCNA 2CGPA 1XGOA 3U9GA 4A0XA 4H0EA 1BI2A 3PQKA 3ECHA 5HLGA 5KVRA 2UXXA 4Z2YA 4HZFA 3JTGA 1IN5A 4PCQA 2J8MA 4EM2A 3BWGA 4EGZA 2AE6A 2PMUA 1YG2A 4KIGA 2A61A 5ICEA 1KYWA 4AWXB 4O5VA 2O61A 4KIBA 3E3VA 4EJVA 2F5FA 3BROA 4R8HA 1FYLA 3RKXA 4IRHA 2FE3A 1FC3A 4CXFA 5AIQA 4S05A 4U7DA 4A6EA 2VZYA 1YK3A 2ZO4A 4KICA 2VODA 1XGSA 2FNAA 3R9FA 2LF8A 4IRGA 2VBZA 3D8PA 3LQRA 2W84A 3DDDA 2DFIA 1XMAA 3COAC 3KEQA 2XIGA 3WE3A 1DP7P 5FO5A 2IA1A 5FLXK 5CVVA 1SFXA 2I79A 5D8LB 2OH1A 1U3EM 1SMTA 1JE8A 3FZVA 3I59B 2QENA 1T6SA 2Z9OA 3J80K 1FP1D 4HX8A 4MJ8A 4I01A 4A2UA 3E5QA 4H6UA 5KTCA 4EJWA 5D5VB 4AG9A 2QQAA 4HQMA 5L3CA 3VWDA 2IVMA 4KOTA 5DCMA 1XDSA 5F64A 4L5JA 2STWA 2P7CB 2R98A 1S6LA 4BHBA 2FBKA 1SFEA 4RB2C 3EUHA 4HLYA 2Z0ZA 2Q7BA 4NXYA 5CYVA 2AS5F 4PZJA 1M44A 1I6XA 4XLNF 2VBXA 2Q8KA 4MBUA 1I27A 1NHAA 5D6EA 3I3GA 4LLLA 4L0YB 2A07F 3FB3A 4JXRA 3OOPA 3RKYA 4ZYHA 1NE9A 4KMUX 4WWCA 3O6BB 2PI0A 4GCVA 3C26A 4EQQA 1L3LA 1F5TA 1Z05A 4M73A 1FBUA 5LBQA 4G6QA 2G0BA 4EJUA 5LLQA 5E1XA 4RB0A 2R7DA 1MK4A 6PAXA 1SD7A 4HQEA 2NMTA 2Z5UA 2JDDA 3F8BA 5BQTA 1FWZA 4HNXB 1WQ2A 2DLLA 5BPIA 1FNNA 2NYXA 1REPC 2A69F 3SXOA 3FYNA 5ERIA 1O3QA 1T0FA 3FM5A 3T9YA 1ZRDA 2DAOA 1R1UA 1Z7UA 2BE5F 1U2WA 5F6FA 1RUOA 3GFMA 3WTTC 5F46A 1YO5C 1R7JA 5C82A 3CUQB 3GZ5A 3J7AO 4I02A 2CNTA 2QECA 3LA3A 3WGIA 3GYHX 1T2KA 2M1BA 1YFHA 1AOYA 4CGZA 1BJAA 2Y48A 1CF7A 2Z33A 2PJPA 1FP2A 1IZ1A 2Y0MA 3QOPA 4ONUA 4E8OA 4G8XA 4Q4ZF 2XAJA 4HA8A 3MFKA 4MEYF 2PSWA 1EH6A 1B4AA 3WR7A 2O03A 2K4BA 2ETHA 3TO9A 1R5HA 3GX4X 5HLHA 2MH9A 4KORA 2OQGA 3TKYA 1XSVA 2EFNA 1U5TB 3MZHA 4HF1A 1KYZA 2EVNA 4PGGA 1EH7A 3DQVC 4UWIA 4CAXA 1IYKA 2E1CA 3Q9SA 3ZPLA 3EC4A 2HTJA 1G3SA 1S7LA 4O3MA 4E0AA 3ELKA 3V8KA 4ZH4F 4EM1A 1M1DA 1XSXA 2BEIA 1M4DA 2VE8A 3EO4A 1MJ9A 3R0AA 4GYIA 4CS0B 1G6NA 1MGTA 5JVTA 5FLXZ 4L9TA 1N71A 1MDMB 1WWXA 1M4GA 3L7WA 1J0RA 3K2ZA 2XROA 1RZ4A 2NNNA 2FIWA 3K0LA 1Y0UA 1LEBA 1ZARA 2ZKZA 2PEXA 2GA2A 3HSRA 3BPVA 2FRHA 4CRYB 1ZGAA 1IYLA 5HS8A 4G7OF 1YX0A 3BLNA 1XGMA 1Z9UA 5D8KB 2NRAC 3L9FA 5LHIA 3K69A 1B1BA 2RGVA 4IXAA 2JLMA 2ATRA 3GVAA 3JSPA 2RC4A 4LD5A 2JTVA 2M87A 4Q48A 3NQOA 3FXUA 4ESBA 4ESFA 4XSXF 1QSTA 2YU3A 3H3ZA 2EJRA 4CHUA 4DNCA 4AIHA 4DQ2A 1CGPA 3S6FA 3KZYA 3M8EA 1KUYA 2CYYA 2B4DB 3BJAA 1Z6RA 1JXSA 3H3UA 3KETA 2FT0A 3R1KA 2XAHA 1S60A 5IX3A 2XHKA 1K78B 3GWZA 2EV5A 1NMTA 1Y9WA 4CZZA 4XNHC 4OIPF 3PQJA 3H4QA 1Z6TA 3DP7A 2Q4YA 1DPRA 4B8XA 2LF7A 4NCZA 2DXQA 2FL4A 1UHWA 3V7RA 2DK5A 5IT9Z 4K2EA 3R60A 4LG0B 2YX4A 2D2WA 2J8RA 1XEBA 3F21A 1SAXA 2Q04A 2AJ6A 3Q5FA 4LB6B 2R7HA 1WKMA 5CJ9A 1ZG3A 2HKOA 1BI3A 4M6YA 2REFA 1S7AA 3FF5A 1FYMA 5BMZA 1UFMA 2G3TA 5I0CA 3V8LA 4XPDB 2Q2EA 2FBHA 3DR6A 2ZBKA 3B8GA 1OYWA 2GXBA 3D5LA 1XMKA 4R1HA 3TCVA 4IVNA 4JXQA 4ZZLA 3LD2A 1UHMA 4OLLA 1ZYRF 4P5OA 3KP5A 3QAHA 1K78A 3BJ7A 4FD4A 4ZBGA 4HAMA 2CNSA 1SQHA 1G4DA 5J8FA 3I5UA 1ULYA 1IXSB 2JZYA 3CTAA 2P6FA 4CYDA 3IKVA 4CICA 3FHZA 4EGYA 2P7VB 1IN6A 2OU2A 2WWYA 4UUVA 2J8NA 1FBQA 3TO7A 5LRRA 5FD6A 4A12A 4U0YA 1V0CA 4A0ZA 2HWVA 5HS9A 1ZN2A 2ESNA 2O0YA 1EH8A 1Z1DA 2OZUA 1LDDA 1KGSA 2QIRA 3NEUA 4Q47A 4GO1A 2RDPA 2H27A 2K7LA 4LUAA 4AVAA 2ZNYA 1IB1E 3P7NA 5FD5A 5HVQC 3B73A 1H9TA 1J59A 2VC0A 1S29A 4O6JA 4WK8F 2G9WA 4HV5A 2P6TA 4PK3A 1G3WA 1DUXC 1BOBA 3UY5A 3BOQA 4R9MA 2EA4A 2CO5A 2QUFA 3GW2A 1PUAA 5ILSA 5C88A 3P2HA 4Y49B 2V6CA 2P0WA 3SHFA 1GXPA 4PV6A 1W7PA 1G3YA 3PP9A 1MKMA 4XNHB 2DPUA 1J75A 2H6CA 2IJLA 4KYWA 1H9GA 3TOBA 5F49A 4KOYA 2XGXA 5LGTA 3GUDA 1BO4A 3VFZA 1STZA 2Q0OA 3PZJA 4NSQA 2FQ3A 2P6SA 4KA4A 1FY7A 1V3FA 5J8CA 4U7BA 4MQVA 5F47A 3KP6A 5E1ZB 4KZTA 1HBXG 4RGUA 2DW4A 2VBQA 1LQ1A 1B6BA 1P4AA 2OB0A 2MBFA 4P55A 2CWEA 5DV5A 1MJAA 1P4NA 1YGHA 2BBYA 4KOSA 2MD5A 1T38A 3C7JA 5L3BA 5ICFA 5EEHA 2QZ8A 5IV0A 4H6ZA 5JR3A 2W85A 2DK8A 3CJNA 2QBYB 2MA3A 2KIUA 3H92A 5H86A 4A6DA 4MY3A 2P6GA 3IWFA 4MTEA 1VKCA 4IRIA 1FSEA 2R7FA 3LAJA 4R87A 2Z99A 4RS2A 4CRZB 1J5YA 2COMA 4BYYA 2V1DA 3PGPA 2ZW5A 2B58A 2A5YB 4JJXA 2FMYA 4OMZA 4P96A 3VOEA 1QPMA 4KVXA 1IAWA 4HLXA 4KUMA 4JBAA 2TDXA 1XSDA 1W5SA 3JSOA 1LDJA 3QU6A 2FU4A 1YW7A 2ISYA 2XAQA 1W4MA 1C0WA 2A3SA 2HGCA 2MLKA 5L3GA 3HSEA 5D5UB 1OMIA 1H0MA 4KOVA 4BQAA 2WPWA 3J81K 3SQNA 1J7KA 3HRUA 3DEUA 4AB7A 3F8MA 2JT1A 2XV4S 3F6VA 4ETSA 2EFWA 2EV0A 5FVJA 1YR0A 3E5UA 4Y13A 1XE4A 5D5XB 1HW2A 2VQYA 1MDMA 1DPUA 5F1RA 4YIIA 2V1XA 1R5GA 1ODDA 2M8EA 4QVTA 4RGXA 5K5OA 4KUAA 2P5VA 4BNCA 3G3ZA 2P5LC 3J81Z 3MCZA 2BYVE 4PDKA 2HTSA 3KP4A 4IPAA 4IHSA 4Y17A 2B3UA 2HKXA 2OZGA 1PP8F 5KTDA 3ZQ7A 1K7AA 2L4MA 1YLEA 5HMNA 2VT3A 4QBJA 3ZMUA 1PUEE 2FA5A 1KU9A 1S7OA 4G94A 1B9NA 2K4JA 3CXQA 3GKRA 2RVCA 3CUOA 4RGSA 4Y49C 1TNSA 4CAVA 4KOWA 2Z10A 2ACJA 1I21A 3K9TA 4M72A 5J6XA 3GEZA 3EYIA 3QB8A 4HX4A 4I09A 2ISZA 3HUGA 4YIFA 4RS8A 1QZYA 4MTDA 3V7CA 3WTUC 5LGNA 4AVBA 3HTSB 3BP8A 1R57A 1Y7RA 4PGHA 2JDCA 4BH9A 4KVOE 3RDIA 4RAZA 3ZMTA 4YFKF 2GZWA 3KCCA 1LNWA 4Y15A 2K02A 2PBIA 5DD4A 1TNTA 3OWCA 1HSJA 2VEZA 5LHGA 3EYYA 5H6QA 3V8IA 3FXRA 2X7BA 3EXNA 3WTSC 4UXNA 5IT9K 1QSRA 3R6SA 3W6SA 2F5CA 2B5GA 1FSHA 4NEXA 1KU2A 2LSOA 4M9XA 3U2RA 4NB5A 3HRMA 3CXPA 2G7HA 3DV8A 3BPXA 5ED4A 3ZMSA 2M45A 2Q44A 3VEPA 4RB3C 2D1HA 5JI6A 1P92A 2ZMEB 3KLNA 4LJZF 1K4JA 1X3UA 4N9HA 4GYGA 4A5NA 1CM0A 2BSWA 2PR1A 2PC1A 1B9MA 1P0HA 3RIRA 4AIJA 3M7GA 2QBYA 2C27A 4OOIA 1IUYA 2P4WA 2YR2A 4LK0F 4UV8A 3ABUA 4QLCU 2M5WA 2K86A 5FGMA 2A6EF 3CO7C 1SD6A 1XDUA 3R0JA 4JWPA 3FMSA 3I9SA 3RYPA 4IF5A 2Y75A 1NSLA 2RQPA 3E6MA 4RGRA 2VT2A 4LLGF 3KFWX 4WXCA 4KOXA 4KIFA 1P4XA 4A5MA 2DTRA 2XAGA 3HHHA 4OMYA 3IWGA 4PSWA 4R79A 2B0LA 5BPDA 1J2XA 2GXGA 4AVPA 1ZLKA 5DCFA 4KNYA 3MZYA 4I0BA 3TDZC 4ESJA 1BIAA 3DPLC 2PRBA 2GIVA 1FT9A 4WX9A 3BJ6A 1RIOH 3I4PA 3S6HA 3L09A 1I1GA 3R4KA 3CXSA 4HF0A 5TRDA 3V7SA 3RTRA 3HHGA 1YIOA 3KZZA 3HRTA 4KDPA 2Z3YA 1BC8C 3NRVA 2FNPA 2ZXJA 1S5KA 3G8WA 3P9IA 2R3SA 2V1UA 2DQRA 1ONVA 2REEA 2D1VA 4ZZDA 5CLSA 4HW0A 3RPUA 3CUQA 2ZW7A 2RN7A 3CO6C 2BL1A 2A4NA 4CAWA 2HQYA 2KJCA 1S7FA 3GF2A 3BJOA 1UB9A 1KUVA 4FD7A 3E5XA 2DBBA 4L9NA 2FBIA 3KLOA 2STTA 4UA3A 1QSMA 4UVCA 2PN6A 1IXRC 2V9VA 1BI1A 3BJ8A 1T98A 4MQ9F 5E20A 2LNBA 1L0CA 4QUSA 5CNPA 2NAZA 4D0PA 4HX7A 2UWMA 2VONA 1JHHA 4L18B 5KTAA 2JSCA 1TQIA 2P8TA 2DI3A 3CDHA 2F5DA 2DU9A 3LFKA 2L4AA 3ZN1A 1U6GA 4E2AA 4I0AA 2G3AA 1ZG5A 3P9KA 4UNOA 4U9YA 3F3XA 3K1NA 4FD5A 4FT8A 4I7HA 2IT0A 2HR3A 3R61A 2OZ6A 3LQQA 3SZPA 1RI7A 4IJAA 2PR8A 1IICA 4BMHA 3C3WA 2ELHA
chains in the Genus database with same CATH superfamily
3E6BA 4U0VA 1VNDA 3U1DA 2KIMA 1X1AA 3OYNA 4E7JA 2NVQJ 1PTRA 2DFEA 2OAZA 3OVOA 2EK8A 5FUWA 3WGHA 3P9CA 3F8FA 2ZJRF 4MFQA 1OR7C 2VBYA 1Y8QB 4TV7A 1IW7F 2VKEA 3BZ6A 2ZPAA 1ZH5A 4K30A 1R36A 2EFQA 1GVJA 5E3NA 3ZP5A 2JRTA 1FZPB 4A93J 1NUBA 4XRFA 3SYTA 2CNMA 3FECA 1JGSA 1R00A 2EA2A 4OC0A 2DA2A 4KISA 1YJNI 1FLIA 1MD0A 1XA6A 1LANA 4A95A 1YX3A 1Z9CA 3MMYB 3AG2H 4PFOA 1LDKB 1JTXA 3VODA 3VPRA 1PUFA 4ZGYB 5DYMA 1QBJA 3PM1A 2VI7A 1S3JA 2HPIA 2QGUA 1U78A 4CAEA 2A5WA 3REOA 5IY5H 1GHEA 3D2MA 1TT5B 2Z11A 3F8KA 4G12A 1FOXA 4BL0B 3SJMA 1FOKA 4I49A 1P4WA 1D1CA 2L5QA 2V8DA 1U5TC 2KKOA 2OQRA 5EBVA 4BD9A 4QC6A 5A2QZ 5E3MA 1R4NB 1XB4A 1PU9A 2XB5A 2JPCA 2EWBA 4IQ4A 3GO5A 1OYIA 4UB6C 4IHYA 1A2ZA 4EVIA 2AFWA 4KVME 1X1PA 1KQ9A 2X1EA 2Y69H 3CF5F 3BDDA 1CT4I 2ZEDA 3PB8X 1LR9A 3PFIA 1IRFA 1T0FC 1R23A 2XF7A 1ARLA 2Q4VA 1W7PB 2WC2A 1Y7EA 4XLPF 2GBYA 2I10A 2XSJC 2H94A 3FKIJ 2PG4A 2HVSA 3S2DJ 1IOIA 3R5CA 3JVNA 4HEA2 4M3EA 2QQ9A 5HH1A 1CHOI 2GIZA 5JPHA 2PMZN 2XUBA 5AG4A 1YYVA 2E1NA 2B5GB 1ON2A 2HQAA 3NH5A 1R1VA 1A35A 3KYCB 4B48A 4X1EA 1MMNA 2DFFA 3BHXA 2MC3A 1BR1A 4C68A 3D66A 1FAQA 2OUMA 1GYTA 2D4OA 4A2ZA 4CPAA 3ABTA 3DFGA 3S6GA 1MBGA 3K10A 3F23A 4MXUA 1XX5A 3R95A 4OAEA 2QQDA 3FXJA 2DPSA 4JK1X 4BAYA 2L9RA 4AD9A 2R5YA 2ELIA 3EETA 3IC7A 1ZHFA 2Z3PA 4MY0A 3ECOA 1WKXA 4A3KJ 2WB1A 5AONA 4BUPA 2RV8A 3FNCA 3ZQHA 2HVRA 3BTJA 1ZLIA 2VL1A 4EM0B 1KMAA 2A6TA 2BEOA 4MHPA 2WA0A 4CYPA 3L2WA 5HNHA 4GI3C 1R22A 2FQ4A 1XS9A 3S1MJ 2DODA 3WG9A 1ZLHA 4NHJA 2EUIA 3VYUB 2JK3A 4GXOA 2WV0A 5JGFA 1FYKA 2VJJA 3O3KA 2BHZA 2WSAA 2R7ZJ 5JFRA 3ZQFA 4UFWA 2E5NA 5GTIC 3SI2A 1TW3A 3MN8A 3S8PA 5HQ8A 3PIPF 4MHDA 2EINH 1F1ZA 5GAHJ 3LMSA 2GWRA 4DZPA 1BM9A 2VKHA 1IICA 1A5JA 1V5FA 2Z3OA 1PPFI 1Z91A 4I99C 2JBJA 4YU9A 1OPCA 1WJDA 4A37A 1HDUA 2HB6A 4KLWA 4Y33A 4EV0A 4HGUA 3TE4A 2YNDA 2K85A 4F55A 1WH7A 3I53A 1H8LA 4B11A 1R3NA 2LLKA 1VHSA 5KK1A 3WHBA 1QQIA 5DEQA 4BE0A 2BOAA 1FX7A 4BXUA 3C18A 4E7IA 2IL4A 3R9EA 2ZEFA 1ZG1A 5LFAA 1AKHA 5IOZA 5ILVA 1CGJI 1T8IA 5IYCJ 1ZRCA 3TBIA 1IIDA 3UGLA 2GAUA 2GM4A 3W6XA 1V5EA 4HKFA 3SJEA 5HVHA 3TMOA 1WPKA 2L01A 3GFLA 3EQLF 1MW7A 5J1YA 2X6WA 2ODFA 1D3YA 1YOVB 1YS7A 2CW0F 2J5OA 3DXJF 3HGGA 2R7WA 5E17F 1WJFA 5M5XJ 2R1IA 3FSYA 4JQFA 1BUSA 1OZPA 1W4RA 4D9JA 4BHCA 1UCRA 4M3DA 1I12A 1OCZH 3FEDA 2IS2A 5E8IA 3SXNA 2QMLA 2IAIA 5J1UA 5H6RA 4XPKA 1Z4RA 4XPDC 3S2WA 5DS0A 3TW6A 2X1DA 1MSEC 3GOXA 2Q0YA 2OCCH 1KQ0A 1SVMA 2DCEA 2K9LA 4CZCA 1BOAA 5EX0A 3PB4X 1HW5A 5CQEA 2VLAA 1MBJA 1RO5A 1USSA 3UR3C 3GFIA 1UFHA 4AYBN 2ANPA 3VH9A 3QPHA 2SGFI 3K70D 2LREA 4LFUA 3PEIA 4L5IA 3LAPA 1X4PA 4HNWB 1K4TA 3WTYC 2KMUA 1V4RA 4YIRX 3QRFF 3KP2A 3LWFA 4GS4A 1V55H 3KYLA 2GOXB 1ZAOA 4FTHA 1QPIA 5K7HA 2FSRA 1OYYA 4XNFA 1LB2A 1JGGA 2V8GA 4WCGA 2HVQA 5L3DA 3IEHA 2PJ7A 4DIQA 3IU2A 3HM5A 3SHPA 1X12A 3DLJA 3W91A 2FCKA 3A01A 1PCEA 3AAFA 1WJBA 3BI1A 1LRZA 4B47A 2W25A 5IP7J 4FX0A 4M6VA 1CP6A 5CBMA 1PDNC 2EZKA 4Z6YA 4F6AA 2M7BA 1S20A 2LEOA 3D67A 3F0AA 1MBHA 4P44A 2LB7A 3ML6A 2V7FA 3TX8A 2YPRA 2KCWA 2ZEEA 3NARA 1BPMA 1Z2IA 1FBSA 1ZLJA 4P9FA 4CCOA 2RKHA 2ZMEA 3S2HJ 5FB2A 2A05A 2CW8A 3GB0A 3S16J 2EB7A 1RC9A 5ICGA 1ENHA 3MKWB 2AQEA 2I00A 2IJZA 2HYFA 2FE7A 3DKWA 4XL9A 2IS6A 2ENZA 2V1CA 3L2CA 4QWQA 2VZZA 3IH3A 4ZTFA 1K4SA 1HKTA 4MCSA 1AKHB 3DTIA 4ENKA 1D8KA 3ZQLA 4X6AJ 1VQ8I 2PIZA 3QPSA 3HL2A 5L3FA 4BE2A 1V1HA 3EUAA 5CVRA 1RKTA 4E7KA 3WTWC 4BMHA 3TQNA 2M30A 3VDXA 1J09A 2CQQA 2OD5A 3KE2A 4D5FA 3FVLA 3IO1A 4OC5A 1D0XA 2XRNA 3TP3A 4OU0A 5A2QK 1TURA 4OIWA 2YQPA 3ONQA 3H35A 3HTUA 3WU1B 4J00A 5D5WB 1U6MA 3GBGA 5FLMJ 2EBIA 5HDNA 3I55I 1SANA 4LB5A 5D4SA 3PBEA 3ZZIA 3DLAA 3M3YJ 1YSJA 4XM3A 4GGGA 1XG1A 2FUG2 1WK4A 1E3PA 2X0LA 1SFUA 1TWAJ 2NNYA 4E6KG 4NF1A 3ULQB 3E0KA 2DO7A 4B4CA 5JM6A 2CU7A 2JEVA 4FCYA 4B09A 3G73A 4X8IA 2L8EA 4EJTA 1IV6A 3E6DA 1IN7A 2VE9A 2JA7J 3HRSA 3KP7A 1KUXA 2BV6A 2XRCA 2K9NA 1Z8XA 4BQOA 1IRZA 2ARHA 3IL2A 4M74A 1ZREA 3BTIA 1HCRA 4KUBA 2AXLA 2H09A 1ZGJA 4MNUA 4OMEA 1VTNC 1QA6A 2LC2A 1TKJA 3K4CA 1KZFA 4EMSA 1U8RA 2B0UC 1JTYA 2RNJA 4HPSA 2LMDA 2Y9YA 1SGEI 1CX8A 2LY1A 5D4RA 4B43A 1UVGA 2IQ6A 4UFVA 1Q1HA 4ZTJA 2P6AC 2K9HA 3VATA 1MNMC 2B4BA 1HQCA 1BI0A 5DDGA 4RMNA 3TFYA 3WG7H 2CV0A 3B3SA 4U88A 2OBPA 2GLOA 1O7LA 3F22A 2WTEA 4RLFA 3Q0UA 5CVUA 1TQMA 5E18F 1HF0A 2ZXHA 1RNLA 4HSTA 3EY5A 1LE8A 3VSLA 5GAEJ 5ICCA 1I39A 3JRFA 1IDYA 1OR7A 2AFOA 4UY8I 4JLYA 2VASA 2GKVA 2F4IA 2KRHA 2VC1A 3OYBA 5FFXA 3FHNA 3CDXA 3GMEA 2JA8J 4MHNA 1TC3C 2PDOA 1QSNA 1LEAA 1T08B 2ADUA 1APLC 3T0YA 3TDUC 1AUGA 4OIDA 2H6BA 2CY2A 3QWPA 2F2EA 2PFBA 1BW5A 3CZ6A 2FXAA 4NJQA 4CDGA 2H5MA 1UHAA 3PJRA 3GCMA 2A20A 2JRMA 4EATA 1IRGA 3RU0A 4B6ZA 3SFIA 2R5ZA 4P4BA 3WU0A 2BY0A 4C3JJ 1QSOA 1YVOA 2KRCA 1R5ID 4KN7X 4LQ6A 3S3OA 3QP6A 3F6OA 2FSWA 3OYKA 1LR7A 1LVKA 3B2YA 4R57A 2LY2A 3KKWA 4KLVA 3QODA 2IGKA 1ETKA 4B3AA 3M1EA 3WABA 4YFJA 4P9UA 2HS5A 4R3LA 4A3EJ 4K3NA 4YG2F 2V6EA 1CGII 3TOAA 4UCMA 1KA8A 2HQRA 1LCPA 1NK3P 1Z5RA 2VXDA 1X1BA 1WH5A 3MAJA 5F08A 4O23A 2R7TA 4NGMA 4PPZA 5HODA 1WJ5A 3OYEA 2F5EA 2QYOA 2PJAA 1HW1A 5EC4A 2OA4A 2ELJA 1RFHA 4C3HJ 2CSOA 4UBRA 5E3OA 3PNTA 4KT5C 2R7RA 2HFHA 5K5RA 1Y39A 1EJ9A 3N7ZA 3I4MJ 2CWHA 3T8RA 3DCFA 2OV7A 5HDKA 1N75A 5LGUA 3JUWA 3CLOA 2W24A 4AVCA 4P4EA 1S5LC 5F48A 3AG1H 1ULKA 5EEGA 3CPAA 3I0TA 3TO6A 2PQ8A 4M6HA 4M85A 3K4NA 1ARMA 2ZW6A 1VQ9I 2FJ1A 4Y52J 3FWEA 2KJBA 1DQUA 1DU0A 4KMFA 1IY7A 3LSJA 5BOXA 3L00A 2UVOA 3B02A 3F8CA 4JZ0A 1K6OA 2XSDC 2GLJA 2L7ZA 3OXLA 3D3SA 1U5TA 1HPTA 3SFZA 4CYNA 2QM3A 4OC4A 2WCYA 2X6YA 4WXHA 2CXAA 4DBRA 1T39A 3R5DA 1Z3YA 5C4XJ 1TTYA 1MJBA 2DMQA 2QQEA 3FM3A 3OYLA 3ZQGA 2ZNZA 1MNEA 3BR3A 3R9GA 4V2FA 1N13A 4LX9A 2UXNA 1JUMA 3HSFA 1U5KA 1GDTA 2LDUA 5E8GA 1CBXA 3TW7A 1KQ8A 2IGNA 2QLZA 1TWHJ 3ESWB 4LG0A 5DWNA 1RTQA 2QVOA 5H84A 1E3HA 1YTYA 3M9AA 3JTHA 1Z7KB 2L2OA 1X4SA 5L3EA 4LQGA 3GIUA 2PRQA 4XBFA 1BN5A 1O3RA 1ON0A 4ENJA 5DWMA 2C6PA 4FX4A 2ZW4A 3CCJI 3PB9X 1CF7B 2PJRA 3H9QA 4RAYA 4FD6A 1E17A 3A1YA 1ETVA 2DB6A 3OL4A 2KIQA 2P6EA 3G4SI 3B35A 1LFPA 2J87A 3FXTA 4KOUA 4N0BA 4MGRA 3LSKA 2Y2ZA 3IWZA 4PJLA 1WGCA 2GXAA 3DSBA 1TGSI 4FWUA 4F91B 2VOOA 2ZJ2A 2GE3A 3G1LA 2VIXA 1XN7A 7WGAA 1QQ9A 4LIVA 1JHFA 2HZDA 4HPQA 3KP3A 2C6CA 4CYOA 1H0ZA 2PVWA 3H0DA 4G7HF 2B4DA 3MZ8A 1DDNA 4R3KA 1GXQA 2DFHA 3DTEA 1USTA 3QQAA 4NGSA 4RBOA 3F8NA 2EPFA 4RAGA 1PP7U 5HI7A 2B3VA 2XKOA 3I4NJ 3TP0A 2Z2SB 3BG7A 5DD8A 4LMYA 1YW6A 4B5OA 2O3FA 2BW3B 4U0WA 1ZTRA 4HSRA 2VJ5A 4LGWA 1K7UA 2HOEA 3G6EI 1ZR4A 4CYCB 5EMIA 2E2HJ 2VUMJ 4F92B 4BU2A 3GZ6A 3I56I 2SGEI 3DEEA 1G3TA 4OIQF 3K4KA 4CCMA 3CXLA 4GM5A 3DF8A 1P2FA 1QO0D 3OV8A 1RUNA 4WF2A 2ARPF 5JHUA 3FC3A 5ISVA 5K1YA 1TQPA 3HC7A 2WYRA 3IGRA 2E71A 1XBUA 3CMMA 3N97A 1YU6C 2ZXVA 3K9UA 3Q9VA 2Q1ZB 3RI4A 1XF8A 2ZELA 1PTQA 2CFXA 1FOYA 3S9LA 1TBNA 3D00A 2HUZA 1D0ZA 3S93A 1FYBA 4BKXA 1Y1BA 2CS3A 4BDYA 4NGTA 5THWA 1LVAA 3G71I 1TW2A 2HQ5A 4MFDA 3SEQA 2HV2A 5FKOA 3W6KB 3ERED 2DDBA 1JQGA 4H89A 3OS1A 1MMGA 4XLFA 3OYMA 1V1IA 3FMRA 1EV7A 2R4GA 3OYGA 4KFCA 2HI3A 4M6IA 5HVGA 4ORFA 2YNCC 1SGYI 1OBRA 2EV6A 2ROWA 5LRJA 1IXCA 3CUQC 2QKLB 1I5ZA 3EFAA 4JOMA 2TRTA 5HLIA 1D0YA 2R5ZB 4KSIA 4WXDA 2RFHA 2AHQA 3I64A 1K79A 4Q36A 2GKRI 2EFPA 2KFDA 3DPTA 2XGEA 1TL8A 1HXDA 3QU3A 4F7ZA 1CG2A 1VGYA 3FJUA 2YS9A 1PYVA 1X2NA 3RZOJ 4UV9A 3F5BA 2E1MB 2IA2A 4A0YA 1ZQ3P 1I1DA 1B6AA 2L54A 1WI9A 4XONA 3HIFA 4AIDA 1TBXA 1FPQA 3JRAA 4HDVA 5HOOA 2LYCA 3D68A 2FF4A 1YQAA 3ZMZA 2LKPA 3WTZA 1CT0I 4ZY2A 1O57A 2BW3A 3VWEA 4F0XA 1T95A 2A6HF 3PDNA 3UGDA 4A3CJ 1P6RA 2FX0A 2JA2A 4C2TA 1WHUA 4XMYA 4M9ZA 3WGGA 2O9LA 3HOWJ 2QSFX 2BVMA 3HOTA 4PFPA 5DUKA 1XRYA 2XEFA 5DS9A 1IC8A 3W2WA 4CA0A 2ABZA 2L3DA 4J3GA 1ETQA 2HZTA 2KLOA 3M1CA 4CO8A 4M71A 3K1MA 2EK5A 3S3NA 2PIYA 2KMOA 3O2PE 3GYAA 1TF9A 2RB7A 3GTLJ 4BY7J 2CG4A 2R7OA 2Z1DA 4NUBA 3JAMK 3WTXC 4B1RA 4KN4X 2F7VA 4YFXF 3ZQQA 1O3TA 2VOPA 2HQNA 2LRDA 3FXLA 2WADA 2R7QA 1VHOA 3IKTA 2LKXA 3TTHA 3ASNH 1UJ8A 2OD1A 2FEZA 5FLVA 1S7KA 1HSTA 5HLTA 2O28A 1NH3A 3T8TA 2O6GE 4UHTA 2PJ1A 4PK2A 2KT0A 4BJ5C 3L1PA 2R7VA 1KBFA 3QOEA 3JR9A 6CPAA 4II9A 5CQGA 2NU0I 5E96A 1XCVA 4ENMA 1MNDA 2ZCWA 4IHXA 2QJ8A 4MHZA 3DNSA 2DMNA 1A31A 2WVJA 4MPIA 3NFZA 3LA7A 2W4SA 4G1PA 1IDZA 4X5KA 1E2XA 2VXZA 1K7VA 4UVAA 2E7WA 4M3BA 2AFUA 3B6AA 2KRFA 1LJ9A 3GXOA 4FHTA 4NC6A 4OIRF 4M6XA 5DTDA 5ILUA 3MWMA 5D6FA 3VB2A 2QSHX 1VFCA 4XKBA 1JUSA 3K2KA 1IF1A 4MFZA 3DR8A 4FKDA 3KQXA 4PXEA 2X4HA 3IAS2 4NQWB 1HJAI 3JAMZ 1B87A 1TIQA 3G3SA 2VI6A 1CPSA 1HDQA 2XEIA 3I1UA 1N77A 2A68F 2VN2A 1UMQA 1MIJA 3EDPA 4EJOA 2L7XA 1RKWA 2XKPA 2XPWA 2NS0A 1RRJA 2QQBA 4ENNA 3LA2A 4L9VA 1AMPA 3OYFA 4Q7AA 2CMPA 5LYFA 4RI1A 3TGNA 5B66C 3NE7A 1IO2A 2RNGA 4G9YA 1YHQI 1EA3A 3IP4B 5JQ4A 1SMYF 5F0FA 3SEZA 1W7PD 3SZTA 2HC9A 4JYKA 4JD6A 1OYVI 4P4DA 1J9IA 1O3SA 2BUEA 2CQXA 3RYRA 2FVGA 4ASNA 2ZJQF 5CCLA 2DT5A 3HLPA 4YRHA 3PFEA 3W3CA 1Q2CA 2ENNA 3PL8A 3J80Z 1LUJB 2ICWG 1NK2P 1ZGWA 2EWNA 2ID3A 3FX3A 2IRFG 1Y9KA 2GU2A 3RZDJ 3KHZA 2PJ3A 1JKPC 3KQZA 4L8AA 1Q2DA 4IHTA 4ZYDA 1Y0YA 3UNGC 4RB1A 2V8HA 3GFJA 4RLQA 4QTRA 1Y8FA 4AIKA 2EIJH 2JA6J 4LLNA 4HNYB 3E6CC 5EX3A 3JREA 3FKJA 4E70A 4XSZF 2F5IA 5M3MJ 3K70C 4EVYA 3FXQA 3QYBA 2HOSA 2EILH 3QP5A 4BBHA 5AIPA 3GLXA 3MVPA 1R58A 4XKCA 3K1PA 2K27A 1LE8B 3BT9A 3MGDA 4B5PA 3QNVA 4GFBA 2YGWA 2XF5A 4XORA 4MEXF 2IA0A 5DCMB 4C2MJ 1L0OC 4UVBA 3H1CA 4XR6A 2R8VA 2VXKA 3A9LA 2GQQA 3IHUA 2CUJA 2JWTA 4M3SA 2E34A 1A6QA 2D4PA 2QWWA 3W6JB 1CJWA 4WWVA 4ZYEA 4OINF 3HH2C 3S6KA 1IN8A 3CCSI 5H20A 1O7FA 1YW4A 3RYOA 2G0EA 1YVKA 4MHGA 5IPAA 3SXYA 4A31A 2DQLA 4LK1F 4XRSG 2M0CA 1JKOC 2IW5A 4A3JJ 4NGPA 3QPTA 3E0JB 1GHCA 2VPLA 4Y4RA 3GTQJ 3E7LA 3P5JA 1S7NA 3MQ0A 3FBUA 1X3ZB 4ZYGA 4DYCA 2IMOA 2XB0X 2DJIA 3L2UA 2R7XA 1YW9A 1K7TA 2ORVA 2XAFA 1P7JA 3LSTA 1I1SA 4L89A 4KS9A 2HDWA 3HYIA 2M2EA 2X1CA 5K5QA 3HJEA 2XASA 5D8NA 3T5XA 4DOZA 2FMLA 2E2IJ 3KR5A 4C9YA 4LITA 1SGQI 1F43A 3WE2A 3ROUA 3A0HC 3I59A 5EGOB 5M5YJ 1R1TA 2VJ4A 3BQZA 1XMBA 1QNTA 2FNFX 2M0MA 1DTDA 4HOBA 2WPXA 4U9ZA 4PSXA 1M1EB 3B4VC 4UCPA 4G6DA 2Z16A 3WODF 2V79A 2AQFA 3M8FA 3IRQA 2MC4A 1F4KA 3BR1A 2KMPA 2AFSA 3B7IA 2CWGA 1YQEA 1QVTA 4E1RA 1YW8A 4N9IA 4CH7A 3DLLF 1B59A 2ZXWH 3BY6A 3PSFA 4L9JA 2YU9J 3WTVC 1ETYA 2DT6A 3ABMH 3CC7I 2KMQA 1JI8A 3SI0A 1Y8RB 5CVJA 1AWCA 3TJQA 1F2OA 3EUKL 2AFXA 5IB0A 3CC4I 2J5PA 3F9KA 3FRMA 3E97A 5F1JA 1VHEA 4HDUA 3I54A 1W5TA 2ZFWA 1SD4A 3RO0A 5LRSA 2OTLI 1VIXA 1YREA 3ZMVA 2E35A 4IF4A 4M3GA 1H89C 5KNLA 1LAMA 4NQWA 2K5TA 3NE8A 2O8XA 2K5CA 3G2BA 1S8NA 2E1MC 2IP2A 4A3DJ 3CD6I 4HV6A 3D7FA 2CFOA 2NOGA 2VBWA 5B5EC 1M4IA 3NH8A 1IGBA 2PLYA 5DUIA 3JRDA 4BY1J 1YMEA 4NJRA 1WRJA 3ZGKA 1IN4A 2VQHA 1JKRC 1QGPA 3CCRI 4F52A 1FJLA 3ZN0A 2WAFA 3V8JA 2W57A 1WSUA 2R93J 1AU7A 1QZZA 3MKYB 1WWZA 3R96A 4I2OA 3R5AA 1OKRA 3HOSA 3ISPA 2E7XA 5AG6A 1YJ9I 2JMWA 5LEKA 2XEGA 2EFOA 3IH4A 5CCMA 2AO9A 2TCTA 4MI4A 4IEJA 1MMSA 3N4MA 1Z4EA 1D1AA 2BZTA 3MEXA 2YSRA 4RDUA 1D5YA 1XMTA 2GA1A 2PMHA 1WI3A 2EH3A 4HYEA 4ON0A 2D45A 1XIXA 4AG7A 1BBYA 1DE4C 4FUUA 5M3FJ 2DPDA 2O5RA 2P5KA 2DYRH 1IU8A 2BGCA 1LOKA 2ZSHB 3JW4A 1RXTA 4YGOA 5G22A 2K9SA 2N52A 4MCRA 5J4VA 1BA5A 4OADA 4U5YA 2BY3A 1YLFA 3DEWA 4OVOA 3BG9A 3VDPA 2UV1A 1H88C 4NBQA 3ZMDA 4YFNF 2L9SA 3HOXJ 1BIBA 4G7ZF 2IBDA 1QRYA 2DMTA 4BHPA 5J47A 1X1DA 3ZQIA 1KU7A 2CQKA 3C1DA 1WZ2A 3D0SA 4MLOA 5IT3A 3PRTA 4UUTA 1S72I 4A38A 1VQ4I 3CZXA 4B10A 1LPQA 1W1WE 4L5EA 1XGNA 3I71A 2WAQA 4XLCA 3CCQI 3DPUA 4UWJA 4FASD 2HDCA 1D5VA 1R0RI 3RBUA 3F72A 2FXFA 4A94A 3UGIA 1ZRFA 4JYWA 3ZJ0A 2M7AA 3T90A 5KHDA 2JPBA 3V4GA 1D8JA 4HF2A 1ON1A 1SD5A 4LG3A 5HS7A 4S04A 2FS5A 3HKZA 2ESHA 1LFWA 4B5PB 2UZKA 1U9OA 2OTJI 1KU3A 2R7SA 3GTJJ 1CQTA 2QCOA 5E1WA 5BS6A 4NGRA 2WY8Q 2FOKA 2UUZA 3SI1A 2GANA 2X52A 2N8GA 2CTCA 3D7DA 1TLHB 4A69C 2OZHA 4BDZA 1MZBA 1XCBA 2UZ3A 1B72B 2JVHA 3P2FA 3ZQCA 5LEJA 4PUSA 2PJRB 2OCEA 4DW6A 1Q2YA 4I98B 4GRIA 3TT2A 4F0YA 3OY9A 2MLGA 2CW7A 3T1BA 2C6YA 5LHHA 1S3ZA 2IPQX 5LYLA 2HEOA 2G7UA 3N05A 1XD7A 5CVIA 3I58A 5HDGA 3RKWA 1BC7C 4IAVA 5F09A 1FTZA 4BJ6C 3RJPA 3PO3J 2GLFA 2W00A 3C2BA 2YX7A 1YITI 4D5CA 2KIFA 3KEOA 3IRRA 4OIOF 4FISA 4A32A 2GREA 2NU2I 2KZVA 3FMQA 2PJ9A 2L02A 1F9NA 3BTCA 4XPLA 4CGMA 2L0KA 2FIAA 4HBLA 4M9SA 1HKSA 2WY7Q 1A04A 1HKQA 3QWLA 1FNOA 4A3FJ 2XVCA 2LH9A 3GY9A 3K2AA 3RPQA 3A0BC 3BR0A 2IS1A 3S1NJ 5TJJA 4MFPA 3M8JA 5FFZA 1SEUA 5FRNA 4BXFA 2HYGD 3JRUA 4IUSA 5AGEA 2DEAA 1SGPI 1WJAA 4L0ZB 2JA1A 4NC7A 1YS6A 3K4BA 3LODA 1OCTC 1J4JA 4Q5SF 1ELMP 1IOFA 3D2PA 2MH2A 1PJRA 2CGPA 5GCNA 1IW4A 2W0TA 5K7FA 5K8NA 3NWTA 1A36A 3BLYA 1XGOA 3U9GA 4A0XA 4H0EA 3SEKC 1CE3A 2Z3LA 4IZZA 1TXRA 1BI2A 3PQKA 2DOEA 3ECHA 2CUFA 1TWFJ 2UXXA 5KVRA 4Z2YA 4HZFA 5HLGA 2L9NA 3JTGA 1IN5A 3GTOJ 1ZKGA 1EE3P 4PCQA 3PIOF 3FK6A 5JVGF 1OCCH 4EM2A 2J8MA 1B8IA 3BWGA 5F04A 4EGZA 1JWQA 1IGNA 3BCAA 2AE6A 2PMUA 4QB9A 1YG2A 3SJXA 3OYIA 2MW8A 4KIGA 3HZJA 2A61A 5ELYA 1Y1CA 4YELA 5ICEA 3W2VA 1KYWA 4E1PA 2LOOA 2IGMA 3FXMA 4O5VA 4AWXB 2O61A 4KIBA 5BNGA 3E3VA 4MFEA 3RQIA 2LP0A 4EJVA 1VQMI 2QQ0A 3SGBI 4HNTA 2F5FA 3NWSA 1F2PA 2OPTA 3BROA 3KEYA 4R8HA 3A03A 2IGOA 2IEKA 5AG7A 1FYLA 3RKXA 4IRHA 2FE3A 1FC3A 4CXFA 1R6RA 5AIQA 4S05A 1YI2I 2R7UA 2ERWA 4WP4A 4NFRA 4U7DA 4A6EA 1HOMA 2VZYA 1YK3A 2ZO4A 3I9V2 2M34A 2QF7A 4KICA 3DKYA 2VODA 1XGSA 5KAIC 2FNAA 3L2RA 1EKEA 3R9FA 2LF8A 4IRGA 4XIDA 2VBZA 2QKMB 3RAMA 3FISA 2Q2EB 3D8PA 3QYFA 4A3GJ 4MCQA 2PMZA 3LQRA 2W84A 3DDDA 3WU2C 2DFIA 1XMAA 3COAC 2QPOA 3KEQA 2BY2A 2XIGA 2LG4A 5FRMA 5FUYA 4P4IA 3FBIB 3WE3A 4OWRB 1DP7P 5FO5A 2IA1A 4MMOA 5FLXK 1Z2LA 5CVVA 2CJJA 4DBQA 1SFXA 2E19A 2QVPA 2I79A 5D8LB 2OH1A 1U3EM 3DKXA 1SMTA 1JE8A 3FZVA 3I59B 2JSPA 5FKKA 2QENA 4RAFA 5EGOA 4J01A 1T6SA 2Z9OA 2DOFA 4AC0A 3J80K 4XRMA 1FP1D 3ZR8X 4HX8A 3LSGA 3BCBA 4MJ8A 1ZG9A 4I01A 4A2UA 3E5QA 2EBJA 4H6UA 5K7ZA 3SGQI 5KTCA 4EJWA 5D5VB 4TNUA 4AG9A 2QQAA 3PSIA 4HQMA 5E3LA 5L3CA 1PCAA 3KR4A 3VWDA 2IVMA 2AFMA 4KOTA 5DCMA 1XDSA 2HPMA 5F64A 3D5SC 3KZWA 2BCOA 4L5JA 2STWA 2P7CB 2R98A 2X6XA 1S6LA 1B72A 4BHBA 2MGQA 3H9JA 2NS8A 1VQKI 1FTTA 1SVLA 2FBKA 1FIPA 3S15J 1SFEA 4RB2C 3D4UA 3EUHA 3H8EA 4HLYA 1MT1A 2Z0ZA 3PBBA 2X85A 2Q7BA 4NXYA 2RREA 3DU5A 5CYVA 2AS5F 4PZJA 2RIJA 4IQJA 2MYSA 1M44A 4UEFA 1I6XA 4IX7A 4W97A 4XLNF 1K61A 1P9QC 2O8KA 4ZJZA 2Q43A 2VBXA 2Q8KA 4MBUA 4J19A 1I27A 4BE1A 1NHAA 5D6EA 3I3GA 5A27A 4LLLA 3BZKA 1IG7A 4L0YB 2N17A 3GTMJ 2A07F 3FB3A 4JXRA 3OOPA 3RKYA 3AKZA 4ZDLA 4ZYHA 3NAUA 1XX6A 1NE9A 4KMUX 1YRNA 1FEXA 4WWCA 1XJOA 2V8VA 2WUUA 4Z65A 3O6BB 3HEFA 4GCVA 2PI0A 2Q4ZA 3C26A 4EQQA 2XPVA 2Y0SN 3S32A 1V54H 3OYHA 1L3LA 2K3FA 2IS4A 1F5TA 2GFQA 1Z05A 4M73A 1FBUA 5LBQA 2WB1N 2NOJB 4G6QA 3PO2J 2G0BA 3EPZA 4EJUA 3DBHB 5LLQA 2NU3I 1X1CA 5E1XA 2NVXJ 2QSGX 1M8CA 2EZHA 2DA7A 3FK7A 3E1SA 4RB0A 1UG2A 3VARA 2R7DA 3HOUJ 1MK4A 6PAXA 1SD7A 4HQEA 2NMTA 4KVOE 2Z5UA 2JDDA 2KMRA 5JHWC 3CJQB 3F8BA 2KCXA 5BQTA 1FWZA 3NH4A 1U9NA 1KZHA 5DM7F 4HNXB 1WQ2A 2DLLA 1W0UA 2P81A 5GTHC 5BPIA 1FNNA 2NYXA 1REPC 1X19A 1IV8A 2A69F 2V26A 4ZYQA 1QHHD 5FROA 3O8GA 3SXOA 3FYNA 1WGXA 5ERIA 2ZB9A 2H8RA 3BI0A 1O3QA 1S9HA 1ELLP 1T0FA 3FM5A 3T9YA 1ZRDA 2DAOA 1R1UA 4XOPA 1Z7UA 2EZLA 2BE5F 4DJAA 1U2WA 2AFZA 4A33A 4OC3A 2M3AA 3OIOA 2EZIA 5F6FA 1RUOA 2PVVA 4F8ZA 1LAPA 3GFMA 4KSFA 1CP7A 1VI0A 3WTTC 1IUFA 1Y56A 5F46A 2K3PA 1YO5C 1YRNB 4NGQA 1R7JA 5C82A 3CUQB 1G59A 3PUBA 3GZ5A 4CUGA 2OF7A 3LSMA 3J7AO 4I02A 1W36C 2CNTA 2WAEA 2F3CI 2VL8A 3CMAI 2QECA 2PX9A 4B13A 2WAQN 3LA3A 1OLTA 1DGRM 1ETWA 1MBKA 1QHGA 4AVZA 3WGIA 3S9NA 3GYHX 2BUSA 4MRIA 1T2KA 3GTPJ 2M1BA 4ZC3A 2H8WA 1YFHA 4FBEA 3UKGA 4CGZA 1N78A 1AOYA 1BJAA 2DMUA 2Y48A 5EJCA 1CF7A 2Z33A 2PJPA 1AHDP 1FP2A 1IZ1A 2Y0MA 3QOPA 4A3LJ 4ONUA 1TF8A 4E8OA 4G8XA 1ETXA 4Q4ZF 2XAJA 2DMPA 4HA8A 3MFKA 3GLJA 4MEYF 2PSWA 1OCRH 1IRXA 1EH6A 1B4AA 3WR7A 2O03A 1YE9A 1SAUA 2K4BA 5TISC 2ETHA 2JVGA 1R5HA 3TO9A 3GX4X 4P45A 5HLHA 3J7ZI 3QTLD 3ISZA 2MH9A 4KORA 2ECCA 2ELKA 1TP4A 2OQGA 3HB9A 3TKYA 2PJ8A 1XSVA 3KGQA 4S0HB 4PXBA 2EFNA 1U5TB 4G6TB 4XKVA 3VYTB 3MZHA 2KISA 3H5RA 1HA8A 4HF1A 4M6GA 2F8HA 4PJJA 3PFYA 1KYZA 4II3A 5J40A 2EVNA 3B3TA 4PGGA 1EH7A 3DQVC 4SGBI 4UWIA 4CAXA 1IYKA 3FX6A 2E1CA 4N4OB 4A39A 3DTKA 3Q9SA 3ZPLA 7CPAA 1R49A 3EC4A 3FF3A 2LUYA 3JRIA 1FMWA 2HTJA 4A24A 3CCEI 3HOZJ 2KZGA 1RR8C 2WZNA 3LNQA 1XFOA 1W0TA 1G3SA 1SVOA 3D5RC 5EG0A 1T56A 1S7LA 4O3MA 3RKQA 4E0AA 1YLOA 3ELKA 2GOMA 1TBOA 2V9PA 3V8KA 4ZH4F 2V1NA 4AXVA 1Z21A 1WJCA 3DBLB 5EF6A 2F6CA 4EM1A 1M1DA 2ZEOA 1XSXA 2BEIA 1M4DA 1UUCA 2VE8A 3EO4A 2JUGA 2L7FP 1MJ9A 4I76A 1VQNI 3R0AA 4GYIA 4MFKA 5CPRB 1FIAA 2YNEA 5TGTA 1GUUA 4CS0B 2DA1A 3FIWA 1G6NA 1MGTA 4KT6A 5JVTA 4L9TA 5FLXZ 5C3EJ 1MDMB 4C3IJ 1WWXA 1N71A 2J9AA 1M4GA 3G1MA 3L7WA 1J0RA 3BG5A 3K2ZA 4UCNA 5FKNA 2KDZA 2XROA 5J4YA 3L2NA 5GP9A 1RZ4A 2BOLA 1KWMA 2NNNA 2FIWA 3K0LA 3LOCA 3OL0A 1G2HA 4D1QA 1Y0UA 1X4OA 4XLEA 3JRHA 1LEBA 1ZARA 4P6YA 4OAZA 4A30A 1PUFB 2COBA 2LVSA 2ZKZA 1P9ZA 5E3RA 2PEXA 2GA2A 3HSRA 3OSFA 5FUXA 3WT4A 3W2AA 3BPVA 4D7MA 5A28A 2SGDI 2FRHA 4CRYB 1ZGAA 1TBQR 2OC6A 4A3BJ 1IYLA 2CIJA 3CCYA 5HS8A 4TWEA 5EZGA 5E3QA 1X58A 4IO9F 4G7OF 4PQAA 1YX0A 3BLNA 1XGMA 1NTCA 1Z9UA 3QAYA 5D8KB 2Z3MA 2NRAC 3L9FA 5LHIA 2ZEHA 3K69A 3SJGA 5JHFA 1B1BA 2RGVA 4IXAA 3KX2A 3CMYA 2JLMA 2ATRA 3GVAA 1X3WB 3Q0VA 3JSPA 2ZFUA 2RC4A 4HG2A 4LD5A 2JTVA 2F5VA 3E59A 3GZNB 4QPQA 2SGQI 2M87A 3H3VK 2ODDA 4Q48A 1NG7A 3NQOA 3FXUA 3FDYA 4ESBA 4F9VA 2FOWA 4ESFA 4UXIA 2M4GA 4XSXF 4IKFA 1QSTA 2YU3A 2Y31A 2JJ7A 3H3ZA 3J7YJ 1HC8A 1SGDI 4C7IA 2LR8A 2EJRA 4CHUA 1DS2I 2E73A 4DNCA 4B6DA 4XN0A 3KL9A 2CH0A 1XOVA 4BBRJ 4AIHA 4DQ2A 1CGPA 3S6FA 3CF2A 3KZYA 3M8EA 5D29A 1KUYA 4C2XA 3GTKJ 1R79A 2Z3KA 2CRGA 2DA4A 2CYYA 3MKLA 4ITVA 3FXKA 2XEJA 4RN7A 2B4DB 4ZDOA 3BJAA 1Z6RA 1JXSA 1Z3XA 2JZMA 3H3UA 4XOTA 3CCMI 5K8PA 3KETA 2Y30A 3RPUD 2FT0A 3R1KA 2N1AB 2JEWA 4HNVA 2XAHA 3S1QJ 1S60A 2LFBA 4E7ZA 2OR4A 2DA3A 1BPNA 5IX3A 2XHKA 1WJEA 2DIPA 1K78B 3GWZA 2EV5A 3ABLH 5F0HA 1NMTA 1HEVA 1Y9WA 4PXDA 4XLHA 4CZZA 4XNHC 4OIPF 3PQJA 3H4QA 1Z6TA 1UAAA 3DP7A 2Q4YA 2QQ8A 4B14A 1UWYA 2RQQA 3UOEA 2YUSA 1DPRA 4B8XA 1OCOH 2LF7A 1Y1WJ 3PFOA 4NCZA 1VQOI 2DXQA 2FL4A 2CV2A 5CKTA 1UHWA 3V7RA 2DK5A 5IT9Z 4K2EA 2NXNB 3R60A 4B44A 4LG0B 1CPXA 5AG5A 2YX4A 4E4HA 2D2WA 3JRCA 2J8RA 1XEBA 1E3OC 4ZDPA 1DS3I 1OJLA 3F21A 1SAXA 2Q04A 2AJ6A 3Q5FA 4E7LA 4N4NB 4YWYA 3DBRB 3ASOH 1OFCX 9ANTA 4LB6B 3VYSB 1WKMA 2R7HA 2E1OA 5CJ9A 4UF4A 1ZG3A 2HKOA 1BI3A 4M6YA 2LK2A 2REFA 1WTJA 1S7AA 3AG3H 3FF5A 4IL6C 1OMTA 1JT0A 1R4MB 3OYAA 4I6ZA 5BMZA 1FYMA 1PJUA 3IAM2 1UFMA 2G3TA 5I0CA 1H8AC 5C44J 3VWBA 2Z3NA 2X48A 3V8LA 4OC1A 4XPDB 3HPGA 2QEXI 1MMAA 4ZX8A 2Q2EA 4DYQA 2FBHA 1BJZA 5K8MA 5LRKA 4IK2A 2X51A 3DR6A 2AXTC 4XICA 4NGNA 2CQNA 4F93B 2ZBKA 1M8BA 3B8GA 3ZOBA 2GVIA 4DJLA 1OYWA 1U0JA 4RUHA 2GXBA 3D5LA 3O8HA 1XMKA 4R1HA 2VB6A 1ZO0A 2VJIA 3TCVA 3CT9A 4B12A 2E5RA 2CWFA 4IVNA 4JXQA 4ZZLA 3LD2A 1UHMA 4OLLA 1ZYRF 4UB8C 4P5OA 3KP5A 4X0GA 3QAHA 1SGRI 1K78A 3BJ7A 4FD4A 4ZBGA 1LFUP 4HAMA 2CNSA 1SQHA 5C4JJ 1G4DA 5J8FA 3I5UA 4RA2A 1ULYA 1IXSB 2XDVA 4EEFG 2JZYA 3BG6A 2NVTJ 1UHSA 3CTAA 4AM3A 2P6FA 4CYDA 3OSGA 1UVFA 3SJFA 3J7AY 3IKVA 4CICA 4JX4A 3FHZA 2P7VB 4EGYA 1IN6A 2NU4I 1B8IB 3GLLA 2OU2A 2WWYA 3RNZA 2EIKH 5BWAB 4UUVA 4E7HA 1YX5A 2J8NA 2Y0SA 4PJNA 1K83J 1FBQA 3TO7A 4JX5A 2D5VA 5LRRA 4ABZA 1BAVA 4R8FA 5FD6A 9WGAA 4A12A 2N71A 4U0YA 2VQGA 2DA6A 5J3LA 1VQ7I 4IOAF 1P9GA 1V0CA 4A0ZA 2HWVA 3HKZN 5HS9A 4BJTA 1ZN2A 2XRLA 1XC5A 1TBRR 1Z8WA 2JA5J 2ESNA 2O0YA 1EH8A 1Z1DA 2OZUA 5LYDA 1OCPA 1LDDA 3CCVI 2HU9A 4ZYAA 1KGSA 2EQRA 4BINA 3MEKA 2QIRA 3NEUA 4Q47A 4GO1A 3OS2A 2RDPA 2H27A 2K7LA 4LUAA 4MIMA 2ZXIA 4AVAA 2ZNYA 4FE4A 2PJCA 5K8OA 1IB1E 3P7NA 3H36A 3JCUC 2ZEMA 1S7EA 5FD5A 5HVQC 4C2YA 3B73A 4ONWA 2M9HA 1H9TA 1J59A 2VC0A 3H9GA 1S29A 4O6JA 4WK8F 1GV2A 2G9WA 1O4XA 2K40A 4HV5A 2P6TA 4PK3A 1G3WA 3U1KA 1DUXC 3OXFA 1BR2A 2E36A 2ZMEC 1BOBA 3UY5A 1ORKA 3BOQA 4OKOA 4R9MA 2EA4A 2CO5A 2QUFA 3F0CA 3GW2A 2CV1A 1ULMA 1PUAA 2B63J 2PJ0A 5ILSA 1YIJI 3P2HA 5C88A 4Y49B 2V6CA 2DN0A 2P0WA 3SHFA 3ISXA 2ZSIB 1GXPA 1T33A 3KI9A 3B3VA 4PV6A 2QA4I 1RETA 1GT0C 4BEHA 1F57A 1W7PA 2VPRA 1G3YA 5GPAA 3PP9A 1MKMA 2LBFB 4XNHB 3FBNB 5FKLA 2XC7A 2CTBA 1LR8A 2DPUA 1J75A 5EZHA 2ZJPF 3AFHA 2H6CA 2IJLA 4YEJA 4UIBA 1ACIA 3V38A 3IUOA 2KDOA 4KYWA 2POKA 4UEEA 1H9GA 1Z67A 3TOBA 5F49A 4KOYA 3HBLA 2XGXA 2HYJA 2JW6A 3GTGJ 2DPTA 5LGTA 3GUDA 1BO4A 2O53A 2DKVA 4UXJA 3VFZA 1STZA 2Q0OA 3OL3A 4BBSJ 4DUKA 3PZJA 4U87A 4NSQA 2O4HA 4X2TA 2FQ3A 2NU1I 5JLXA 2P6SA 4BS9A 3HG9A 4KA4A 1FY7A 1V3FA 2CQ7A 5J8CA 2OOTA 4U7BA 4MQVA 5F47A 4CGOA 4HNUA 3KP6A 2DJNA 1MMDA 5E1ZB 4QIWN 4KZTA 3Q0WA 3MKZA 1DP3A 3TEDA 1HBXG 4RGUA 2DA5A 2DW4A 2VBQA 4M3FA 1LQ1A 1B6BA 2MD0A 1P4AA 2OB0A 2MBFA 4P55A 2NYQA 3CESA 4R76A 2CWEA 5DV5A 1MJAA 1P4NA 4B3XA 3OIQA 1YGHA 2BBYA 4KOSA 2MD5A 1T38A 3C7JA 3HUGB 2PJ5A 5L3BA 5ICFA 1Z8LA 4ZY0A 5EEHA 1P7IA 2QZ8A 3BZCA 3K7AJ 5IV0A 4H6ZA 5JR3A 2W85A 4IOCF 4WJBA 4BQNA 1ZG8A 2DK8A 4A3IJ 1RPWA 5IP6A 3CJNA 2ME6A 2JBKA 3L2VA 2QBYB 2MA3A 2KIUA 2F48A 4NNJA 3H92A 3N5FA 5H86A 4CGNA 4A6DA 4MY3A 1Y1VJ 2P6GA 2LY9A 2MG4A 2F4MB 2YUUA 2B8TA 2C6GA 3IWFA 3M07A 2PJBA 4MTEA 4BEHB 1ZK8A 1AN1I 3V42A 2HOTA 1LFBA 1SFKA 5GAGJ 1VKCA 1ZG7A 3FXOA 1FSEA 2R7FA 3LAJA 4IRIA 1NXUA 3H5AA 3KZIC 4R87A 4C2ZA 2Z99A 4RS2A 5DAEA 4CRZB 1J5YA 4EWTA 2COMA 4JCVE 2XPUA 1PYTB 1DGWY 2HXIA 4BYYA 3S9MA 2V1DA 3PGPA 1RR7A 3AL0C 2ZW5A 4UIAA 2B58A 4EMEA 2A5YB 4OAYA 4JJXA 2FMYA 1PVEA 4OMZA 4P96A 3VOEA 1QPMA 1W36D 4NDLA 3H0GJ 3KPHA 5GPCA 4KVXA 1IY6A 1IAWA 4HLXA 4KUMA 4IHVA 4JBAA 4H4KC 3LACA 1ETOA 3I3LA 4UUSB 3Q3SA 4MFLA 2K9MA 2TDXA 3LFUA 1W5SA 1XSDA 2JQ7A 1QZEA 3JSOA 1LDJA 3QU6A 3LSRA 3IWEA 2FU4A 1HEEA 1GLNA 1YW7A 2K9QA 1POGA 4ZI6A 2ISYA 2M4KA 1M4LA 1D1BA 2XAQA 4L9MA 2L7MP 4XLAA 5EG0B 1W4MA 1C0WA 4EFDA 3DU6A 4FETA 3HGYA 3CLQA 2A3SA 3JTKA 3BR6A 3S3MA 1Y0NA 2HGCA 2W1OA 3CCUI 2GKTI 1XBTA 2MLKA 3FEEA 5L3GA 2KPMA 3HSEA 5D5UB 1OMIA 2WBMA 1VZ0A 4V2GA 4DGWB 1R71A 3UEYA 3FMCA 3ZXSA 2BO9A 2ZEPA 3A4CA 3PUFA 3CJTB 2H1LA 1Z7LA 3PNVA 1VDDA 1H0MA 3CJRB 1V5GA 3BXMA 2DOAA 4E7SA 2ZOFA 4KOVA 4BQAA 2BHYA 2SGPI 4PJ0C 2WPWA 4XKWA 4Q38A 2LTPA 1CSOI 3OIPA 3J81K 3SQNA 1J7KA 3RCOA 4AYBA 3HRUA 3PB7X 5GADJ 2BY1A 4XRSA 3DEUA 4AB7A 3F8MA 3CP8A 3IH2A 2JT1A 2XV4S 3F6VA 4ETSA 3D1NI 2EFWA 2BVLA 2EV0A 3V7ZA 1VF9A 1YTPA 5FVJA 1YR0A 2I5UA 3E5UA 2DXIA 1UELB 4Y13A 3FIXA 1XE4A 5D5XB 1HW2A 5FKMA 1MDMA 2VQYA 4R7MA 4CAFA 1DPUA 5F1RA 2B7EA 3PNYA 4YIIA 2CF4A 2V1XA 1UG0A 1R5GA 1ODDA 2M8EA 1Z8TA 4QVTA 4RGXA 3IU1A 5K5OA 1JKQC 2CJSC 2V1CC 4KUAA 2B9SA 4R6TA 2P5VA 4FAIA 4UUSA 1I3QJ 4BNCA 3G3ZA 4F3QA 2P5LC 5E3PA 2HNHA 5J1QA 3J81Z 3MCZA 2BYVE 2HDDA 3RZAA 4PDKA 2HTSA 5IB9A 3CQZJ 3KP4A 4IPAA 4IHSA 4Y17A 2B3UA 3B3CA 2HKXA 2LD5A 2OZGA 3DWLE 3WC7A 1PP8F 1BMOA 4LIUA 5KTDA 3ZQ7A 3WC5A 1AYEA 1Z77A 1K7AA 3MRUA 4DYOA 2L4MA 3PB6X 1YLEA 3IWWA 1VQLI 4X3RA 2VT3A 5HMNA 1AA7A 1NG6A 4QBJA 2Q7SA 3ZMUA 3EUHC 4II2A 2FA5A 1PUEE 1QMUA 1KU9A 2PJ2A 5CPAA 3OXGA 1S7OA 4G94A 1B9NA 4MCPA 2K4JA 2BXYA 3CXQA 1KBEA 2RVCA 5IOYA 3GKRA 2J9RA 3CUOA 4GXHA 1DU6A 2ZC2A 4RGSA 1MBEA 4P4FA 3LSPA 3CPXA 4Y49C 8CPAA 1TNSA 4RM2A 4AUXA 2LKSA 4CSWA 4CAVA 4KOWA 1Y0RA 1K6YA 2ID6A 2Z10A 1TZLA 4P4JA 3KHXA 1MH3A 2ACJA 1TWGJ 1I21A 3K9TA 4M72A 5J6XA 3GEZA 3IC1A 3VE5A 2FD5A 3EYIA 4DYRA 3QB8A 4HX4A 4I09A 2MABA 2ISZA 3HUGA 3OOUA 4YIFA 5I4MA 4RS8A 5HVFA 1OMUA 2V9KA 5EYRA 1QZYA 2M8GX 2R0QC 2DTZA 4IHMA 4OP4A 4MTDA 1I50J 3V7CA 2XF6A 3C2GA 3WTUC 4C2UA 3BR2A 4GDFA 5LGNA 3WC6A 1IJWC 4UXHA 3HTSB 2IXSA 2XAUA 3BP8A 3OR1C 1QVUA 1R57A 1Y7RA 4PGHA 2JDCA 3TL4X 4BH9A 3CCLI 1TT0A 3RDIA 5M5WJ 2JUCA 4RAZA 3RSNA 3ZMTA 1TUSA 5IP9J 4YFKF 2GZWA 4CCNA 1GV5A 1I6HJ 3K6GA 3KCCA 1Q9BA 1LNWA 1WCMJ 4Y15A 3W6VA 1NSAA 2K02A 2DT7B 2PBIA 1TNTA 5DD4A 5E79C 1HSJA 5HNFA 1ZR2A 5IYDJ 1EF4A 3OWCA 1HDDC 2VEZA 5B1BH 5LHGA 4F9UA 3EYYA 3G1OA 1OISA 1X2MA 2R5YB 4CGPA 3K4LA 5H6QA 3VYRB 3V8IA 3FXRA 3SDGA 2X7BA 3EXNA 1Q7LA 2NVUB 4MFJA 5JH9A 3WTSC 4UXNA 1ITYA 5IT9K 2JXDA 2NVYJ 3R6SA 1QSRA 3HXLA 3W6SA 1KONA 2F5CA 3KYDB 3X2QH 2B5GA 3CDLA 1FSHA 4NEXA 1KU2A 1R43A 2VKDA 2LSOA 4M9XA 5F0CA 3U2RA 2H1KA 5G21A 4NB5A 3HRMA 3CXPA 2L9VA 3LL7A 5FUVA 2G7HA 1GVDA 3DV8A 1R9TJ 3BPXA 1WVRA 3BQYA 5ED4A 1FARA 2PE3A 2HOAA 1WGTA 3ZMSA 1IY5A 4CGLA 2M45A 3OYJA 2Q44A 5B1AH 1E0EA 3VEPA 4RB3C 2OJED 2G9DA 3ZRGA 1TIHA 2D1HA 4H2KA 3LSHA 5JI6A 1P92A 1RESA 1FOWA 2ZMEB 1N25A 3KLNA 4LJZF 1K4JA 1X3UA 4N9HA 4GYGA 3IIBA 2VKVA 2ZENA 4A5NA 1CM0A 2BSWA 1Q1VA 4JP0A 1MSFC 1ERDA 2PC1A 2PR1A 1UZCA 1B9MA 3VDUA 2CUEA 2EO8A 3OMYA 3R5BA 1P0HA 1W5CC 3RIRA 4BGDA 4AIJA 3A02A 3M7GA 2QBYA 2C27A 1HDPA 2I3CA 3GUXA 4OOIA 1HLVA 1IUYA 2P4WA 2WGCA 5H2FC 1XMXA 2YR2A 3A01B 4LK0F 4UV8A 1JT6A 4IHWA 3ABUA 2KQRA 3CC2I 3K4JA 4QLCU 1TKFA 3RQ4A 2M5WA 2K86A 3WHCA 4PXCA 5FGMA 4A3MJ 3HPHA 3MN2A 2V77A 2M5XA 2A6EF 2HXOA 1SD6A 3CO7C 1XDUA 3D7GA 3R0JA 4JWPA 3KIOA 3FMSA 3I9SA 3RYPA 3KASA 4IF5A 3CP2A 2KHMA 3HDDA 3H8FA 2PJ6A 1I3AA 2R92J 3AL0B 2Y75A 5KCMA 1NSLA 3TC8A 2RQPA 3E6MA 4RGRA 2VT2A 1U8BA 5J1RA 1JJ6C 2ZOGA 1OQYA 3H5ZA 4LLGF 4RM3A 4OC2A 3KFWX 3B6CA 4YRVA 3UFFA 1XPXA 3HOYJ 3K4MA 4WXCA 4KOXA 4KIFA 3OWTA 1P4XA 5EEAA 4AU7A 4A5MA 2W48A 2Y9ZA 2DTRA 2DDAA 2I8DA 5LD2C 2XAGA 3HHHA 4C30A 2PCUA 5G20A 4OMYA 1A6IA 3IWGA 4PSWA 2VRWB 2E5ZA 5G1ZA 4R79A 1BW6A 2PJ4A 4NC8A 3SZGA 2B0LA 5BPDA 1SFOJ 1J2XA 4QSHA 2GXGA 4AVPA 1FT7A 4C7HA 2X3TA 2EK9A 3OR2C 1JJ8C 3JRGA 4DZJA 1ZLKA 5DCFA 4KNYA 3MZYA 2NS7A 4I0BA 3TDZC 4ESJA 1BIAA 3DPLC 3S17J 1MH4A 2PRBA 3BC8A 3AG4H 4PK4A 2GIVA 3C2HA 2JN6A 1FT9A 3HUVA 1G8XA 4KSAA 4WX9A 3BJ6A 1RIOH 3I4PA 3IFEA 5EDNA 2X6OA 1CT2I 1ULNA 3S6HA 1X10A 3L09A 4XK4A 1JUPA 4V19K 2VQLA 2V4JC 3QPLA 2W7NA 3LSIA 1I1GA 3NA6A 3R4KA 4KITB 3S1RJ 2C1CA 1TKHA 3H8GA 3U21A 3IV5A 4BQQA 2CUZA 5FJ8J 3CDIA 3CXSA 2O7OA 4HF0A 1Y6IA 4QPOA 2F4OB 3V7SA 5TRDA 4P10A 3JRBA 1WFXA 2ME0A 2BXZA 4AMLA 3RTRA 4CYCA 1XTAA 3H5NA 3HHGA 1YIOA 3KZZA 3HRTA 4KDPA 2LBFA 5HXDA 1BLLE 2Z3YA 1MBFA 3NRVA 1BC8C 2FNPA 2W82A 2ZXJA 1S5KA 3P9IA 2R3SA 3S14J 3M4OJ 3G8WA 2V1UA 2V53A 3DGVA 1TWCJ 2DQRA 1FMVA 1ONVA 3OYCA 4CCKA 3FH4A 2REEA 2D1VA 3T8WA 3ERMA 4ZZDA 5CLSA 4BXXJ 4CYQA 2RAEA 2YNCA 2DF5A 4HW0A 3RPUA 4LOCA 3A2KA 3CUQA 4MO7A 5KAFC 2ZW7A 2RN7A 3CO6C 2BL1A 2A4NA 4ZX9A 4CAWA 2EIMH 2HQYA 2KJCA 1S7FA 4KJZA 2JYYA 4XN3A 2ORWA 1F36A 3GF2A 4XQFA 3BJOA 1UB9A 3ZCOA 1KUVA 2DYSH 4FD7A 2KP6A 3E5XA 2X9DA 2DBBA 4L9NA 3CMEI 2E2JJ 1Z0XA 3D7HA 2FBIA 2XGCA 3KLOA 2STTA 2QYVA 4UA3A 1QSMA 3UEJA 3OYDA 4UVCA 4W9YA 4FQGA 2PN6A 1IXRC 1BL0A 2V9VA 5IYBJ 1BI1A 3BJ8A 1T98A 4CCLA 4MQ9F 5E20A 3OS0A 1HDLA 3E2IA 2LNBA 2L7KA 4BACA 2OVOA 1L0CA 4QUSA 5CNPA 2NAZA 4D0PA 4HX7A 1YJWI 2UWMA 2MSYA 2VONA 1JHHA 4L18B 1W3SA 5KTAA 2JSCA 1TQIA 2MFZA 2VQCA 4Y7NJ 3HOVJ 4P1WA 2P8TA 1LKXA 4W1UA 3VSKA 3MD2A 3FSXA 2ECBA 3ABKH 4FE7A 5JLWA 1SC7A 2Q51A 2DI3A 3CDHA 2F5DA 3LMMA 2DU9A 2KL4A 1OVOA 3KY9A 3IJ3A 3LFKA 4D7NA 4UEZA 1TOTA 4MHYA 3QYEA 2L4AA 3ZN1A 1U6GA 1VQ5I 1X74A 4E2AA 4I0AA 5LRGA 2G3AA 3L2QA 1ZG5A 1SGNI 3P9KA 4PJMA 4UFXA 4Y3OA 3BR5A 4UNOA 3SDBA 4ANJA 4CCJA 2XGDA 3BTLA 4U9YA 4HRIA 3F3XA 3K1NA 3LWUA 1ZELA 2ZEGA 4FD5A 1VQPI 3BJIA 4FT8A 4I7HA 5F27A 1VQ6I 1QU3A 5B3SH 2E60A 2IT0A 2HR3A 3BG3A 3R61A 2NSMA 2OZ6A 4AVBA 2QQCA 5DM6F 3LQQA 3B3WA 3SZPA 5LYIA 1RI7A 1BR4A 2WV1A 4IJAA 4JX6A 2PR8A 4ZY1A 3C3WA 2ELHA
chains in the Genus database with same CATH topology
3E6BA 4U0VA 3U1DA 2KIMA 2OAZA 3WGHA 3P9CA 3F8FA 4MFQA 2VBYA 4TV7A 1IW7F 3BZ6A 2ZPAA 1ZH5A 4K30A 1R36A 2EFQA 1GVJA 3ZP5A 2CNMA 2JRTA 1FZPB 4XRFA 1JGSA 1R00A 2EA2A 1FLIA 1MD0A 4A95A 4QB9A 1Z9CA 3VODA 4ZGYB 1LDKB 5DYMA 1QBJA 2VI7A 1S3JA 4CAEA 1U78A 3D2MA 3REOA 1GHEA 2Z11A 3F8KA 1FOKA 4I49A 1P4WA 1U5TC 2KKOA 2OQRA 4QC6A 5A2QZ 1XB4A 1PU9A 2JPCA 1OYIA 3GO5A 4EVIA 4KVME 1KQ9A 3BDDA 3PFIA 1IRFA 2Q4VA 1R23A 1W7PB 2WC2A 4XLPF 2H94A 2PG4A 3JVNA 2QQ9A 5HH1A 5JPHA 2XUBA 5AG4A 1YYVA 2E1NA 2B5GB 1ON2A 1R1VA 4C68A 2MC3A 4A2ZA 2D4OA 3ABTA 3DFGA 3S6GA 3F23A 3R95A 4OAEA 2DPSA 4JK1X 4BAYA 4AD9A 3EETA 3IC7A 1ZHFA 2Z3PA 4MY0A 3ECOA 5AONA 3FNCA 2RV8A 4EM0B 2BEOA 4CYPA 1R22A 3WG9A 4NHJA 2EUIA 4GXOA 2WV0A 1FYKA 3O3KA 2WSAA 5JFRA 4UFWA 1TW3A 4MHDA 1F1ZA 2GWRA 1BM9A 2Z3OA 1Z91A 1OPCA 4KLWA 3TE4A 4EV0A 2YNDA 3I53A 4B11A 1VHSA 5KK1A 1QQIA 5DEQA 1FX7A 4BXUA 3C18A 2IL4A 3R9EA 1ZG1A 5ILVA 1ZRCA 1IIDA 2GAUA 3W6XA 4HKFA 2L01A 3GFLA 3EQLF 1D3YA 1YS7A 2CW0F 2J5OA 3DXJF 5E17F 2R1IA 4JQFA 1OZPA 4BHCA 1UCRA 1I12A 5E8IA 3SXNA 2QMLA 4XPKA 5H6RA 1Z4RA 4XPDC 3S2WA 2Q0YA 1KQ0A 1BOAA 1HW5A 1RO5A 1USSA 3GFIA 1UFHA 3QPHA 4LFUA 4L5IA 3LAPA 4HNWB 3WTYC 1V4RA 3QRFF 3KP2A 3LWFA 4GS4A 1ZAOA 2FSRA 1OYYA 1LB2A 4WCGA 5L3DA 3IU2A 3SHPA 3W91A 2FCKA 3AAFA 1LRZA 2W25A 4FX0A 1PDNC 4F6AA 3F0AA 3ML6A 2YPRA 2KCWA 1FBSA 1ZLJA 4P9FA 2RKHA 2ZMEA 5FB2A 2EB7A 5ICGA 2I00A 2HYFA 2FE7A 3DKWA 3L2CA 4QWQA <