3TO7A

Crystal structure of yeast esa1 hat domain bound to coenzyme a with active site lysine acetylated
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
276
structure length
275
Chain Sequence
EVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title MYST protein acetyltransferase activity requires active site lysine autoacetylation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords Histone acetyltransferase ESA1
total genus 79
structure length 275
sequence length 276
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2011-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3to7A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 3to7A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3to7A02
2JSCA 2RN7A 3RTRA 1CJWA 4QB9A 3J80Z 2R98A 4ON0A 4XPKA 1FPQA 3DEUA 1R1TA 1WWXA 3FXTA 4UVBA 1Z6RA 3F23A 3ABTA 3H3UA 4Z2YA 1BC8C 3KFWX 2HQYA 3WTZA 1HW1A 4Q48A 1QZZA 4LLLA 1M4GA 4OADA 3K2ZA 3F0AA 4UNOA 1W7PD 2DXQA 2OH1A 2QENA 4P9FA 2NNYA 2J8RA 1JHHA 1R5HA 4XBFA 2W24A 4OMYA 2MA3A 2YSRA 3I4PA 4I0AA 2HTJA 5D8LB 1Y0UA 3HRUA 2DK5A 2ZNZA 1Z6TA 1KU7A 2FBIA 3RI4A 2D4PA 2VONA 3GZ6A 3BP8A 2NRAC 1MJAA 1OKRA 2HOEA 5ICCA 1HKTA 2XGXA 3R60A 1D8JA 1I1SA 3F21A 3ZJ0A 1S7AA 1J59A 5BPDA 3R9GA 3IKVA 4ORFA 4AG7A 1H0MA 2G7UA 5J8FA 2RC4A 4NB5A 4MJ8A 2V1UA 2KCWA 1ULYA 3C7JA 4KN7X 3WE2A 2Q0OA 1ZGJA 5L3DA 2XVCA 3BDDA 2ZMEA 1BI1A 2IVMA 3ZZIA 4S04A 2JT1A 3KETA 2JRTA 3RPUA 1HSTA 4KIFA 5E1ZB 4UVAA 4AVBA 3CUOA 3T90A 4CGZA 3P9IA 1K7AA 5E17F 1E2XA 4TV7A 3R0JA 4K2EA 1IN5A 1LDJA 2HYGD 3D0SA 1IYKA 5D6EA 4R1HA 1B6BA 3GXOA 2NYXA 4KICA 4EGZA 3WTXC 4FD6A 1RO5A 3FMRA 1BOAA 4G94A 3F8KA 2RNJA 4U0VA 4A6DA 4ENKA 4KT5C 2X7BA 2VE8A 5BQTA 1FP2A 5E1XA 2EFQA 1DPRA 4KVXA 2FBHA 2OB0A 1B6AA 4ZZDA 1CM0A 2EV6A 3S6GA 2YX7A 2P5LC 2P6GA 3MCZA 1SD5A 3R96A 5LRRA 1TQMA 3J80K 2DBBA 4P96A 2CQKA 3ZPLA 2WWYA 2GAUA 2DU9A 2F2EA 1IAWA 2DPUA 1XCVA 1S7NA 2L4MA 1SFXA 2K86A 1YG2A 2D1VA 3TTHA 2BL1A 2QUFA 1M4IA 2WC2A 4HX4A 5CJ9A 3C1DA 3ECHA 1FP1D 4FD7A 4MHGA 5ICFA 1S7KA 1IICA 2IP2A 2PR1A 4PSXA 4CRYB 3T0YA 4MEXF 1U3EM 5EBVA 4KZTA 3DQVC 2A69F 4FX0A 1XMTA 3NRVA 1BIAA 2E7XA 2PFBA 4GXOA 1FLIA 1QO0D 5F46A 1U5TB 2B5GB 1Q1HA 4HZFA 2XV4S 5CVRA 4JJXA 1M44A 2PSWA 3ELKA 3SHPA 2A6EF 4ZH4F 1GHEA 5E8IA 3ML6A 2EFNA 1P92A 3QB8A 1B4AA 4G7ZF 3GY9A 3KLOA 4UXNA 5FLXZ 1PP7U 1OR7A 2PJPA 4WF2A 2Z10A 3RJPA 1F4KA 3SZPA 2Z3YA 2R7DA 2R3SA 4UWJA 3JAMK 3RYPA 5DV5A 4U9YA 2ACJA 4A0ZA 3ZMSA 1RIOH 2IRFG 1A04A 3JW4A 3HOSA 3UY5A 3FM3A 2V1XA 4RGSA 1F5TA 2J8MA 4KUMA 4I7HA 5HMNA 4OIPF 2DW4A 1U6MA 3F8FA 2D2WA 5DWMA 3TT2A 4Y49B 5KTCA 1IW7F 2B0LA 4QWQA 4H0EA 4KMFA 2FS5A 1XDSA 2MBFA 3IWZA 2GXBA 3F3XA 3ECOA 4CO8A 5IV0A 4FHTA 4UVCA 2ELHA 1T2KA 2QVOA 2V9VA 3R0AA 2FNPA 4I02A 4O6JA 5AIPA 3CLOA 5ERIA 2W57A 2K5TA 4L8AA 3DXJF 1HW2A 2A61A 2ZW6A 5LBQA 3PQJA 3IRQA 2XAQA 2ESHA 4Y15A 2ISYA 1YYVA 3QRFF 1IXCA 2Z11A 1HKQA 2Z5UA 3V7CA 2STTA 4PK3A 2W25A 1USSA 3ROUA 3N7ZA 4EM0B 3MFKA 2NMTA 3GLXA 3F8NA 4EQQA 4BHBA 2O3FA 4ZYGA 2HTSA 3WG9A 1EH8A 3ZN1A 4UHTA 1JE8A 4XLPF 3BWGA 3ZMZA 4IUSA 2JPCA 1O57A 1XDUA 1S5KA 1E17A 1TTYA 2HGCA 2CW0F 2JDDA 1USTA 1S60A 4B5PB 3GFIA 4HQEA 1R36A 3WTVC 3SXOA 3J7AO 3C26A 4U88A 3EO4A 1W7PA 4HLXA 3LA7A 2YU3A 1FYMA 2IA2A 2IT0A 5ICEA 2PQ8A 2R7HA 4ETSA 3R9FA 3GEZA 1UHMA 4E2AA 1IN4A 3FYNA 1SAXA 2ZJ2A 4EM2A 1P0HA 3V8IA 2BV6A 1S8NA 5CYVA 2RV8A 4S05A 3RYOA 1TNTA 1IB1E 4FD5A 2DI3A 3E97A 5DWNA 3WTSC 2PMUA 1Z4RA 1XSXA 1S7LA 3WGGA 4Q4ZF 2GANA 1LVAA 1TBXA 2RQPA 2GIVA 1H9GA 5D8KB 2IA1A 3LODA 2XASA 4KVOE 2M8EA 4KIBA 1ZREA 1W4MA 1IRFA 2KIMA 3RKYA 2QQAA 4LJZF 3D2MA 5KVRA 3BLNA 4MNUA 2JLMA 3WTWC 1IYLA 2QYOA 3EFAA 1P6RA 2PRBA 1XMKA 4L9VA 5A2QK 1N71A 2BUEA 4KOTA 4M71A 1UCRA 5FD6A 2MH2A 4XNHC 4HW0A 2FE7A 3I64A 2AE6A 2EK5A 2G3AA 4GGGA 1B9NA 3O6BB 3WU1B 5D4RA 2LKPA 4PSWA 3RYRA 2IW5A 4JBAA 5CVUA 2HFHA 2ADUA 4GCVA 1K78A 5CLSA 2QBYB 2IJLA 3VOEA 3HIFA 1IN6A 4L0ZB 4G7OF 3TO6A 3GO5A 1KZFA 2QMLA 3PQKA 1ZRFA 2KJBA 3ZN0A 2Q04A 4FD4A 4FT8A 3RKXA 2L01A 3CUQC 1KYWA 1MKMA 4HNWB 1RI7A 4BMHA 1I5ZA 1QQIA 4R9MA 2H6BA 5LEKA 4EGYA 5DCMB 2KIFA 2R7FA 3NQOA 1MD0A 1T6SA 2WPXA 2M1BA 3E0KA 4KOYA 3D5LA 3P9CA 2EB7A 4RB2C 1DUXC 1F9NA 1B59A 1B9MA 1YW9A 1FBUA 1R57A 1ON2A 3E5QA 1U8RA 3SXNA 1BIBA 2J8NA 4YFKF 4EM1A 1Q2DA 4AB7A 2CGPA 2NS0A 5KK1A 4B8XA 2FBKA 2HR3A 1ZGAA 2VXKA 3DR6A 3CXPA 1MDMA 4ENMA 3E5XA 1SFUA 2PC1A 2JEVA 4CHUA 4DQ2A 5CVIA 2EFPA 1NSLA 1PP8F 2DLLA 5J8CA 3BJAA 5F6FA 2EJRA 3P7NA 1HW5A 5GCNA 1K4JA 5C88A 4N9HA 1HKSA 3SXYA 4EVIA 1QBJA 3F22A 1U2WA 3TO7A 3N97A 1K79A 2CNMA 3D8PA 2QQBA 1LJ9A 4MGRA 1EV7A 1I1GA 1WKMA 3BY6A 3CUQA 2FEZA 3NE7A 3VEPA 2ARHA 2OBPA 3HUGA 3WR7A 1SMTA 1YLFA 4LX9A 3FXQA 2NNNA 5IT9Z 1G3TA 3ZMTA 2KJCA 2JDCA 1AOYA 3JAMZ 3PP9A 2B3VA 3E6DA 4CAXA 4YFNF 4CICA 2VZZA 2BBYA 2HQNA 2FCKA 2GQQA 2BE5F 4XSZF 1M4DA 4A12A 2HDCA 3PZJA 4OMZA 2CWEA 2BYVE 4JK1X 1ZLJA 3MGDA 2IL4A 4RGUA 2VZYA 3K1MA 2PN6A 3K1NA 2I79A 5L3BA 4HBLA 3CO6C 1T39A 3WTYC 2D4OA 4M3SA 4KUBA 2QBYA 2PG4A 2FNAA 3PFIA 2WPWA 2VOPA 2ZW5A 2FA5A 2ZNYA 2JPBA 3LAPA 4QLCU 2O6GE 1NE9A 2MC3A 2M87A 5ILSA 2CYYA 4A2UA 1RUOA 4MY3A 4B5OA 3U2RA 1KU3A 2ZMEB 5I0CA 1BM9A 3QOPA 4IXAA 3CDHA 4N9IA 4P9UA 1YREA 1YR0A 1W5SA 3KCCA 4WXHA 4EJTA 5KTAA 4AWXB 1BI2A 5IB0A 4M73A 1YS6A 4LB5A 1I27A 2O28A 1XCBA 3EYYA 3L9FA 1RUNA 2PR8A 3V8JA 1R58A 1I6XA 3S2WA 4U0WA 5HOOA 4P55A 4LG0A 4HV6A 4NSQA 3IL2A 2XAJA 4IJAA 3DDDA 2FF4A 1Y7RA 4AIJA 3G3ZA 1V4RA 5HS9A 3GFMA 2E1NA 1PDNC 4M74A 5H84A 4MEYF 1ZLKA 3E6MA 2CSOA 2EFWA 4BQAA 2PEXA 3COAC 4KLVA 4RAYA 3BJ8A 2B5GA 1GXPA 4HF0A 3LFKA 4IRIA 2LDUA 2Z0ZA 4M6YA 1KUVA 3FRMA 3R6SA 4I2OA 3KP2A 3FM5A 1SMYF 2VBXA 2CNSA 5HLHA 2F5CA 2DAOA 1FBQA 4ZZLA 2DQRA 3CO7C 2FMYA 1KU2A 5LHHA 4M6XA 2VBYA 2BSWA 3F6VA 5E20A 4QC6A 1ZN2A 1KUYA 2ETHA 1L0CA 1ODDA 2FXFA 3EQLF 4MQ9F 4XSXF 1REPC 2XKPA 4KOXA 2F5IA 2VT3A 2H27A 1L0OC 3LQQA 4YFXF 1VKCA 3ZQ7A 4HYEA 3HYIA 4F6AA 2XKOA 5K5QA 1R1VA 1ONVA 3E3VA 2XAFA 5ILVA 1YO5C 3CUQB 1BJAA 1P4AA 3QAHA 1XD7A 3OWCA 3BPXA 3JUWA 5HS7A 3C3WA 3WGIA 2ZPAA 5KTDA 4PDKA 1CF7A 3PGPA 2XROA 3R9EA 4I49A 5HVQC 3WE3A 3H92A 4NEXA 1XN7A 3E6CC 2ISZA 2OU2A 2Q44A 5DEQA 1NHAA 1YK3A 2VT2A 3GWZA 2L4AA 1LRZA 4CZZA 1XEBA 4D0PA 4RS2A 3JSPA 3J81K 1ZARA 4L5JA 1VHSA 3R4KA 4XNHB 2ZO4A 3V7SA 4JWPA 4PZJA 1P4XA 2VEZA 5CNPA 5ICGA 4X5KA 4GO1A 1XGMA 4BHCA 3TDZC 3EY5A 1LDDA 2V1DA 5E1WA 3MEXA 3B02A 2HWVA 2K02A 5LEJA 4H89A 1SD6A 2WV0A 3MWMA 3MZHA 3KP5A 1TQPA 3LQRA 2F5DA 3DP7A 3FBUA 3E5UA 3ERED 1K78B 3GF2A 1QZYA 2DQLA 3DKWA 3EETA 2RVCA 3W6JB 1L3LA 4ZBGA 4LG0B 3DSBA 4LFUA 3W6KB 3GX4X 2EA2A 2B4BA 2XRNA 2KRFA 1GXQA 1H9TA 5HDGA 4OINF 1WQ2A 1XIXA 1JXSA 1HXDA 3V7RA 3P2HA 1JHFA 2YR2A 4NCZA 2G3TA 4ONUA 1I1DA 4PV6A 3FZVA 5IT3A 1YVOA 3VWEA 1IRGA 5CVJA 2A4NA 4UUVA 3KP4A 5L3CA 2E1CA 3IKTA 2DK8A 4KOWA 4ASNA 5HDKA 2REEA 5DDGA 1OPCA 1Z1DA 2A5YB 1RNLA 1SQHA 2LF8A 4HV5A 2FU4A 1S6LA 2XIGA 4MI4A 1UHWA 3H3ZA 3IWFA 1V0CA 5LHGA 4H6ZA 5K5RA 1ON0A 3HTSB 3FWEA 2P6TA 4MTDA 4E8OA 5HLGA 3SHFA 3TDUC 5TRDA 2WTEA 1QGPA 2VI7A 2KIUA 5FVJA 1TW2A 2HKOA 3EUHA 1TLHB 2Q0YA 3RDIA 1ZHFA 1Z7UA 1HBXG 3M1EA 2Q8KA 4CDGA 3HRSA 2HKXA 1QPMA 2RGVA 4AIHA 3ZMDA 4HF2A 2COMA 3R95A 3ABUA 2OZHA 1XGOA 1QSOA 4PGGA 2E7WA 2K4BA 1J4JA 1ZH5A 4QUSA 3FB3A 4MBUA 4ZYEA 3V8LA 5JVTA 2Z9OA 2EVNA 4AVAA 5C82A 2QECA 2P6EA 2W85A 4Y13A 4L5IA 4G7HF 1WSUA 3KEOA 1S7OA 4H6UA 5LGNA 2OQRA 4PCQA 2LNBA 5D5XB 5LLQA 2AJ6A 3CXSA 5HH1A 1LB2A 2PBIA 2FIWA 4LMYA 4R3KA 1HSJA 4IHSA 1KYZA 4KDPA 2L3DA 4O3MA 4R57A 3ISPA 2CG4A 5H6RA 4RGRA 3VODA 2ESNA 2Q7BA 2R1IA 1F1ZA 1FSHA 1KU9A 2CO5A 4RB1A 2J5PA 1P4NA 1G3SA 2VODA 1Z91A 2FE3A 4CYDA 3I59A 2OQGA 1YLEA 3FIXA 2MLKA 2H5MA 2PMHA 3G3SA 1MGTA 3RKWA 2EUIA 1U78A 2L02A 4CAWA 1FX7A 2UWMA 2P6SA 4LLNA 2MLGA 3BZ6A 2P7VB 1ZG5A 1BOBA 1R5GA 6PAXA 2XUBA 2O61A 1WI9A 4K30A 4YRHA 1OYIA 3RPQA 2GWRA 2EFOA 1IZ1A 3MZYA 2K27A 4OOIA 2TDXA 3KLNA 2M30A 4A5MA 4OLLA 3KE2A 1T38A 4HDUA 1EH6A 3HHGA 3K69A 2ZXJA 4HA8A 3B73A 2MD5A 4LK0F 1O7FA 4XPDC 5FLXK 2QLZA 4MQVA 3V4GA 3F8BA 2BEIA 4E0AA 1U6GA 3DFGA 3I3GA 3D2PA 3KP3A 3KP6A 2O8XA 2P8TA 3V8KA 3WTTC 3LSTA 1YX0A 1RZ4A 2Z33A 5FFXA 2CFXA 1R7JA 1IXSB 1Z05A 2Q2EA 3QPTA 5EEHA 2DO7A 1OMIA 3NEUA 2VBZA 3HRMA 2ZKZA 3JSOA 3G8WA 1R00A 1IN8A 3BJ7A 4FX4A 1V3FA 3S6FA 4CRZB 5J6XA 3LWFA 4GYIA 1XE4A 4JXRA 3L2CA 3S6HA 2P5KA 2IA0A 1BO4A 3DPTA 5E96A 2F5FA 1IF1A 5FO5A 4P5OA 2VN2A 2P5VA 4Y17A 4RGXA 4HKFA 3RIRA 3HTUA 4WXDA 1LQ1A 3ZMVA 2ATRA 5BS6A 4EVYA 5JR3A 4BNCA 1QSTA 4EV0A 1TIQA 5JPHA 3R61A 4KOVA 2OZUA 3O2PE 4F7ZA 4KORA 1FYKA 5HDNA 3H4QA 1W7PB 4HX7A 2ZFWA 1LEAA 2LF7A 2C6YA 2A07F 3I5UA 4I01A 1FSEA 2VBWA 2X0LA 3C18A 4LD5A 2IPQX 4ZYDA 1I12A 4U0YA 4B09A 3KEQA 2PI0A 2M45A 2BGCA 2H09A 5L3GA 3FMSA 1XSDA 2EWNA 3DF8A 4OIOF 1O3QA 3HSFA 4M85A 4NF1A 4CXFA 1X3UA 1FYLA 5LHIA 4RI1A 3K9TA 2I00A 2FMLA 2P6FA 1YVKA 1BBYA 3F6OA 3HSEA 2Q4VA 3ZP5A 2J5OA 4JXQA 2OD5A 4ESFA 4RS8A 4IRHA 2C27A 3F8CA 2UXNA 4G8XA 4OIRF 1OYYA 4RB3C 4M9ZA 3P2FA 1TQIA 2B4DA 4BHPA 4IF4A 4UWIA 3KKWA 2Z99A 5DD4A 4MHDA 3KP7A 4YG2F 3TCVA 2O03A 3F5BA 2FSWA 2F5EA 2FRHA 4M72A 1BN5A 4HNXB 4OAEA 4ENJA 3FNCA 4E70A 3QP5A 1J7KA 4HDVA 2R8VA 3F8MA 3QPHA 1PUEE 2ZXVA 1ON1A 1T0FA 2VBQA 3EYIA 3SFZA 1W5TA 5IT9K 1D5VA 2FT0A 3FX3A 4ESBA 4HX8A 3BOQA 1G3YA 5FFZA 4XRFA 1YIOA 2OA4A 3WGHA 5F1RA 2Y75A 4HLYA 1ZYRF 1IUYA 4QBJA 3W91A 1MK4A 4IHTA 3I58A 4KMUX 5JHUA 5K1YA 4AIKA 4N0BA 3BJ6A 2Y48A 4R87A 3LD2A 2EA4A 5A2QZ 4LGWA 4YFJA 1SFEA 1Z9CA 2UXXA 1GVJA 3GYHX 1YQAA 5EEGA 3JTHA 4XPLA 3SZTA 5JI6A 2EV0A 1KQ0A 3O3KA 1UB9A 4QVTA 4I98B 3U9GA 4PK2A 1WWZA 3F72A 2ZW4A 2HS5A 2P4WA 4JQFA 4Q5SF 1XF8A 1Z9UA 4PGHA 1K6OA 1YW8A 2VE9A 1J75A 4WK8F 2V6CA 4A5NA 1TNSA 4ENNA 1YS7A 3BJOA 1XB4A 2FOKA 2VOOA 1IN7A 1IXRC 4AVPA 1J9IA 2G9WA 1G3WA 1Q2YA 1FNNA 2HQRA 1QSRA 4IF5A 3GUDA 3T8RA 5F64A 4RB0A 3FMQA 2YPRA 1J5YA 4L9TA 1Y9WA 4MTEA 5H6QA 2KKOA 3W6XA 3JTGA 4A0YA 3M8FA 1STZA 2PLYA 2HZTA 3Q9SA 1D8KA 4LK1F 3R1KA 3M9AA 2AXLA 2HV2A 2W84A 2A3SA 3TQNA 2MH9A 2QM3A 2FL4A 1S3ZA 2ZW7A 3LAJA 5TJJA 1YGHA 1KUXA 5IX3A 1G6NA 4UV8A 3OV8A 1I21A 1ZAOA 4YGOA 2VC1A 4O5VA 4GYGA 1P4WA 2RDPA 3EC4A 1S7FA 1QSMA 2VXZA 4UBRA 4M9SA 5HS8A 4KNYA 1J2XA 3U1DA 4UA3A 2H6CA 5D5WB 1LNWA 2A68F 2YX4A 4Y49C 3REOA 5F48A 4JLYA 5E8GA 2Y0MA 3HOTA 3MQ0A 4WX9A 1C0WA 3TO9A 1JGSA 4I09A 3T9YA 2JTVA 1B1BA 1ZRCA 3P9KA 1FWZA 4KLWA 1ZG3A 3L09A 3EXNA 1S3JA 4KA4A 5ISVA 1Q2CA 3TOAA 1Z4EA 5F49A 4NXYA 5LGUA 3LA2A 2STWA 4WXCA 2XAHA 2EV5A 2D45A 5D5UB 1O7LA 5BOXA 2REFA 2G7HA 4G6QA 3KZZA 3S6KA 5D5VB 2DFIA 3L7WA 2CNTA 2HEOA 5EC4A 2K7LA 1O3SA 5ED4A 3TFYA 4NQWA 5E18F 4MY0A 1XMAA 5JQ4A 2GXGA 1YW7A 3E6BA 4HOBA 1KGSA 5DYMA 2HYFA 4RAZA 4UV9A 4KN4X 4KUAA 1BI0A 5K5OA 4OIQF 4G9YA 5HLIA 3ULQB 4L9JA 4HF1A 1FC3A 5DUKA 4KVME 4L18B 5AIQA 1U5TA 3BPVA 2GA1A 4U5YA 4AG9A 1O3RA 4KYWA 4EJOA 1QNTA 4II9A 3WU0A 1IIDA 4L89A 1BC7C 2ZBKA 3I53A 5FGMA 2CY2A 2DTRA 4CS0B 3FHZA 3QU6A 1ZRDA 3FF5A 4U7BA 1LEBA 4B5PA 3K1PA 4KIGA 2VQYA 3K9UA 5DUIA 1OYWA 2QQ9A 3I54A 1WK4A 2P0WA 1G4DA 3LA3A 1DDNA 2ZCWA 1MJ9A 3JVNA 4BXUA 5D4SA 1MJBA 3TE4A 1KQ8A 4HQMA 4LUAA 3IRRA 2JZYA 4YIFA 2FSRA 4L0YB 3I59B 1NMTA 1MZBA 3QP6A 3GVAA 1HQCA 4Q47A 1FOKA 2XAGA 4JD6A 4J3GA 1U5TC 3I9SA 3N4MA 4GS4A 2G0BA 4NHJA 4BAYA 3ZMUA 1BI3A 2HUZA 5D6FA 1FY7A 1XSVA 1LDKB 3GKRA 5DCMA 4L9NA 2QIRA 2K4JA 3T8TA 1D3YA 2OZGA 5BPIA 2OAZA 1XGSA 5FB2A 3Q5FA 3GYAA 5H20A 4KOUA 2BEOA 1S29A 1KQ9A 5AONA 2V79A 4XLNF 3DPLC 3TOBA 4DNCA 4BH9A 1YFHA 3VWDA 2DT5A 2DPDA 1OZPA 5JFRA 1PUAA 2B4DB 4IVNA 3D3SA 3GW2A 1VTNC 1R23A 2RKHA 1O3TA 3G73A 3GZ5A 3KZYA 4ESJA 2XHKA 4R8HA 3DV8A 1GHCA 4LLGF 1R22A 2OZ6A 2VC0A 4EJWA 4EMSA 4U9ZA 4R79A 1UFMA 3HHHA 3DNSA 2L54A 1AWCA 4IRGA 2O0YA 4G6DA 4LB6B 4AD9A 4HAMA 2Q4YA 3WODF 2UZKA 3M7GA 3CXQA 4IPAA 1UFHA 2M5WA 2QZ8A 1M1DA 3FXRA 3J81Z 5ILUA 2D1HA 4AVCA 1SD7A 1DP7P 3I0TA 1FT9A 5H86A 1WRJA 5L3EA 1FZPB 4CAVA 3VFZA 3SQNA 2PDOA 2QWWA 2A6HF 3L00A 1CGPA 4KFCA 4A6EA 3MAJA 4YIIA 5DCFA 5FD5A 1Y9KA 3CTAA 3K0LA 3EDPA 2GE3A 1SD4A 4WCGA 3CJNA 3IC7A 4KOSA 5DD8A 3TKYA 2FIAA 2GA2A 3B8GA 4BYYA 1EH7A 5LRSA 1YTYA 1DPUA 1PU9A 4M9XA 5BMZA 5L3FA 3VB2A 1ZG1A 3TGNA 2B3UA 3M8EA 3IWGA 1P2FA 1MDMB 1FBSA 3HSRA 2H94A 3OOPA 4R3LA 4F0YA 3HRTA 3GFLA 3W6SA 4ZYHA 4EJUA 3GFJA 4WWCA 5F47A 3I71A 3IHUA 3FXUA 1RXTA 3AAFA 1CF7B 2AS5F 3T1BA 3WTUC 4XPDB 2FXAA 4U7DA 4OU0A 2LSOA 2NAZA 1KA8A 3BROA 2FQ3A 5LGTA 2P7CB 3DR8A 1XGNA 1QSNA 3Q9VA 2B58A 1J0RA 5CVVA 4HNYB 4EJVA 1T98A 2X4HA 1TW3A 4I0BA 1R1UA 1B87A 4A0XA 2GZWA 3QU3A 3T5XA 3IGRA
chains in the Genus database with same CATH superfamily
2JSCA 2RN7A 4XMYA 3RTRA 3W2AA 1CJWA 4QB9A 3GTLJ 3KY9A 2DEAA 4V19K 3J80Z 2R98A 4ON0A 4XPKA 3BR5A 1FPQA 1Y1VJ 1R1TA 3DEUA 2HXOA 2K40A 1WWXA 3UGIA 3CMMA 2A5WA 1A2ZA 2MG4A 4ZC3A 2BVLA 3FXTA 1I3QJ 4UVBA 1Z6RA 3PEIA 3F23A 3B3TA 3IWEA 3DBRB 3K4NA 3M1CA 3ABTA 3H3UA 1PCEA 2ZENA 1B72A 4Z2YA 1BC8C 3KFWX 5E3RA 2X1EA 3JRIA 2XRLA 1F2PA 2HQYA 3WTZA 1HW1A 1QHHD 2XSJC 4Q48A 1RR8C 2LEOA 4BBSJ 1QZZA 4LLLA 1M4GA 4OADA 2M3AA 5J1RA 1LFBA 3K2ZA 3F0AA 3I56I 4MIMA 2JRMA 2CW8A 4UNOA 1NSAA 1W7PD 2DXQA 4PJLA 2VQGA 2OH1A 2QENA 4P9FA 4P10A 1F43A 2LK2A 2NNYA 3FDYA 2J8RA 3SFIA 1LAPA 1JHHA 1R5HA 5B1BH 2PJ8A 5E79C 3DGVA 4XBFA 2W24A 3NWTA 2V1CA 2NU3I 3DTIA 4OMYA 4C2XA 4AXVA 2MA3A 2YSRA 4DJLA 3I4PA 4IK2A 1OFCX 3I9V2 2HTJA 4I0AA 5D8LB 4KSFA 1TF8A 3OYGA 1WJCA 3A2KA 1Y0UA 1Y1BA 3HRUA 4XRSG 1VI0A 2DK5A 2ZNZA 1Z6TA 1KU7A 2VKHA 2R7ZJ 3DWLE 2FBIA 3RI4A 2D4PA 5LD2C 2VONA 2DTZA 1MBFA 3GZ6A 4X1EA 3BP8A 3NWSA 2NRAC 1IY6A 1MJAA 4OC4A 4G6TB 1OKRA 1FTTA 2HOEA 2XC7A 2X6WA 4A3FJ 4OMEA 3JRHA 4A30A 2IS4A 2JWTA 2HPIA 4CCJA 5ICCA 2HOSA 2XGXA 4IHVA 1HKTA 3R60A 2E1OA 2KPMA 1D8JA 2VJJA 4KSAA 1ERDA 1I1SA 2ORVA 1ELLP 2FOWA 3F21A 1NXUA 2X6OA 3BR2A 1S7AA 4IQ4A 2PI0A 3QYBA 1VQPI 1J59A 3KQXA 3ZJ0A 2L2OA 1Z3XA 1TWCJ 4OC3A 3ZQGA 1SGQI 4DZPA 5JHFA 5BPDA 3Q0WA 3IKVA 2CF4A 2XEIA 4MXUA 3K4LA 3R9GA 4ORFA 4AG7A 1OQYA 1H0MA 2G7UA 1F36A 2M8GX 1KMAA 5J8FA 2RC4A 4F91B 1Q7LA 4NB5A 2WV1A 2DPTA 2PVWA 1CSOI 1BW5A 2V1UA 1TBOA 3FJUA 4MJ8A 4CYPA 2F4IA 1A36A 1IOIA 1ULYA 2KCWA 1Z8LA 4NGSA 3C7JA 4KN7X 4N4NB 3WE2A 2Q0OA 4NDLA 3KHZA 1ZGJA 1NUBA 3LSKA 3BR3A 2GOXB 5L3DA 2XVCA 3BDDA 1ZLHA 2ZMEA 1BI1A 3H1CA 2CXAA 4XRMA 1LKXA 2DFFA 2IVMA 1DTDA 3ZZIA 3KR4A 2OCCH 3EUAA 1HDUA 4S04A 2JT1A 3KETA 2OTLI 2FD5A 3KZIC 2JRTA 3RPUA 4B11A 1HSTA 2DCEA 3K7AJ 4KIFA 4BS9A 3PSFA 1U5KA 5E1ZB 4UVAA 2EK8A 4IHMA 3CUOA 3OYJA 3H0DA 1R4NB 5KAFC 2R5ZA 3CCSI 4Y33A 3T90A 2GLOA 3P9IA 1K7AA 4CGZA 5E17F 3JCUC 1NTCA 1E2XA 4Q7AA 5LRGA 4TV7A 2F48A 3R0JA 4K2EA 1IN5A 1LDJA 1MBGA 2HYGD 3D0SA 1X1CA 5D6EA 1IYKA 1OYVI 1VQ4I 1UZCA 4R1HA 3QQAA 1B6BA 2L5QA 3GXOA 3CPXA 2XB0X 3K2KA 2NYXA 4XLFA 4KICA 4EGZA 3WTXC 4FD6A 2CJSC 4I99C 5H2FC 3PNVA 1RO5A 3FMRA 1BOAA 2BHZA 1UVGA 4G94A 5F04A 3AL0B 3F8KA 2RNJA 4U0VA 4A6DA 3HXLA 1RRJA 4DYQA 4ENKA 4KT5C 4PXBA 2X7BA 2VE8A 1LE8B 1LFPA 3MKLA 1TWFJ 2FJ1A 5BQTA 1W0TA 5FJ8J 5C44J 1NG6A 2IMOA 2QSHX 1FP2A 4XK4A 5E1XA 5CPAA 2EFQA 1DPRA 4A3JJ 4KVXA 4CGNA 1Q9BA 3KASA 3PM1A 4UFXA 2OD1A 2FBHA 1MIJA 6CPAA 2OB0A 1D0ZA 1B6AA 3H8FA 1AKHA 4ZZDA 4DIQA 5HI7A 5LYLA 1CM0A 1Z8TA 2EV6A 3S6GA 3LNQA 2X6YA 2Z16A 2YX7A 2XF7A 5CPRB 4C30A 1VQMI 3MN8A 4GM5A 2M5XA 4E6KG 2P5LC 3MCZA 2CMPA 1SD5A 3FSXA 2P6GA 3R96A 2CUZA 3I55I 5LRRA 4YEJA 4HG2A 1TQMA 3J80K 2DBBA 4P96A 2CQKA 2L9SA 2R7WA 2UZ3A 3JRUA 4NGMA 8CPAA 3ZPLA 4JYKA 3LMMA 2WWYA 2GAUA 4JCVE 2DU9A 2F2EA 1IAWA 2DPUA 2ENNA 1XCVA 1YITI 4ZX8A 4Y4RA 4F9VA 2JYYA 1S7NA 4OWRB 5J4VA 4BDZA 1CHOI 2KMRA 2CTBA 4BJTA 1SFOJ 2L4MA 1SFXA 2K86A 3SDBA 4NC7A 2QYVA 3S8PA 3VH9A 2NVYJ 4C3HJ 1UAAA 1YG2A 2D1VA 2AHQA 3GTMJ 2VQCA 5FUWA 3TTHA 2BL1A 2QUFA 1M4IA 2WC2A 4HX4A 5CJ9A 4C7IA 3C1DA 3ECHA 1FP1D 4FD7A 4P44A 4MHGA 5ICFA 1S7KA 1IICA 1LANA 3BQYA 2IP2A 4PSXA 3DBHB 2PR1A 4CRYB 4NUBA 2V7FA 4UUTA 1SVMA 5GP9A 3T0YA 5GPCA 3LSPA 5M3FJ 4O23A 4B48A 4MEXF 4UEEA 1U3EM 5EBVA 3IAM2 3LOCA 4KZTA 3W3CA 2GM4A 1ZO0A 1AHDP 3DQVC 1E0EA 2A69F 4FX0A 1XMTA 2ELIA 3NRVA 4E7ZA 4BE2A 4ZY1A 1BIAA 2E7XA 2PFBA 2Y9YA 4GXOA 1QO0D 1FLIA 5F46A 2NOGA 1U5TB 7WGAA 2B5GB 1Q1HA 4HZFA 2XV4S 2K85A 5CVRA 1GVDA 4JJXA 1M44A 2XPVA 3A4CA 3RZOJ 1JI8A 1MBKA 2CJJA 2PSWA 5IB9A 3ELKA 3SHPA 2H8WA 2DMUA 2ARPF 1K6YA 2A6EF 4ZH4F 1UVFA 2W82A 5EEAA 3MVPA 1IDYA 3OS0A 4XR6A 2C1CA 2QKLB 4AUXA 4FE7A 1V55H 1B8IB 9WGAA 1GHEA 1UG2A 3B4VC 3WHCA 5E8IA 2E2IJ 1XPXA 2Q7SA 4PQAA 1M8CA 3ML6A 2EFNA 1P92A 1Z7KB 3BG5A 4PJJA 5KHDA 1B4AA 4G7ZF 3W2VA 3GY9A 3QB8A 3VARA 5JLXA 3KLOA 4UXNA 2OUMA 5FLXZ 2CS3A 1OR7A 4E7IA 1PP7U 2PJPA 4WF2A 2Z10A 1IRZA 3RJPA 1F4KA 3SZPA 5LYFA 2Z3YA 2R7DA 5EF6A 2Y0SA 2R3SA 5EGOA 3KZWA 3SJGA 2JA5J 1ZKGA 4UWJA 3JAMK 3K70D 5JH9A 2EPFA 4B10A 3RYPA 5IP7J 5DV5A 5F08A 4U9YA 3D67A 5FUXA 2ACJA 3OYLA 4A0ZA 1YIJI 3ZQIA 3ZMSA 1RIOH 2B0UC 3HOVJ 2IRFG 1A04A 2X3TA 3JW4A 1ETKA 3HOSA 3UY5A 3FM3A 2V1XA 4RGSA 1F5TA 2J8MA 4KUMA 3GOXA 5J1YA 4I7HA 2HU9A 3K70C 5HMNA 4OIPF 2CIJA 4UUSA 2DW4A 2NS7A 5FKLA 1IGBA 1U6MA 1TKJA 3H8EA 2HZDA 5G21A 3TEDA 2V53A 1IRXA 2GKTI 1BA5A 4A37A 3F8FA 2D2WA 5DWMA 3TT2A 3ERMA 4UEZA 4NGPA 3L2RA 4Y49B 5KTCA 1IW7F 2B0LA 3CP2A 4QWQA 2IS6A 4H0EA 3D68A 4KMFA 3KX2A 1XDSA 5GADJ 1W5CC 2FS5A 2MBFA 3IWZA 3KI9A 3LSIA 3Q0VA 2HDDA 2GXBA 3F3XA 4UIAA 4ZYAA 3ECOA 4CO8A 3LWUA 1RESA 5IV0A 2OF7A 2ZMEC 4FHTA 3JRBA 2BOLA 4UVCA 2ELHA 2KRCA 2QVOA 3G1MA 1T2KA 2JXDA 2V9VA 3R0AA 2FNPA 4R76A 4I02A 3KIOA 4O6JA 5F0HA 3BTJA 5AIPA 4C2UA 4PPZA 2DOEA 4J01A 3S3MA 2ENZA 3CLOA 5ERIA 2W57A 1POGA 2WSAA 4W1UA 5C4JJ 3BCBA 1HLVA 3G1LA 2K5TA 1B72B 2WBMA 4P6YA 4L8AA 4XLEA 2W4SA 4RM3A 5K8OA 2H1KA 5DS9A 3DXJF 1HW2A 4EMEA 2VRWB 5HNFA 3S2DJ 2Y69H 2A61A 1YW4A 3CDIA 2JJ7A 1TZLA 2ZW6A 5LBQA 3KYLA 3PQJA 4AVBA 3IRQA 2J9RA 2XAQA 2ZFUA 2ODFA 2ESHA 4Y15A 2ISYA 3K4BA 5AG6A 1YYVA 3QRFF 1IXCA 1EF4A 2Z11A 1HKQA 3CCVI 2E2HJ 1GLNA 1SVOA 2Z5UA 4HSTA 3V7CA 2STTA 3BG9A 3H3VK 4PK3A 2W25A 1USSA 3ROUA 3N7ZA 4EM0B 3MFKA 3G1OA 2NMTA 3I1UA 3GLXA 1QMUA 3B2YA 3F8NA 2LG4A 4M3DA 5AGEA 4EQQA 1TWAJ 4BHBA 2N8GA 3S1RJ 2NU0I 2O3FA 4ZYGA 2HTSA 3WG9A 3T8WA 2Y0SN 4XKWA 3QOEA 4CCOA 1MNMC 2PJ9A 1EH8A 5CKTA 2EIJH 3ZN1A 4E7SA 1JTXA 1H0ZA 3BR1A 1I50J 1U8BA 1QQ9A 4UHTA 1JE8A 4XLPF 3FMCA 3BWGA 3JRGA 1WGTA 3FSYA 2SGEI 3ZMZA 4IUSA 3FXMA 2JPCA 1O57A 1BLLE 1VIXA 2WUUA 1XDUA 1S5KA 1E17A 1TTYA 2HGCA 1FNOA 2CW0F 2JDDA 1USTA 1S60A 4B5PB 5HNHA 3GFIA 4HQEA 1R36A 3IUOA 2BW3A 3WTVC 3PBEA 3SXOA 2XRCA 4J19A 2WGCA 3VSLA 3J7AO 2NU2I 4U88A 3C26A 3EO4A 4XOTA 4P4DA 1W7PA 3ZQQA 4HLXA 3LA7A 2YU3A 1FYMA 2IA2A 1X19A 1B8IA 2IT0A 3D00A 5ICEA 2PQ8A 1PCAA 4UF4A 5CBMA 4MFEA 1ETWA 2R7HA 4ETSA 3IWWA 3DBLB 1I3AA 1W36C 1BR4A 1UWYA 3R9FA 2IEKA 3GEZA 1UHMA 4E2AA 1IN4A 1CT0I 3TMOA 2BY1A 2ORWA 3FYNA 5HVFA 3DLLF 1SAXA 2ZJ2A 5DTDA 3OR2C 4EM2A 1P0HA 1Q1VA 3V8IA 2BV6A 1X3ZB 3LSHA 1XMXA 2E36A 1KZHA 1OJLA 4RDUA 1S8NA 3DKYA 2LY1A 5CYVA 3BG7A 4AC0A 2RV8A 4S05A 3RYOA 1A6QA 3CZ6A 2JBJA 1TNTA 3OYFA 1IB1E 1Y7EA 2IGNA 4FD5A 2V1NA 2DI3A 3E97A 5DWNA 1G59A 1KBEA 5JHWC 3OSFA 3K4CA 2W7NA 2YGWA 1TT0A 1HEVA 3WTSC 2PMUA 3HOWJ 1Z4RA 1XSXA 1S7LA 1BJZA 4C2MJ 1YQEA 5GTIC 2V6EA 2L7FP 4OVOA 3WGGA 4Q4ZF 2GANA 1X1AA 4B44A 4KITB 5B5EC 3V42A 3BZKA 3W2WA 1LVAA 1WJFA 2KL4A 1TBXA 1Z5RA 2RQPA 2GIVA 3BR0A 1Y1CA 1H9GA 5D8KB 2IA1A 1ETYA 1VQNI 3I4MJ 2IXSA 1ARLA 1HDPA 3LODA 3HBLA 2E5ZA 3HOUJ 3OXLA 2A20A 4RLQA 2XASA 4KVOE 2M8EA 4KIBA 4IX7A 1ZREA 1W4MA 1IRFA 1TT5B 2KIMA 4ZI6A 3RKYA 2QQAA 3LSGA 4LJZF 3ZQFA 2R7OA 4BJ5C 2DPSA 3D2MA 2PVVA 5KVRA 4LQ6A 2HNHA 3H5NA 4MNUA 3BLNA 3HZJA 5M5WJ 3A01B 3E1SA 1WJEA 1QVTA 1E3HA 1X2MA 1A6IA 2KISA 4B1RA 2JLMA 3WTWC 3C2BA 1X1DA 1IYLA 2QYOA 2ME0A 3EFAA 3H5RA 4B12A 5A27A 1P6RA 3ESWB 2CV2A 2PRBA 1XMKA 4L9VA 5A2QK 1NH3A 1EJ9A 1N71A 2BUEA 3PRTA 4KOTA 2JVHA 4M71A 1UCRA 4A93J 2BZTA 4PJ0C 5FD6A 2MH2A 3HKZA 4XNHC 3HUGB 1Z67A 4HW0A 3OYCA 2DA2A 2FQ4A 2F3CI 3I64A 2FE7A 2DODA 2GBYA 2LBFA 2LFBA 2AE6A 1FAQA 2EK5A 1PUFA 2G3AA 4GGGA 1Z7LA 1B9NA 3O6BB 1OISA 3WU1B 3UEYA 5D4RA 1XBTA 2PX9A 2HB6A 3LMSA 3FXKA 2LKPA 4PSWA 4DUKA 1RPWA 2IW5A 1FOWA 4JBAA 5CVUA 3RYRA 2HFHA 2Q51A 2ADUA 4GCVA 2XGDA 4RLFA 2W0TA 5EX3A 1K78A 1DE4C 1XOVA 1LAMA 5CLSA 2QBYB 2IJLA 3VOEA 3HIFA 1IN6A 2M0MA 1M1EB 4L0ZB 4G7OF 3GIUA 3TO6A 3GO5A 1KZFA 3VYSB 2QMLA 3GLJA 4BQOA 3PQKA 5E3NA 2M7BA 4ANJA 5EJCA 1K83J 1ZRFA 2KJBA 2ZXIA 5M5XJ 1TF9A 3ZN0A 2R4GA 1VNDA 4DJAA 2IGKA 1N77A 3S3NA 2Q04A 4FD4A 1R71A 4MO7A 1WJAA 3H36A 2EIKH 4FT8A 2VPLA 4JX4A 3RKXA 4AVZA 2NU1I 2E60A 2L01A 3CUQC 1KYWA 4C9YA 4FTHA 2RNGA 1MKMA 4HNWB 2L7ZA 1ZG8A 1RI7A 2Q43A 4BMHA 1I5ZA 1QQIA 2Q2EB 2HPMA 2ERWA 4R9MA 2H6BA 5LEKA 4EGYA 5DCMB 2DF5A 2KIFA 4HEA2 2R7FA 3NQOA 1MD0A 1T6SA 3HDDA 3SGBI 3PUFA 4UXHA 3CCMI 2WPXA 2M1BA 2JUGA 3E0KA 4KOYA 3D5LA 1XTAA 3RBUA 3P9CA 2EB7A 1MW7A 4RB2C 4A3IJ 2LD5A 3HPGA 3ASNH 3I4NJ 1DUXC 1F9NA 1JKPC 2X6XA 1H89C 2BXZA 1B59A 3A0HC 1B9MA 1YW9A 2ABZA 3KEYA 2W00A 2K9MA 1FBUA 1R57A 5LRJA 1ON2A 3E5QA 2CWFA 1CT4I 2YNEA 1U8RA 4P4IA 1LFUP 3WHBA 2XB5A 3SXNA 3O8GA 3JRCA 5E3MA 1BIBA 5IP9J 2J8NA 4YFKF 1JJ6C 4EM1A 1Q2DA 4AB7A 2EZKA 2CGPA 4PK4A 1TGSI 1LPQA 2NS0A 3B35A 5KK1A 4B8XA 2FBKA 2HR3A 1ZGAA 2VXKA 3DR6A 2L7MP 2MC4A 4BGDA 1N78A 3CXPA 2OOTA 1MDMA 1IUFA 1EKEA 4ENMA 3BJIA 3ZR8X 3E5XA 4XKBA 1SFUA 1Z8XA 2JEVA 2PC1A 4DOZA 1G8XA 4CHUA 4WJBA 4DQ2A 5CVIA 4IHWA 3BTCA 2EFPA 3CZXA 1NSLA 3LSMA 1PP8F 1YU6C 1JUPA 4M6HA 2DLLA 5J8CA 3BJAA 2OVOA 2EQRA 2M9HA 5F6FA 4A69C 4MLOA 2EJRA 3P7NA 1YHQI 3W6VA 1MT1A 1IU8A 3S14J 2L9RA 4F8ZA 4M3GA 3SYTA 1HW5A 3A0BC 5GCNA 4NGNA 3O8HA 1K4JA 5C88A 2NOJB 4N9HA 1HKSA 3SXYA 4EVIA 1T8IA 1QBJA 3QYEA 3F22A 1U2WA 3TO7A 3N97A 1K79A 1X3WB 2KMQA 2CNMA 5THWA 2XPUA 3D8PA 2QQBA 1S20A 1LJ9A 4MGRA 4X6AJ 1EV7A 3IU1A 1I1GA 2KDZA 1WKMA 3BY6A 3CUQA 1PYTB 2C6GA 2FEZA 3NE7A 2RIJA 3VEPA 2ARHA 2OBPA 3HUGA 3WR7A 1SMTA 1YLFA 2O8KA 3EPZA 4X0GA 4LX9A 3FXQA 1SGYI 1LR8A 1CGJI 2HQ5A 2NNNA 5IT9Z 1VDDA 1IO2A 1G3TA 2LLKA 4QPQA 3ZMTA 2KJCA 2JDCA 2E19A 2AXTC 1AOYA 3JAMZ 2NVXJ 3Q0UA 4OAZA 3IFEA 3PP9A 3EUKL 1MH3A 2BY3A 3VYUB 2B3VA 2AQEA 1MMSA 2RQQA 1D0YA 3E6DA 4CAXA 4YFNF 2WVJA 4CICA 4A3CJ 2VZZA 2BBYA 2HQNA 2FCKA 5G1ZA 2GQQA 2BE5F 5F27A 4XSZF 1M4DA 2Z1DA 2NSMA 5LYDA 4A12A 1UELB 2DFEA 2HDCA 3PZJA 5C4XJ 3R5AA 2QQEA 4OMZA 2CWEA 2BYVE 4JK1X 1ZLJA 1P9QC 1HC8A 2ICWG 1CBXA 3MGDA 2ZEHA 3RKQA 2JQ7A 2IL4A 4RGUA 2DB6A 1LE8A 4WWVA 2VZYA 3K1MA 3QPSA 2PJ1A 2PN6A 2MFZA 3K1NA 2I79A 5L3BA 4HBLA 3CO6C 1T39A 3P5JA 3WTYC 2D4OA 4M3SA 4RMNA 2QBYA 1SGPI 4KUBA 1QZEA 2B63J 1YW6A 4OIWA 2PG4A 2FNAA 3PFIA 3OS2A 2WPWA 1QVUA 2JA1A 3ABKH 2VOPA 2ZW5A 2FA5A 2ZNYA 2C6PA 1UJ8A 2JPBA 2OCEA 5IOZA 2V26A 3LAPA 4X3RA 1WJBA 4QLCU 2O6GE 1NE9A 1JUMA 3E0JB 3FHNA 1X1PA 2MC3A 2R7QA 2VASA 2M87A 2XGCA 5ILSA 1XJOA 3OXGA 2LBFB 2CYYA 4A2UA 3UKGA 4MHNA 3DTKA 1RUOA 4MY3A 4B5OA 5F1JA 5CCMA 3ONQA 3U2RA 1KU3A 3F9KA 2ZMEB 3KYDB 4BACA 2AFUA 2DMQA 5I0CA 1BM9A 3QOPA 4XIDA 1V1IA 1NK3P 4IXAA 3CDHA 4N9IA 2XF6A 2M4KA 4P9UA 1IG7A 3CC4I 2DOAA 1YREA 1W5SA 3KCCA 4WXHA 4EJTA 1YR0A 2V8HA 3PB7X 3HOYJ 3PBBA 5KTAA 3B6AA 3TW7A 4AWXB 3MD2A 1BI2A 1VFCA 3FVLA 1R3NA 4M73A 5IB0A 1YS6A 1HJAI 2RB7A 4FKDA 4LB5A 1CT2I 3GTGJ 1I27A 2F6CA 2O28A 1XCBA 3EYYA 3L9FA 4BXXJ 2A6TA 1RUNA 1DS3I 1XBUA 2PR8A 4L9MA 3V8JA 1R58A 1I6XA 2KQRA 2M2EA 5K7ZA 3S2WA 4P55A 4U0WA 5HOOA 4LG0A 1LVKA 4HV6A 4NSQA 3AFHA 2DMTA 1TURA 2KDOA 2XAJA 3IL2A 3NH5A 2AO9A 2N1AB 1X2NA 4IJAA 1CX8A 3DDDA 2KT0A 2ZEMA 4GXHA 2FF4A 1Y7RA 2KHMA 1ULNA 4MCQA 2KLOA 3E59A 2HDWA 4HNVA 4AIJA 2ID6A 3G3ZA 2COBA 4XQFA 1FTZA 1V4RA 5HS9A 3CJRB 3GFMA 2E1NA 1PDNC 3K4MA 4M74A 2GLFA 2JK3A 3MN2A 5H84A 4MEYF 1ZLKA 1R6RA 3E6MA 2CSOA 3B3WA 2JN6A 3BLYA 1BR2A 4F0XA 2V8GA 2EFWA 2QVPA 2CH0A 3DLAA 4BQAA 2E1MC 2PEXA 3COAC 4KLVA 2QQ8A 2JSPA 4RAYA 3PO2J 3BJ8A 4R6TA 5F09A 2ZEPA 2B5GA 2CQ7A 1GXPA 4HF0A 3LFKA 3G6EI 2LKSA 2LDUA 4IRIA 4XM3A 2Z0ZA 4M6YA 3DLJA 4UCNA 1KUVA 3R5CA 3FRMA 3R6SA 4I2OA 2LP0A 3KP2A 3FM5A 1SMYF 2M4GA 2VBXA 2DKVA 1O4XA 4RM2A 2CNSA 1OMTA 2EBJA 5HLHA 2RREA 3FECA 2F5CA 5J1QA 1W4RA 2DAOA 5BNGA 4G12A 3U21A 4CYNA 1FBQA 4E4HA 2HYJA 2IS2A 4Y3OA 2DQRA 2KZGA 4ZZLA 3CO7C 4BINA 2FMYA 2DFHA 3CF2A 2BXYA 3D7FA 3Q3SA 1KU2A 2VQHA 3UNGC 2E5RA 1EE3P 1NG7A 4JP0A 5LHHA 3GTKJ 4NJQA 3OMYA 4UUSB 2WYRA 4CCKA 1YRNA 1ETOA 4M6IA 2MGQA 4M6XA 2VBYA 3PB4X 2BSWA 1YSJA 3F6VA 5E20A 1JT6A 2HVQA 5IYCJ 4QC6A 4GDFA 1V5EA 1Z3YA 4ZDPA 4D5FA 1FOYA 1ZN2A 1KUYA 2ETHA 1L0CA 4JZ0A 1ODDA 3VDXA 2KFDA 2FXFA 3EQLF 1MBJA 4MQ9F 4BBRJ 5ELYA 3UFFA 3JRDA 1X4PA 4XSXF 4CAFA 1REPC 2XKPA 4XORA 2NYQA 4KOXA 2NVQJ 2F5IA 2DOFA 2LVSA 1UMQA 1K7VA 2VT3A 2H27A 2CUEA 3AL0C 2V8VA 1L0OC 2WZNA 5LYIA 2X52A 3LQQA 1ZELA 1IOFA 4YFXF 1VKCA 3CJQB 1XG1A 2Z2SB 3ZQ7A 4HYEA 4A32A 5AG4A 3HYIA 5HVGA 4M6VA 2XKOA 5K5QA 4F6AA 3OWTA 1MMGA 4A3EJ 1R1VA 3HLPA 1ONVA 2M0CA 3E3VA 1MBEA 2XAFA 3ZXSA 5ILVA 1VHOA 1YO5C 3HC7A 2H8RA 4UCMA 1HEEA 2PJCA 5KNLA 2TCTA 2LMDA 4DYCA 3B7IA 3CUQB 1YJWI 1BJAA 1P4AA 3QAHA 1XD7A 5FLVA 3OWCA 4OAYA 3BPXA 3JUWA 5HS7A 3C3WA 4XICA 3WGIA 2Q4ZA 2ZPAA 5A28A 5KTDA 4PDKA 1OMUA 2YUSA 1CF7A 3PGPA 2XROA 3R9EA 4X2TA 1WVRA 4FETA 4CCLA 4CCMA 5HVQC 4I49A 3WE3A 3H92A 4XL9A 2KRHA 4NEXA 1XN7A 1Y8RB 3E6CC 1MMAA 1UHSA 3IH3A 2QJ8A 4LIUA 2ISZA 2OU2A 4PXCA 2Q44A 4H2KA 3C2HA 1NHAA 5DEQA 2E34A 1YK3A 1YRNB 2VT2A 3GWZA 2L4AA 3AG3H 1IJWC 2D5VA 4Z65A 1BPNA 1LRZA 4CZZA 3AG4H 3LACA 4BQQA 5CQGA 4YU9A 1XEBA 1MBHA 4D0PA 4UIBA 4RS2A 2P81A 4Y7NJ 3RSNA 4DZJA 3JSPA 3J81K 4M3EA 1X58A 4JYWA 4F52A 3FH4A 1ZARA 4L5JA 1VHSA 3FEEA 3R4KA 5IYDJ 3TX8A 4XNHB 2A05A 2I3CA 1SGRI 2KMPA 2ZO4A 3V7SA 4ZTJA 4PZJA 3CMEI 1P4XA 2VEZA 4JWPA 5CNPA 5ICGA 1A35A 4XLAA 4X5KA 4GO1A 1XGMA 3N5FA 4BHCA 3TDZC 3EY5A 2YQPA 1D1CA 3G4SI 5J1UA 2VI6A 1VQ9I 1LDDA 1GDTA 3S93A 2V1DA 3G2BA 4MHZA 5E1WA 3MEXA 3B02A 2HWVA 2K02A 5LEJA 4H89A 1SD6A 3IP4B 3S1QJ 2WV0A 3MWMA 1Y8QB 2KMOA 3JRAA 3MZHA 2FNFX 3KP5A 5JLWA 1SGDI 1YMEA 2X1CA 3OYNA 1TQPA 1T56A 3LQRA 3SI1A 4IEJA 2F5DA 3DP7A 3FBUA 2ECBA 1CE3A 3E5UA 2B9SA 4KSIA 1H8LA 3CCQI 2EZLA 3ERED 2OC6A 1K78B 3GF2A 2NU4I 2JEWA 3FEDA 1QZYA 2DQLA 2M7AA 3FXJA 1DP3A 5M5YJ 2DDBA 3DKWA 3EETA 2RVCA 1JQGA 1AYEA 4MPIA 3W6JB 1L3LA 1X74A 4ZBGA 4EATA 3BR6A 2ZB9A 4LFUA 2R5YB 4LG0B 3VDPA 3DSBA 2GKVA 4CCNA 3W6KB 4C2TA 3L1PA 3GX4X 2EA2A 3R5DA 2XRNA 2B4BA 2PJAA 2KRFA 1GXQA 1H9TA 5HDGA 3KYCB 4NGQA 1QRYA 5FKKA 4OINF 1WQ2A 2G9DA 4C2ZA 2AFWA 2WY8Q 3ZQCA 1W0UA 4MCPA 1XIXA 3N05A 1JXSA 2BCOA 4MHPA 1HXDA 3CC7I 3CD6I 3V7RA 3P2HA 1JHFA 2YR2A 4NCZA 1FMVA 5FKOA 4HNUA 2G3TA 2LC2A 1T0FC 4ONUA 1I1DA 3D7GA 3OVOA 1YJNI 4PV6A 1A31A 3FZVA 5IT3A 1YVOA 3JTKA 1K4TA 3ZGKA 2OV7A 2LB7A 3VATA 1IRGA 5CVJA 3VWEA 1OCOH 2A4NA 1JKQC 4UUVA 2L7XA 3KP4A 2LY2A 3GTJJ 2PIZA 1I39A 5L3CA 3FBIB 2L8EA 4XNFA 4BJ6C 2E1CA 1DU6A 2PE3A 4W9YA 1QA6A 2ZSIB 1F57A 5EDNA 2BO9A 4W97A 3IKTA 2DK8A 4KOWA 4U87A 3SI2A 1M4LA 4ASNA 2LYCA 1TL8A 1YX3A 3OIOA 5HDKA 2REEA 3KGQA 5DDGA 1OPCA 5IPAA 2TRTA 1Z1DA 2A5YB 1RNLA 1APLC 1SQHA 4CH7A 1X10A 2ROWA 4ZYQA 4YRVA 2LF8A 3GB0A 2KMUA 1QPIA 1ZGWA 1BW6A 4HV5A 2FU4A 2OR4A 4ZX9A 2JA8J 3A01A 3MZ8A 3HUVA 2GOMA 1S6LA 2EH3A 2XIGA 4I6ZA 3M8JA 2K5CA 3QNVA 4MI4A 1UHWA 4Q36A 2QEXI 3BG6A 3VPRA 3H3ZA 2B7EA 3IWFA 1IDZA 5LHGA 3R5BA 1V0CA 4H6ZA 5K5RA 1ON0A 4P4EA 1X4OA 3HTSB 4E7LA 3FWEA 2P6TA 4MTDA 4E8OA 4PJMA 1UG0A 5HLGA 3OYAA 4AM3A 3SHFA 3TDUC 5TRDA 2WTEA 1QGPA 4B3XA 2PJ0A 2VI7A 1OR7C 3ZQHA 2KIUA 3CCEI 3BI0A 5FVJA 1TW2A 2HKOA 3EUHA 2GKRI 4MFKA 1TIHA 4OP4A 2O53A 1TLHB 2QSGX 3RDIA 2Q0YA 5I4MA 1Z0XA 1ZHFA 1Z7UA 2MD0A 1E3PA 2EILH 3M1EA 2Q8KA 4CDGA 1YJ9I 3HRSA 1HBXG 3BG3A 2E35A 3GLLA 3IH4A 3OY9A 3PB9X 5EMIA 2HKXA 4HPQA 1QPMA 3K2AA 2RGVA 4AIHA 3ZMDA 4HF2A 2CUJA 3PL8A 1FEXA 2COMA 4GI3C 1U0JA 3B3CA 3KR5A 1CP7A 4A2ZA 4LIVA 3CMAI 1K7TA 2W48A 3R95A 4CZCA 1D0XA 4DGWB 3UOEA 4MHYA 3ABUA 2OZHA 1XGOA 3K6GA 1QSOA 4PGGA 2E7WA 1T08B 2K4BA 1J4JA 1ZH5A 4QUSA 1ETVA 1GV5A 3FB3A 4MBUA 4ZYEA 3V8LA 1FIAA 5JVTA 2Z9OA 5D8NA 1FIPA 1PTQA 1HDQA 2EVNA 4B43A 4AVAA 5C82A 3VYTB 2JA2A 3OOUA 5E3QA 2QECA 2P6EA 2W85A 4IOCF 1CPXA 3CCYA 4Y13A 4L5IA 2VPRA 3CF5F 4G7HF 1KBFA 1WSUA 2K9SA 3KEOA 1S7OA 1V5GA 3D5SC 2QF7A 3OR1C 5LGNA 2OQRA 4PCQA 4H6UA 2LNBA 5D5XB 1R43A 5LLQA 2XGEA 1YOVB 2AJ6A 4P4BA 1JUSA 3QPLA 3CXSA 5HH1A 3RQIA 1H88C 1LB2A 2PBIA 5CQEA 2FIWA 4LMYA 2F7VA 4PUSA 1HSJA 4R3KA 4II3A 1KYZA 4IHSA 4A3KJ 4KDPA 2L3DA 4O3MA 4R57A 2F5VA 3ISPA 1LCPA 1HPTA 3RQ4A 2CG4A 3L2QA 5H6RA 4RGRA 4PXDA 3VODA 4ZTFA 3MMYB 2ZEEA 2ESNA 3PNYA 5EX0A 2Q7BA 3PFYA 2CQQA 1F1ZA 1FSHA 2R1IA 4P4JA 2DYSH 1TKHA 4CAEA 3KQZA 3IC1A 1KU9A 3S2HJ 2CO5A 1V1HA 5C3EJ 4QTRA 3WU2C 4RB1A 4CPAA 2J5PA 1P4NA 1G3SA 2QSFX 2LY9A 2VODA 4AMLA 4QPOA 1Z91A 2FE3A 5FUYA 2PJ2A 4CYDA 2M34A 3I59A 2OQGA 1YLEA 2F4MB 3DTEA 3HM5A 3FIXA 2MLKA 2H5MA 2HC9A 2PMHA 3PUBA 3IU2A 3TP3A 2VL1A 2ZJQF 1MGTA 3RKWA 2EUIA 3G3SA 4CYQA 1V5FA 2DMNA 2L02A 2X48A 1U78A 3PSIA 5FUVA 2I8DA 3F0CA 4RAFA 4CAWA 2WB1N 4XN3A 1D1AA 1FX7A 2UWMA 2P6SA 4LLNA 1BOBA 2MLGA 2P7VB 3BZ6A 1ZG5A 1R5GA 6PAXA 4BUPA 5IOYA 4D1QA 2XUBA 2O61A 1WI9A 3PFOA 4K30A 4YRHA 1OYIA 3RPQA 2JBKA 2ZC2A 2GWRA 2DJIA 1IZ1A 2EFOA 3MZYA 2K27A 2LR8A 3HKZN 4GFBA 4OOIA 2VIXA 3S9NA 3SJMA 2TDXA 1TWGJ 2CQXA 2PIYA 3KLNA 1OCCH 1X12A 2M30A 2I5UA 4A5MA 4OLLA 4E7HA 2ODDA 3KE2A 1YI2I 1T95A 2AFSA 1T38A 3H35A 4HDUA 3RCOA 1EH6A 3BT9A 3HHGA 7CPAA 3CLQA 3K69A 5HLTA 4M6GA 2GREA 2OTJI 2ZXJA 4HA8A 1XMBA 1SAUA 2P6AC 3ASOH 3B73A 4II2A 2MD5A 2B8TA 4LK0F 5FRNA 4F9UA 1O7FA 4XPDC 1J09A 3UR3C 1ZTRA 5F0CA 2HVSA 1TBRR 5FLXK 2WY7Q 3AG2H 2QLZA 4MQVA 3HPHA 3F8BA 3V4GA 2BEIA 4E0AA 1U6GA 3DFGA 2EK9A 3TL4X 2AFMA 1KWMA 1MSEC 3BZCA 3I3GA 1JWQA 3D2PA 3KP3A 4B3AA 3KP6A 2O8XA 2P8TA 2G0EA 3V8KA 1ZLIA 3WTTC 3LSTA 2ZOFA 4IAVA 1YX0A 1RZ4A 3D4UA 2EZHA 3WG7H 2Z33A 3FXLA 3K4JA 5FFXA 2CFXA 1R7JA 1IXSB 2K3FA 3B6CA 4I76A 3SJXA 1Z05A 1OCPA 1FOXA 2Q2EA 3QPTA 5EEHA 2DO7A 1OMIA 2E71A 4UFVA 3NEUA 3RZDJ 2RAEA 1Y8FA 1WPKA 1AKHB 2VBZA 4NC8A 2QKMB 3FISA 3HRMA 2ZKZA 3JSOA 2C6CA 3G8WA 1R00A 3NE8A 1IN8A 1MSFC 4HGUA 5IYBJ 2EWBA 3BJ7A 2ELKA 4FX4A 5GAHJ 3M3YJ 1V3FA 3S6FA 2EO8A 4CRZB 5J6XA 3LWFA 4GYIA 4A3BJ 1XE4A 2CFOA 4B6DA 4JXRA 3L2CA 5HXDA 2PJ6A 1TUSA 1JKOC 1TC3C 4LG3A 2KZVA 2P5KA 2IA0A 3BC8A 1BO4A 3S6HA 2ZOGA 5JM6A 3HL2A 3DPTA 5E96A 1TP4A 2E2JJ 2GU2A 3NH8A 2ELJA 2VQLA 2ZELA 3FK6A 2F5FA 1IF1A 4EEFG 5FO5A 4P5OA 2VN2A 1PTRA 3D66A 4IKFA 2P5VA 4Y17A 4B4CA 4RGXA 4HKFA 3RIRA 3VWBA 3HTUA 5HQ8A 4X8IA 2R5ZB 4WXDA 5KCMA 1UUCA 1OBRA 2DMPA 3ZMVA 2EZIA 1LQ1A 3A02A 2ATRA 5BS6A 4EVYA 2JVGA 5JR3A 4BNCA 1QSTA 4EV0A 1TIQA 4CYOA 2WB1A 5JPHA 3BTLA 3R61A 4KOVA 1ACIA 4BDYA 2OZUA 1G2HA 2CQNA 3O2PE 4N4OB 3JR9A 4F7ZA 5K8NA 4KORA 1DGWY 1ZR2A 4B6ZA 2MYSA 2CUFA 3RPUD 1FYKA 3SEKC 4S0HB 2WAQA 5HDNA 3GTPJ 1R0RI 3H4QA 4AIDA 5FROA 4XRSA 5D29A 1W7PB 4HX7A 4G1PA 2R7UA 1WJ5A 2ZFWA 4D7MA 1LEAA 3PDNA 1FJLA 4MFLA 2LF7A 2K9QA 4GRIA 2C6YA 4RBOA 3CCRI 2A07F 3I5UA 4A3GJ 4I01A 2CTCA 3AG1H 1VQ6I 5GPAA 1FSEA 1ZG9A 2VBWA 2X0LA 3C18A 4LD5A 2CRGA 2IPQX 2CWGA 4KS9A 2VJ4A 4ZYDA 1VQKI 1I12A 4U0YA 1ORKA 1FMWA 4B09A 2DT6A 4UY8I 2CWHA 2AFOA 2Z3LA 4MCSA 3V38A 2UUZA 4BL0B 3KEQA 2ZEDA 3LL7A 4XONA 1ENHA 2MABA 2M45A 2BGCA 5EGOB 2H09A 5L3GA 3FMSA 3H0GJ 5LFAA 4E7JA 1XSDA 1Z2LA 3FF3A 2EWNA 1MNEA 3DF8A 5KAIC 3OYBA 1TBNA 1JT0A 5F0FA 4RAGA 2V9KA 4OIOF 3E2IA 4E1PA 3ISXA 1IW4A 1O3QA 3HSFA 1Y0NA 4A38A 4FAIA 4M85A 4NF1A 4CXFA 3S9LA 1SVLA 1X3UA 2HOTA 1FYLA 4XLHA 1VGYA 5LHIA 4RI1A 3UGDA 3SGQI 3K9TA 2I00A 2FMLA 2P6FA 1WJDA 1YVKA 2DXIA 1BBYA 2VJIA 5HODA 2IBDA 3KL9A 2Y9ZA 3F6OA 5FKMA 2GLJA 2JMWA 3HSEA 4FASD 1JJ8C 5EZHA 2Q4VA 3L2WA 3ZP5A 1P9ZA 4P1WA 4B47A 4KISA 3RNZA 2VL8A 2J5OA 1BMOA 5B1AH 1DS2I 4JXQA 2OD5A 4ESFA 2F4OB 4RS8A 1OLTA 2DA3A 1I6HJ 4IRHA 4DBQA 2C27A 2L9NA 4PJNA 3M07A 3F8CA 2UXNA 5EYRA 3MEKA 4G8XA 3UGLA 1VHEA 1HDDC 4OIRF 4BEHB 1OYYA 4RB3C 4M9ZA 1JKRC 2BUSA 1RTQA 1TQIA 1Y6IA 3P2FA 1K7UA 3LSJA 2B4DA 1YLOA 4BHPA 4JX6A 2ANPA 3SEZA 4IF4A 4E1RA 4UWIA 3NFZA 3KKWA 2Z99A 3CDXA 4F92B 5DD4A 4MHDA 1W1WE 3FBNB 3QWPA 2OPTA 3KP7A 4YG2F 3TCVA 2O03A 2JZMA 3F5BA 4P45A 2FSWA 2F5EA 2FRHA 3K4KA 4M72A 1BN5A 1WGCA 3BHXA 4HNXB 3OYKA 1VQ5I 4ENJA 4OAEA 4ZY2A 3FNCA 4E70A 3QP5A 1J7KA 4HDVA 2QQ0A 2R8VA 5AG5A 3F8MA 2DA5A 3QPHA 4MMOA 2WAEA 5JVGF 1PUEE 2ZXVA 1ON1A 1T0FA 2NXNB 3RZAA 1U9OA 3RO0A 1LR9A 5BWAB 2VBQA 3B3SA 3EYIA 2LH9A 2GVIA 3SI0A 3H5ZA 4CA0A 3SFZA 4MRIA 1W5TA 5E3OA 5IT9K 1D5VA 2FT0A 3FX3A 4UB6C 2Z3NA 1MMNA 1VZ0A 4HX8A 4ESBA 1Z2IA 4MFPA 3BOQA 1G3YA 5FFZA 4XRFA 1YIOA 2OA4A 3WGHA 5F1RA 1LOKA 3G71I 1CGII 2MW8A 2Y75A 2QPOA 4HLYA 3A9LA 1ZYRF 1IUYA 4QBJA 4C3IJ 3W91A 1MK4A 3FXOA 4IHTA 3I58A 2VKVA 4E7KA 4KMUX 5JHUA 5K1YA 4AIKA 4N0BA 3BJ6A 2Y48A 1WZ2A 4R87A 1WI3A 2DN0A 3OSGA 3GBGA 1LR7A 3S17J 3LD2A 2EA4A 5A2QZ 4LGWA 1Y39A 1CG2A 4YFJA 1SFEA 5J4YA 3IJ3A 4OC2A 3OIPA 1WCMJ 1Z9CA 1BUSA 3H8GA 3NA6A 2UXXA 1GVJA 3GYHX 3IEHA 1YQAA 4UCPA 5LRKA 5EEGA 3JTHA 4XPLA 4FISA 3SZTA 5JI6A 4MFQA 4B13A 4BU2A 3VE5A 3TP0A 2IJZA 2ZXHA 3D1NI 4IL6C 1HCRA 2EV0A 1KQ0A 3DCFA 4V2GA 3O3KA 4NBQA 1UB9A 4QVTA 1SGNI 3ZOBA 4I98B 4HNTA 3U9GA 1AU7A 1WWZA 4PK2A 3F72A 2ZW4A 2UV1A 2HS5A 2P4WA 4JQFA 4Q5SF 1LFWA 5GTHC 2E73A 2R92J 1XF8A 1Z9UA 4PGHA 2NVTJ 4A3LJ 2KCXA 1K6OA 1YW8A 4MFJA 1M8BA 2L7KA 4A94A 2MSYA 4Q38A 2VE9A 1J75A 3C2GA 1VF9A 1N75A 3M4OJ 4WK8F 3PB6X 2BY2A 4C2YA 2V6CA 4A5NA 1TNSA 4ENNA 1IY7A 1T33A 2WCYA 1YS7A 2VKEA 3BJOA 3BQZA 4MCRA 1XB4A 2FOKA 2HQAA 4F3QA 2VOOA 3FIWA 4ZGYB 2LUYA 2IGOA 1IN7A 1IXRC 1CQTA 1TOTA 3MKWB 4AVPA 1J9IA 2G9WA 1G3WA 1ELMP 1Q2YA 3CT9A 3OIQA 1FNNA 2E5NA 2HQRA 2SGPI 2PJ7A 5B66C 1QSRA 4CUGA 3QYFA 3SJFA 4B14A 4IF5A 4QIWN 3PB8X 3GUDA 3T8RA 5F64A 3HGYA 4RB0A 2R7XA 1A5JA 2KIQA 3FMQA 2YPRA 3A1YA 1J5YA 4L9TA 3GTOJ 1Y9WA 1GUUA 4MTEA 5H6QA 1PYVA 4KJZA 2KKOA 3W6XA 3GCMA 3JTGA 4BEHA 2R7TA 2BY0A 5B3SH 3OYMA 4A0YA 4TWEA 3M8FA 1STZA 5G22A 2PLYA 5GAGJ 3DKXA 1AN1I 2HZTA 3Q9SA 2K9NA 1D8KA 4A39A 2YS9A 4LK1F 5M3MJ 4K3NA 5EZGA 3ZQLA 3R1KA 4JX5A 1SEUA 3M9AA 2AXLA 4FCYA 1K4SA 2HV2A 2W84A 2A3SA 2FUG2 3TQNA 2VUMJ 2MH9A 3WABA 1P7IA 2QM3A 3MKZA 1S3ZA 2FL4A 4NGRA 1QU3A 2ZW7A 4NC6A 3LAJA 2RFHA 5TJJA 1YGHA 1KUXA 5IX3A 1G6NA 2PMZN 3VDUA 4UV8A 4R7MA 3CQZJ 3HJEA 3BI1A 4C3JJ 1N13A 3OV8A 1I21A 1ZAOA 4YGOA 1Y0YA 2FX0A 2VC1A 4MFDA 4O5VA 3NH4A 4EFDA 4GYGA 1P4WA 3MRUA 2RDPA 1R49A 3EC4A 1S7FA 1QSMA 2VXZA 4UEFA 4UBRA 5K7HA 2E1MB 4M9SA 4M3FA 5HS8A 1XFOA 4KNYA 1J2XA 3BCAA 3ABLH 3H5AA 3U1DA 4UA3A 4F55A 3L2UA 4BKXA 5K7FA 1S72I 4IZZA 2HVRA 1Y0RA 2H6CA 5D5WB 1LNWA 2JW6A 1YE9A 2A68F 1VQOI 2YX4A 4A31A 2JUCA 2EINH 3TW6A 4Y49C 3REOA 1ZQ3P 5F48A 3B3VA 4JLYA 1RC9A 4PFPA 2Y0MA 5E8GA 3GMEA 3MQ0A 3HOTA 4YELA 4AU7A 4WX9A 1SANA 2YNCC 5G20A 1C0WA 1ETQA 3TO9A 1FYBA 1JGSA 4I09A 1KONA 2DJNA 5GAEJ 3T9YA 1MH4A 5DAEA 2WAFA 2JTVA 1B1BA 1Z21A 2ZJRF 1D5YA 1ZRCA 3P9KA 5HVHA 1FWZA 4KLWA 2XDVA 5FKNA 2Y2ZA 4LQGA 5K8PA 1R5ID 1ZG3A 3L09A 3J7YJ 3EXNA 1S3JA 4OIDA 3KPHA 4KA4A 3UEJA 4PXEA 5ISVA 2QCOA 1YX5A 3TOAA 1Q2CA 1Z4EA 2AFZA 2O7OA 3JRFA 1WH5A 4NXYA 3QODA 5LGUA 2YNDA 3LA2A 5F49A 3QAYA 3V7ZA 2STWA 2PJ4A 3OL3A 3CJTB 4WXCA 3AKZA 2XAHA 2EV5A 2D45A 5DS0A 5D5UB 3PJRA 1ZG7A 1O7LA 5BOXA 3D7DA 2LOOA 2ZEGA 5FLMJ 2G7HA 3PIPF 2REFA 3KHXA 1S9HA 3KZZA 4G6QA 3D7HA 5D5VB 3S6KA 2QGUA 2DFIA 5TISC 4XN0A 3L7WA 2CNTA 2IQ6A 2HEOA 5EC4A 2K7LA 1BAVA 4NGTA 1O3SA 1ULKA 5ED4A 4D5CA 3TFYA 4NQWA 5E18F 1X4SA 3CMYA 4MY0A 3CCLI 1XMAA 4TNUA 5JQ4A 2GXGA 5DM6F 2F8HA 2ZJPF 2X51A 2SGDI 1JGGA 1YW7A 3E6BA 1VQLI 2X9DA 4HOBA 1KGSA 4ZDLA 1RETA 5DYMA 1XA6A 2HYFA 1GT0C 1EA3A 4IHYA 4MFZA 2LTPA 2DYRH 2HXIA 4RAZA 4UV9A 4BXFA 3FC3A 4KN4X 3CC2I 3S9MA 4KUAA 1BI0A 3OL4A 2BVMA 3CXLA 5E3PA 2IAIA 1HA8A 5K5OA 1U9NA 2NS8A 4G9YA 5HLIA 3ULQB 4OIQF 4M3BA 1TWHJ 2CU7A 4KT6A 1IY5A 4L9JA 3FK7A 4HF1A 1FC3A 5DUKA 1IV6A 3NAUA 5EG0B 4L18B 4UXIA 4KVME 5AIQA 1WHUA 1U5TA 4V2FA 3BPVA 5FRMA 2GA1A 4BBHA 4U5YA 4AG9A 3SZGA 2SGFI 3I3LA 3HH2C 2X1DA 1R4MB 1O3RA 3L2NA 1MMDA 2BOAA 4KYWA 4EJOA 4IOAF 1DQUA 1QNTA 2N17A 3VSKA 3H9JA 2LKXA 2XEJA 3PNTA 2DA4A 1ZR4A 3IIBA 1WTJA 3CP8A 2O9LA 2PJ3A 4II9A 1OCTC 3WU0A 1IIDA 4DW6A 3J7AY 3HGGA 2O5RA 2AQFA 2JA7J 4UXJA 2Z3OA 4L89A 4ZJZA 2Z3PA 2QA4I 2ZBKA 1BC7C 4SGBI 4PFOA 3OL0A 4OC1A 3DU6A 3I53A 5FGMA 2CY2A 2DTRA 3SEQA 4CS0B 1HDLA 2V9PA 3FHZA 4UB8C 4FWUA 3QU6A 3DEEA 1ZRDA 2IGMA 3FF5A 2WADA 3IAS2 1RKTA 4YIRX 1WKXA 4CGLA 4Z6YA 3K10A 4U7BA 4RA2A 1LEBA 3VYRB 4B5PA 2YNCA 4BE1A 3K1PA 4KIGA 2VQYA 2UVOA 4XOPA 3K9UA 5DUIA 1OCZH 1OYWA 2XSDC 2QQ9A 3I54A 2V1CC 4HSRA 1WK4A 3HOXJ 2P0WA 1G4DA 2XEGA 3LA3A 1WGXA 5TGTA 1DDNA 1K61A 2ZCWA 5IP6A 2DA1A 3S16J 1MJ9A 2Q1ZB 3JVNA 1MNDA 5EG0A 4BXUA 2FVGA 5D4SA 1ULMA 4OKOA 4FE4A 1MJBA 3TE4A 1P9GA 1Z77A 2EBIA 3OYEA 1E3OC 1KQ8A 4HQMA 4LUAA 3IRRA 2JZYA 4YIFA 2GXAA 2FSRA 4ZY0A 4L0YB 3I59B 1NMTA 1MZBA 3GZNB 3QP6A 3GVAA 1HQCA 4D9JA 5AG7A 4Q47A 1FOKA 3ZRGA 2XAGA 2BHYA 4JD6A 1S7EA 1Y56A 4J3GA 2CW7A 4FUUA 3FKIJ 1N25A 1OVOA 1U5TC 3I9SA 4NFRA 1AMPA 3N4MA 4FBEA 4GS4A 1Z8WA 3SJEA 3CDLA 4NNJA 2G0BA 2YU9J 4NHJA 4LOCA 5DM7F 1BR1A 2Y31A 3HB9A 3ZMUA 4BAYA 4CGOA 1BI3A 4BQNA 2XAUA 2HUZA 1FARA 5D6FA 1FY7A 1XSVA 3QWLA 1LDKB 3GKRA 4CYCA 1WH7A 2IS1A 3S1NJ 5DCMA 2PJRA 4L9NA 1LUJB 2VKDA 2R7RA 2QIRA 4XLCA 4HRIA 2K4JA 3T8TA 4C68A 3WT4A 4D7NA 1D3YA 2DDAA 2OZGA 1QHGA 2R7SA 3OYHA 5BPIA 2HI3A 2J9AA 2DA7A 3S3OA 2OAZA 3EUHC 5IY5H 1VQ7I 1XGSA 5FB2A 3Q5FA 3CCJI 1TXRA 4L5EA 3GUXA 3GYAA 2W1OA 3WC5A 5H20A 4A24A 3CESA 4KOUA 1BPMA 2BEOA 3OXFA 1S29A 3H9QA 1KQ9A 1HOMA 3S1MJ 5AONA 3GTQJ 4A95A 4LITA 1PJRA 4P4FA 2V77A 2V79A 4XLNF 2PMZA 3DPLC 3TOBA 4DNCA 1P7JA 1CP6A 4BH9A 3PIOF 1YFHA 4A3MJ 2R0QC 3VWDA 2XF5A 4A3DJ 4AYBA 1PPFI 2L0KA 2DT5A 2DPDA 1OZPA 5JFRA 3IH2A 2I10A 1PUAA 2B4DB 4IVNA 2ECCA 3D3SA 4IO9F 4ZDOA 4RN7A 3GW2A 3FX6A 2KP6A 1VTNC 4BD9A 2VJ5A 1R23A 3D5RC 2ZXWH 1PVEA 1PUFB 2RKHA 1DU0A 1BL0A 2OJED 2DIPA 1AUGA 2DA6A 5J47A 1O3TA 3G73A 1TKFA 3GZ5A 3KZYA 4ESJA 4H4KC 2XHKA 3L2VA 4R8HA 3DV8A 1Y1WJ 1GHCA 4LLGF 1R22A 2OZ6A 2VC0A 3OYIA 4EJWA 3CCUI 4EMSA 4U9ZA 2HOAA 4JOMA 4R79A 1UFMA 4J00A 5J3LA 1NK2P 2ID3A 3HHHA 3S32A 3LSRA 3DNSA 4IHXA 2L54A 2X85A 1AWCA 4ONWA 3H9GA 4IRGA 1H8AC 4NJRA 2O0YA 2K9LA 3PO3J 4G6DA 2VXDA 4LB6B 4AD9A 2QQDA 4HAMA 2VB6A 1UHAA 4IQJA 2Q4YA 3WODF 2ZEFA 4QSHA 2K3PA 2UZKA 3ABMH 3M7GA 2ME6A 2PJ5A 3CXQA 4IPAA 2R5YA 4OC5A 1UFHA 3RAMA 2M5WA 2QZ8A 1JTYA 3FXRA 2N71A 3J81Z 1M1DA 5ILUA 2O4HA 2D1HA 4AVCA 1X1BA 1SD7A 4AYBN 2GFQA 1DP7P 3I0TA 1FT9A 2EIMH 3ISZA 2Y30A 5H86A 3DPUA 4HPSA 2R93J 1WRJA 3A03A 4XKVA 5L3EA 3LFUA 1FZPB 4CAVA 1XX5A 2ZSHB 3VFZA 3SQNA 4BY1J 1S5LC 4BE0A 2PDOA 1ARMA 2QWWA 2A6HF 3L00A 1HF0A 1CGPA 3ZCOA 4A6EA 1IGNA 3MAJA 4YIIA 5DCFA 5FD5A 4KFCA 1FT7A 3WC7A 1Y9KA 5JGFA 3CTAA 4RUHA 3K0LA 1ZK8A 1F2OA 1V54H 1RFHA 3EDPA 2GE3A 1RKWA 5E3LA 1SD4A 4DYRA 4WCGA 2AFXA 1ITYA 3NARA 3IO1A 3CJNA 3IC7A 4Y52J 1XX6A 3S15J 1XS9A 3RU0A 4KOSA 2H1LA 5DD8A 3OYDA 3TKYA 2SGQI 3E7LA 4A33A 4CGMA 2FIAA 2GA2A 3B8GA 3JREA 4BYYA 1EH7A 5LRSA 2CV1A 1YTYA 1DPUA 3IV5A 1PJUA 4M9XA 1PU9A 4WP4A 3WC6A 5BMZA 1RR7A 4DBRA 5L3FA 1OCRH 1SFKA 4F93B 1SC7A 3VB2A 1R79A 1ZG1A 3TGNA 2B3UA 2K9HA 2Z3MA 3M8EA 3IWGA 1P2FA 2L9VA 4FQGA 1MDMB 1FBSA 3HSRA 2YUUA 2NVUB 3MKYB 3TJQA 2QQCA 2H94A 1W3SA 3OOPA 2POKA 4R3LA 4F0YA 1AA7A 4ITVA 2JA6J 3HRTA 3GFLA 2Z3KA 2ZEOA 1WFXA 2V8DA 1XRYA 3W6SA 2R7VA 4ZYHA 2PJRB 4EJUA 4ABZA 2PJBA 4EWTA 3GFJA 4CYCB 4WWCA 1SGEI 2V4JC 3BXMA 5F47A 2WAQN 3DEWA 3OS1A 3X2QH 2XEFA 3I71A 3IHUA 1IC8A 1R9TJ 3TC8A 3FXUA 4CGPA 1RXTA 4CSWA 5CCLA 3J7ZI 3AAFA 1CF7B 2AS5F 4BY7J 4XKCA 2J87A 1TBQR 9ANTA 3T1BA 1D1BA 2BW3B 4OC0A 5K8MA 3TBIA 4NQWB 3DU5A 4R8FA 1XC5A 1GV2A 2GIZA 2LRDA 3WTUC 5J40A 2N52A 2FXAA 4U7DA 4XPDB 4YWYA 1IV8A 4OU0A 1DGRM 3FKJA 1YTPA 1GYTA 2PRQA 2LSOA 2XPWA 2NAZA 3HEFA 1KA8A 3BTIA 1W36D 4DYOA 3BROA 2FQ3A 5LGTA 2WA0A 2VLAA 2P7CB 1VQ8I 3DR8A 2LREA 1XGNA 3HG9A 1QSNA 3Q9VA 2B58A 3QTLD 3HOZJ 3CPAA 1J0RA 2DT7B 5CVVA 2PCUA 4HNYB 4C7HA 4EJVA 3SDGA 2CV0A 1T98A 2X4HA 1CPSA 1TW3A 4I0BA 1R1UA 1B87A 4A0XA 4UFWA 3PFEA 2GZWA 1ETXA 3U1KA 3QU3A 3T5XA 3IGRA
chains in the Genus database with same CATH topology
2JSCA 2RN7A 3RTRA 1CJWA 4QB9A 3J80Z 2R98A 4ON0A 4XPKA 1FPQA 3DEUA 1R1TA 1WWXA 3FXTA 4UVBA 1Z6RA 3F23A 3IWEA 3ABTA 3H3UA 4Z2YA 1BC8C 3KFWX 2HQYA 3WTZA 1HW1A 4Q48A 1QZZA 4LLLA 1M4GA 4OADA 3K2ZA 3F0AA 4UNOA 1W7PD 2DXQA 2OH1A 2QENA 4P9FA 2NNYA 2J8RA 1JHHA 1R5HA 4XBFA 2W24A 4C2XA 4OMYA 2MA3A 2YSRA 3I4PA 4KSFA 4I0AA 2HTJA 5D8LB 1Y0UA 3HRUA 2DK5A 2ZNZA 1Z6TA 1KU7A 2FBIA 3RI4A 2D4PA 2VONA 3GZ6A 3BP8A 2NRAC 1MJAA 1OKRA 2HOEA 4A30A 5ICCA 1HKTA 2XGXA 4KSAA 3R60A 1D8JA 1I1SA 3F21A 3ZJ0A 1S7AA 1J59A 5BPDA 3R9GA 3IKVA 4ORFA 4AG7A 1H0MA 2G7UA 5J8FA 2RC4A 4NB5A 2DPTA 4MJ8A 2V1UA 4CYPA 2KCWA 1ULYA 3C7JA 4KN7X 3WE2A 2Q0OA 1ZGJA 5L3DA 2XVCA 3BDDA 2ZMEA 1BI1A 2CXAA 2IVMA 3ZZIA 4S04A 2JT1A 3KETA 2JRTA 3RPUA 4B11A 1HSTA 4KIFA 5E1ZB 4UVAA 4AVBA 3CUOA 3T90A 4CGZA 3P9IA 1K7AA 5E17F 1E2XA 4TV7A 3R0JA 4K2EA 1IN5A 1LDJA 2HYGD 3D0SA 1IYKA 5D6EA 4R1HA 1B6BA 3GXOA 2NYXA 4KICA 4EGZA 3WTXC 4FD6A 1RO5A 3FMRA 1BOAA 4G94A 3F8KA 2RNJA 4U0VA 4A6DA 4ENKA 4KT5C 2X7BA 2VE8A 5BQTA 1FP2A 5E1XA 2EFQA 1DPRA 4KVXA 4CGNA 4UFXA 2FBHA 2OB0A 1B6AA 4ZZDA 1CM0A 2EV6A 3S6GA 2YX7A 2P5LC 2P6GA 3MCZA 1SD5A 3R96A 5LRRA 1TQMA 3J80K 2DBBA 4P96A 2CQKA 3ZPLA 2WWYA 2GAUA 2DU9A 2F2EA 1IAWA 2DPUA 1XCVA 1S7NA 2L4MA 1SFXA 2K86A 1YG2A 2D1VA 3TTHA 2BL1A 2QUFA 1M4IA 2WC2A 4HX4A 5CJ9A 4C7IA 3C1DA 3ECHA 1FP1D 4FD7A 4MHGA 5ICFA 1S7KA 1IICA 2IP2A 2PR1A 4PSXA 4CRYB 3T0YA 4MEXF 1U3EM 5EBVA 4KZTA 1ZO0A 3DQVC <