3TO7A

Crystal structure of yeast esa1 hat domain bound to coenzyme a with active site lysine acetylated
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
276
structure length
275
Chain Sequence
b'EVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone acetyltransferase ESA1
molecule tags Transferase
source organism Saccharomyces cerevisiae
publication title MYST protein acetyltransferase activity requires active site lysine autoacetylation.
pubmed doi rcsb
total genus 79
structure length 275
sequence length 276
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2011-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3to7A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 3to7A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3to7A02
2Q4YA 2P6SA 5AIQA 1VTNC 1EH8A 1ZGJA 4KNYA 1K78A 1YLEA 3DR6A 1OYWA 1W4MA 4LMYA 3V7CA 4MJ8A 4HYEA 1O3RA 4A5NA 4I09A 3VB2A 3CXQA 3HSEA 1J4JA 1OPCA 2I00A 2UXNA 2Z11A 5LGTA 2ZBKA 2L4AA 3TCVA 2JLMA 3CLOA 4MEXF 5I0CA 3DFGA 2P4WA 2Z33A 2XRNA 2DT5A 3ECOA 2ZW7A 3GLXA 4P96A 5AONA 3TDZC 1V0CA 4BYYA 3M1EA 4A0XA 3QP6A 4M74A 5K5QA 2D4PA 4FD5A 2RGVA 4CRZB 3HIFA 3F8CA 3R6SA 4AD9A 3D8PA 5IT9K 4L9JA 2YR2A 5FB2A 4LLLA 4QUSA 4QBJA 4BHBA 3JUWA 5IT9Z 4KN7X 3QRFF 3WU0A 1EH6A 1FSHA 2P5VA 3TO9A 2H6BA 4MQ9F 3G8WA 1RNLA 4TV7A 4LFUA 1TW3A 2EV5A 4H6ZA 4ONUA 1GXPA 3DQVC 2STTA 2B3VA 1KQ9A 1F4KA 2DPUA 4EJUA 3J81K 4XLPF 4YFNF 1BC8C 1STZA 1BJAA 4RI1A 2RN7A 3WTYC 1S7LA 4MTEA 4O5VA 1OKRA 2MD5A 2XKPA 1XDSA 3R1KA 1TQIA 1UHWA 3CDHA 2A3SA 4QWQA 4RS8A 3GYHX 1D8JA 2Z0ZA 2BV6A 2HQYA 3TDUC 2XKOA 2OBPA 4KLVA 1XN7A 5DWMA 3LA3A 5CVUA 3RPUA 3F6VA 5J8FA 2EK5A 5JPHA 1SMTA 4Y49C 4YFKF 2MH2A 3RI4A 3GKRA 4KT5C 3KP2A 1IYKA 2JSCA 2D4OA 4HX7A 5D5WB 4QB9A 1F5TA 2UXXA 3W91A 3DEUA 3FM3A 4HW0A 2EB7A 1YS7A 5FO5A 4LK0F 4ZH4F 1XSDA 1IN7A 3LA2A 1QPMA 2W84A 4RAZA 1BI0A 2JPCA 2JPBA 2YPRA 1Q2CA 1FYKA 2VBWA 1U6GA 4UV8A 1REPC 4AG7A 1XGSA 2PEXA 3DR8A 1IYLA 3Q9VA 1HW2A 3LSTA 1BIAA 3NE7A 2Y48A 3BP8A 3QP5A 2E1CA 3UY5A 3KZZA 3CO6C 1I21A 2O61A 2L3DA 2DBBA 2ZMEA 3H3UA 3K2ZA 3RKYA 1QZZA 1T6SA 2ETHA 4A2UA 3G73A 3ZMTA 1O3QA 1RIOH 1KYWA 2HKOA 1XGNA 3TOBA 1XDUA 4KVOE 3KFWX 4NQWA 2Q7BA 3F8KA 5C82A 5ICGA 1IRFA 4AIKA 3K1PA 2OZ6A 1ZARA 5HLGA 2DI3A 3HOSA 2ISZA 1KUYA 1PUAA 3IWZA 2ZXVA 2DW4A 4II9A 2L02A 2QQBA 4UVCA 2XAQA 2FE7A 1ZAOA 3E3VA 4LX9A 3RIRA 4M9SA 2GXBA 1XMKA 4G8XA 3GVAA 3V4GA 1HKTA 3TO6A 3ECHA 5KVRA 2A4NA 1S7NA 1QBJA 1D8KA 2VI7A 4IHTA 4MY3A 5D6FA 2EFPA 3NQOA 2LF8A 3KP6A 2C27A 3BJOA 1S3ZA 3S6HA 4HA8A 4PGGA 1I27A 3ULQB 2GANA 5LEJA 2LNBA 1FZPB 3MEXA 5ILUA 1IAWA 3D3SA 1S7KA 3KEQA 3S6KA 4CGZA 3F21A 4IUSA 1MDMB 1P6RA 2G0BA 2O03A 4YFXF 4Y13A 3L7WA 1G3WA 3GZ5A 1A04A 1ZLKA 2HQNA 1F1ZA 4FX4A 1G3YA 3HOTA 4E2AA 2GZWA 3GFJA 3R4KA 4BXUA 1BBYA 2QVOA 2WTEA 4IVNA 5JFRA 1KGSA 4KDPA 4JQFA 3PGPA 3M7GA 1QSRA 2NYXA 3CO7C 1ZG5A 3OV8A 1LQ1A 2IA0A 3GYAA 3MGDA 5DD8A 5JQ4A 3PFIA 3DP7A 4IHSA 4I01A 5CYVA 4HBLA 3GW2A 3FXTA 4G94A 2A69F 5DDGA 3ZP5A 4XPDB 3JTGA 3F8MA 1R5GA 5JVTA 4GYIA 4OOIA 3GWZA 2Z99A 1I5ZA 3WTZA 1BC7C 5LBQA 2M8EA 1DP7P 4UHTA 4ZYEA 1DUXC 1FSEA 1SQHA 2C6YA 1HBXG 4ZYDA 2Q0YA 3KCCA 2BGCA 4KOTA 4WX9A 2B4DB 2X7BA 2DAOA 3I9SA 5LRRA 2XROA 4UVBA 4IRIA 2MBFA 2HV2A 2W57A 3VOEA 3TE4A 2IJLA 3FF5A 2NRAC 1S60A 3R0JA 4B5PA 2EA4A 2R98A 4ON0A 1M4GA 3NRVA 2REFA 4EVIA 5KK1A 3DDDA 1H9GA 1VHSA 3ZN0A 2ADUA 3F6OA 3KE2A 1M4IA 4MHDA 2UWMA 2AJ6A 1TTYA 2ZPAA 3FBUA 4ENNA 2F5DA 1S7AA 2XAJA 4KZTA 3JSPA 4WCGA 1SFEA 1QO0D 1W7PA 2FIWA 3IC7A 3HHGA 4WK8F 5EC4A 1XSVA 2BSWA 2Z5UA 4XPLA 2ZW5A 1FOKA 3V7SA 3IRQA 3WE3A 1U8RA 4U7BA 3M8FA 4NSQA 3EYIA 2IA1A 2M30A 3FHZA 2IRFG 2K4JA 4KUAA 4E0AA 1GXQA 3GO5A 5L3BA 3I5UA 4QVTA 2VZZA 1FX7A 1MJBA 3F23A 2QECA 3HRMA 1HKQA 3E6CC 3KLNA 2V79A 5E18F 2XHKA 4KVXA 4I0BA 4HZFA 4L5IA 4P55A 4L8AA 1WI9A 5CVIA 1XCVA 3R9EA 4ETSA 2YSRA 2HFHA 1EV7A 3E5XA 3I54A 3L2CA 2HWVA 2LDUA 4G7OF 3V7RA 3RDIA 5K1YA 2H5MA 1RO5A 2BEIA 1Z6TA 3QOPA 4OIPF 2P0WA 3R96A 4CS0B 1M44A 3QPHA 3VWDA 3E6MA 4KFCA 4IRGA 3RKXA 2PC1A 2RQPA 4M3SA 1G4DA 4JD6A 1P4AA 4LGWA 4RB3C 1Y0UA 1ZHFA 3KKWA 1OZPA 5FGMA 1W7PD 4ZZDA 3IKTA 4BHPA 4OLLA 2FSWA 3DV8A 1KQ0A 2HZTA 4AIHA 2GWRA 5ILSA 3J7AO 1IICA 1LNWA 1NE9A 2FSRA 5F47A 1IXRC 2D45A 3IGRA 5ISVA 4FD4A 5HDNA 2GA2A 3BLNA 3HUGA 4A0ZA 4PCQA 5EEGA 5HLIA 5LHIA 4U0WA 2BE5F 5L3FA 1KZFA 1MGTA 2ESNA 3O3KA 1LDJA 2B4BA 2H27A 1MJAA 1S8NA 2PDOA 2W85A 4HDUA 2VE8A 3ZQ7A 4YIFA 3ABUA 4O3MA 5E20A 4HLYA 2WPWA 5KTAA 1E17A 2V1XA 1QSMA 2ATRA 3FWEA 4GS4A 4MNUA 3EETA 4CHUA 2JRTA 4HKFA 5F64A 2F5IA 3BY6A 4XNHC 2RKHA 2ZFWA 1Q2YA 4MEYF 3EDPA 3RYPA 4AVBA 3JTHA 5HS9A 2V6CA 3JW4A 2PMHA 5CNPA 3FRMA 2YX7A 3B8GA 2QM3A 3QPTA 4UBRA 1SD6A 1FLIA 4WXDA 1YYVA 2VE9A 1FYMA 3GUDA 5HOOA 2Q8KA 4EJOA 2PBIA 2HQRA 4LJZF 2IVMA 4CAVA 4MY0A 3C1DA 1R5HA 3MCZA 4EGZA 3ISPA 4EM0B 4MHGA 4Q5SF 1ZYRF 4CRYB 1KQ8A 3IRRA 3P9KA 3V8JA 2AS5F 3R60A 1XD7A 1R1VA 2Q0OA 1T39A 5H20A 5J6XA 3D2PA 3I53A 4BQAA 2VC1A 4HF1A 5J8CA 5D5VB 1O7LA 4D0PA 2GQQA 5DCMB 3FIXA 5HMNA 2DU9A 1RZ4A 5D5UB 4R1HA 5D8KB 1XE4A 2RDPA 1HQCA 2L4MA 3PZJA 4L9TA 4CAXA 5D4RA 2Z10A 3LODA 4Q48A 2P7VB 5FLXZ 1OYYA 4N0BA 3E6DA 4RS2A 3U1DA 2Q44A 3E5UA 1B9NA 1XGOA 4LUAA 4BNCA 3L00A 2VXKA 3I58A 2ZO4A 1TW2A 3EQLF 3K1MA 3MAJA 3TO7A 2PJPA 3I71A 4LB5A 1OYIA 4BMHA 4ESJA 3K0LA 2CQKA 4AVAA 2EFOA 2FCKA 3KP4A 2IPQX 2IA2A 1T38A 1W5TA 6PAXA 1YTYA 4KUBA 3ZPLA 2ARHA 3LAJA 2FT0A 1K78B 2J5OA 3ZMZA 3FM5A 4MTDA 3E6BA 5L3GA 5F48A 5BQTA 4Z2YA 2G7UA 2OQRA 1P4NA 4NHJA 2Z9OA 2IL4A 3C18A 3K9UA 4G7HF 4OIQF 4NB5A 4F7ZA 2CNTA 2HTJA 4I0AA 4I02A 5FVJA 1UHMA 1Y9KA 1SFXA 4KOSA 2HUZA 3LFKA 3DSBA 1LB2A 5FD6A 2STWA 3RPQA 1Q1HA 5HS8A 2PR8A 2JZYA 4I2OA 4R3KA 2PI0A 5BMZA 5E1ZB 4AVPA 2OU2A 2FU4A 2J8NA 2XV4S 4WF2A 3G3ZA 3WGHA 4QC6A 2XUBA 3ZMDA 3N7ZA 3VWEA 3NEUA 1CJWA 2DFIA 1BM9A 4LG0A 3DF8A 1AOYA 2DXQA 3KP3A 3E5QA 2DK8A 1TQPA 1KUXA 4RAYA 3BOQA 2D1VA 3WTUC 4LLGF 4A6EA 1R22A 2VEZA 1EH7A 1MKMA 1FBSA 2EFQA 1YG2A 4KIFA 3WE2A 1GVJA 4JXRA 3H4QA 3BWGA 5HDGA 2R8VA 3GY9A 4CZZA 2QYOA 4FHTA 1QNTA 2XVCA 5ICEA 2HS5A 3E0KA 1LEBA 4HAMA 2TDXA 3R95A 4KYWA 2M87A 1BO4A 3F8NA 4P9UA 1JHHA 2LSOA 5IV0A 2OA4A 2GXGA 1Y9WA 4R57A 2JDDA 1WKMA 3ZMSA 1J75A 2J8RA 1O3SA 3D2MA 4LK1F 3T1BA 1S29A 1TNSA 4EJWA 4XLNF 3TGNA 2W24A 4M6XA 2PSWA 3BZ6A 3T8TA 1K79A 2FA5A 4RGRA 2QBYB 4GXOA 5CLSA 1OMIA 3F8FA 5DYMA 1JXSA 1PDNC 4IF5A 4B8XA 2DQLA 1J9IA 1S6LA 2CW0F 2DPDA 4NXYA 1UCRA 2FE3A 2F5FA 4I7HA 2B5GB 1ZRFA 2E1NA 1Z6RA 4DQ2A 2R1IA 4FD6A 1TBXA 3Q9SA 2PG4A 2QLZA 4YG2F 2VQYA 3QB8A 2O8XA 3C26A 3EYYA 3ELKA 2FS5A 4EJVA 4HV6A 3P7NA 2V1DA 3H92A 3ABTA 1J2XA 4PV6A 4HX4A 5ERIA 2P6GA 3HRSA 3C7JA 1IUYA 1I6XA 2J5PA 1J0RA 4IF4A 3D0SA 1KA8A 1N71A 3CUOA 5DUIA 1Z9UA 5LHGA 1IXCA 3F5BA 1HW5A 3FX3A 2K5TA 2B4DA 3O6BB 1WWZA 2FBHA 4U9ZA 1BN5A 4ORFA 3SHFA 3J80K 2X0LA 2FIAA 3GFIA 5K5RA 1ZH5A 5L3DA 2VBYA 2P6FA 2EA2A 4R87A 5ILVA 2PMUA 4OU0A 2CWEA 2XAHA 2P5LC 4M9XA 2R3SA 3FXQA 4UA3A 2QENA 4PSXA 1KU7A 2ZJ2A 3K1NA 1RI7A 4PGHA 4L0YB 2KJCA 5HLHA 4HOBA 1FBUA 2MC3A 1YK3A 2O28A 2OAZA 4NEXA 3WU1B 1YREA 4ESFA 4GYGA 5HDKA 3I59B 3TOAA 5BPIA 3CUQB 1W7PB 1ZREA 2I79A 2ZMEB 1J59A 3JAMZ 4QLCU 3EFAA 4A5MA 5LLQA 4JXQA 3SXYA 4KICA 3HYIA 3BPVA 4RB0A 2LF7A 2B0LA 3KETA 1DDNA 5JR3A 4PK2A 2CSOA 5HVQC 1WSUA 1YO5C 1FBQA 2P6TA 1NHAA 1U5TB 1S7FA 5DUKA 1FY7A 1R7JA 1R58A 1AWCA 5IB0A 5L3CA 3KLOA 1K7AA 3HSRA 1YR0A 2B58A 4RGXA 1Z1DA 5ICCA 3CUQA 4CICA 3WTTC 2HR3A 1O7FA 5ICFA 2O3FA 1S5KA 4XPKA 2O6GE 4OADA 4G7ZF 1ZGAA 1IN5A 1O57A 1NMTA 3SZPA 2PN6A 4GGGA 5JI6A 4CXFA 4M71A 1C0WA 2P5KA 2Q4VA 3CXPA 2JDCA 2PRBA 1XMTA 4K2EA 3EXNA 3RYRA 4EVYA 1IXSB 1FC3A 3FMQA 4B09A 3ERED 2AE6A 4BAYA 2A5YB 2AXLA 1SD7A 3SQNA 5EBVA 3JVNA 4L9NA 2EFWA 1FNNA 2V1UA 3CJNA 4HQEA 4IPAA 2KIMA 4EMSA 4XBFA 2YX4A 5TJJA 2P8TA 3H3ZA 3ROUA 2EUIA 1TQMA 3T8RA 4OIOF 3DPTA 2FXFA 2H6CA 4MBUA 3B02A 1BIBA 2FF4A 3TT2A 2VZYA 4PK3A 1G3SA 3GEZA 3ZMUA 2ZW4A 1UFMA 4M73A 1YVOA 4BH9A 4EM2A 4G6QA 1I1DA 1ON1A 4L9VA 1YVKA 2VT2A 3TFYA 2GAUA 4XPDC 2HYFA 3I59A 3REOA 4A12A 5FFZA 5LEKA 3KP5A 3HRTA 1T98A 1J5YA 2HTSA 2RVCA 1IF1A 1HSJA 2F5CA 2FBKA 1U5TC 1MZBA 3MWMA 5KTCA 4N9HA 2FOKA 1SD4A 2NAZA 5E8GA 2VBXA 4KOWA 2VN2A 5FD5A 4E8OA 4KLWA 2CGPA 4HQMA 5H6RA 4U9YA 1F9NA 2M5WA 4OINF 1LJ9A 4RGSA 5CJ9A 4KVME 4FX0A 2MLGA 3R61A 1KUVA 3LWFA 2IP2A 2JT1A 1P4WA 3P9CA 5DV5A 1U6MA 4U7DA 1BOBA 4G9YA 4WXHA 3M9AA 2QQ9A 3LAPA 2BYVE 3WODF 4XRFA 1R23A 3IWFA 1WRJA 5LRSA 2K02A 3FB3A 3FZVA 4KMUX 4HNXB 3F3XA 5AIPA 4K30A 2VODA 2O0YA 2UZKA 3R9FA 3WTVC 2WC2A 2R7FA 4KA4A 4M85A 3AAFA 1TNTA 4KOVA 1CF7B 4ENKA 4PDKA 2B5GA 5H86A 1ODDA 2ZXJA 4EGYA 1YW9A 1IIDA 2OB0A 4AG9A 4F6AA 1IRGA 2A6EF 3PP9A 1L0CA 1D3YA 1LDDA 4N9IA 1W5SA 3PQKA 4CDGA 4XSXF 4U0YA 1JE8A 2QUFA 2A68F 4O6JA 2BUEA 1ZRCA 3MZHA 3W6SA 1R1UA 1IN4A 1CF7A 1YFHA 4I49A 1YX0A 2NS0A 2PR1A 4L0ZB 4KORA 1KU3A 2PFBA 3D5LA 2MH9A 2VOOA 3FNCA 1I1GA 2GE3A 4R8HA 4XSZF 2EV6A 1RXTA 4R3LA 2OZGA 2H09A 5FLXK 3HTUA 4ZZLA 2WPXA 5DWNA 1PP7U 2QZ8A 3LQRA 1YS6A 3TKYA 2JTVA 4ASNA 2ZKZA 3DXJF 3O2PE 4M72A 3EUHA 3U9GA 5IT3A 3GX4X 2FBIA 3V8LA 1R00A 2CO5A 3DPLC 3Q5FA 2PLYA 4UXNA 1YGHA 1S7OA 3VFZA 1FYLA 4ENJA 3BJ7A 2CG4A 2R7HA 2IT0A 2K27A 1PU9A 5F46A 4HF2A 3T0YA 2HDCA 3GF2A 3HTSB 2E7WA 1KU2A 3G3SA 2Q2EA 2CYYA 2RV8A 3FXUA 1SD5A 5CVVA 1H0MA 3MFKA 3VEPA 3S6GA 2RNJA 3I4PA 1DPRA 3KP7A 1I12A 4KMFA 4DNCA 1FWZA 2HKXA 2DLLA 4R9MA 2VXZA 1Z05A 5D4SA 3MZYA 5DEQA 3FYNA 3J81Z 1IZ1A 1XB4A 3VODA 3ZN1A 5JHUA 4G6DA 1U5TA 1KYZA 4UVAA 3LD2A 3DKWA 3CUQC 4WXCA 3R9GA 2ISYA 3I3GA 5D5XB 1B1BA 2F2EA 3HSFA 1QGPA 2DTRA 1Z4RA 5FFXA 4AWXB 3P2FA 1I1SA 4MI4A 1P92A 4UWIA 1Y7RA 1QSTA 5LHHA 1MDMA 2PQ8A 1HXDA 2YU3A 5CVJA 2COMA 2OZHA 2J8MA 3HHHA 3S6FA 2WV0A 3GXOA 4KOXA 1ON2A 1CM0A 1XSXA 5F49A 2Y75A 4MGRA 1P4XA 2EV0A 5HH1A 2NMTA 4A0YA 3T90A 3JSOA 3CTAA 2DO7A 2CNSA 3N4MA 3RYOA 2ELHA 1D5VA 5L3EA 5F1RA 1P2FA 2KCWA 4ZBGA 2ZCWA 2HEOA 3DNSA 1V4RA 3QU3A 3ZZIA 4RB2C 2FXAA 4GO1A 5IX3A 1SAXA 1U2WA 4KOYA 1Z7UA 4Y49B 2GA1A 2QBYA 3E97A 1GHEA 2KIUA 4FD7A 2W25A 2A61A 4EM1A 3CXSA 1T2KA 3WTSC 5D8LB 3N97A 1ZG1A 1LEAA 5BOXA 4JJXA 4IJAA 1H9TA 1Z9CA 3OWCA 3FMSA 1JHFA 1UB9A 4E70A 4U88A 1B59A 4B5PB 5H84A 5E17F 1R1TA 3WGIA 3I0TA 4FT8A 1OR7A 2XIGA 3B73A 4BHCA 4AVCA 4RGUA 1ULYA 4J3GA 1V3FA 1QQIA 2H94A 1P0HA 2EWNA 4JWPA 4M9ZA 1HW1A 2K86A 2FNPA 2OZUA 4X5KA 4Q4ZF 3KEOA 1IW7F 4YRHA 1XGMA 2M45A 1RUOA 2BBYA 1DPUA 3ZMVA 1HKSA 2P7CB 1WK4A 2ESHA 2GIVA 2DQRA 4CO8A 1B6AA 1ZLJA 3KZYA 5DCFA 3F72A 5BS6A 1TLHB 4L18B 5D6EA 1YLFA 2REEA 4HDVA 1M4DA 3SFZA 1USTA 5GCNA 1Z91A 2RC4A 1WQ2A 1MJ9A 5E8IA 4HLXA 4A6DA 4LD5A 3TTHA 2VOPA 1QSNA 3JAMK 2CNMA 2D2WA 3WTXC 2FQ3A 3SHPA 1XF8A 1XMAA 2G7HA 2CFXA 3V8KA 3T9YA 3LQQA 2IW5A 5DD4A 4AIJA 4ZYGA 3COAC 1SFUA 4LG0B 1YIOA 4NF1A 2F5EA 4CYDA 1G3TA 2VT3A 5E96A 1LDKB 1ZRDA 2B3UA 1FT9A 3IHUA 1XCBA 2FL4A 2G3TA 1YW7A 2L01A 4YIIA 4CAWA 4IXAA 1R57A 3J80Z 2A6HF 2VC0A 5KTDA 1ON0A 5EEHA 1L3LA 1LVAA 4RB1A 3SXNA 4EV0A 1KU9A 4I98B 1X3UA 3I64A 4JK1X 4PZJA 2BL1A 3WR7A 3TQNA 1S3JA 4HV5A 3F0AA 3IKVA 3QU6A 2NNYA 2E7XA 3FXRA 1CGPA 3K69A 5LGUA 3F8BA 2XASA 4KOUA 4MQVA 1XIXA 2OQGA 2A07F 4R79A 2WWYA 2KKOA 3GFMA 1NSLA 4PSWA 4Y15A 5HS7A 2JEVA 4ESBA 3K9TA 1SMYF 3LA7A 3PQJA 4EJTA 3ZJ0A 5BPDA 2VBZA 4HNYB 1FPQA 5H6QA 4JLYA 2QMLA 4AB7A 4ENMA 1GHCA 3WG9A 5E1XA 1JGSA 1U3EM 1BOAA 4LB6B 3RTRA 3BPXA 2R7DA 2EJRA 3GZ6A 3WGGA 1HSTA 1ONVA 3GFLA 3BDDA 4U0VA 3R0AA 1XEBA 2Z3YA 2EVNA 3P2HA 4UUVA 4H6UA 3EC4A 5TRDA 2G9WA 1B6BA 5E1WA 1ZG3A 2EFNA 3MQ0A 3FMRA 2NNNA 2XAFA 1RUNA 2D1HA 2ZNZA 3SXOA 1VKCA 4H0EA 5A2QZ 2XGXA 5DCMA 3W6XA 2DK5A 3HRUA 4P5OA 2FNAA 1BI1A 3IWGA 3C3WA 1Q2DA 1O3TA 4KIBA 2KJBA 1B9MA 4U5YA 3V8IA 4KIGA 5LGNA 1BI3A 4S05A 3EY5A 4HNWB 2VONA 4EQQA 2QQAA 1QZYA 1PP8F 4NCZA 1E2XA 3SZTA 4KUMA 4UV9A 4YGOA 4OMZA 2QIRA 1L0OC 3RJPA 2OH1A 2QWWA 1BI2A 2FMLA 3P9IA 3W6KB 2K4BA 1FP1D 2FRHA 5F6FA 2K7LA 1Z4EA 3S2WA 1QSOA 4WWCA 4M6YA 2HYGD 2P6EA 1PUEE 2FEZA 3OOPA 2HGCA 2KRFA 1IN6A 1T0FA 2KIFA 4Q47A 3T5XA 2Y0MA 4ZYHA 4F0YA 1J7KA 4UWJA 3BROA 2M1BA 4B5OA 2MA3A 4HX8A 5A2QK 1LRZA 2HOEA 3L9FA 3L09A 2CY2A 3F22A 1FP2A 4L89A 3QAHA 4JBAA 4YFJA 1MK4A 4GCVA 2ACJA 1UFHA 2VBQA 4XNHB 2L54A 1IB1E 3U2RA 1WWXA 3W6JB 1B87A 4P9FA 2ZNYA 5CVRA 3EO4A 1B4AA 1R36A 1ZN2A 1YW8A 3RKWA 3ML6A 2BEOA 3BJAA 3IL2A 2OD5A 1YQAA 3BJ8A 5C88A 4OAEA 4L5JA 3WTWC 2Q04A 3M8EA 1USSA 1U78A 4Y17A 2G3AA 2ZW6A 1IN8A 2X4HA 3BJ6A 2LKPA 4IRHA 4S04A 2V9VA 1G6NA 1M1DA 4H89A 2XAGA 1K6OA 5ED4A 4KN4X 4UNOA 2MLKA 1TIQA 4OMYA 4HF0A 1MD0A 5K5OA 2FMYA 4LLNA 1K4JA 4OIRF
chains in the Genus database with same CATH superfamily
4PJJA 2XRCA 2P6SA 2Q4YA 5AIQA 1VTNC 1JKPC 3JCUC 1EH8A 4WP4A 2KT0A 1ZGJA 4KNYA 1K78A 1X1PA 3BR0A 3JRFA 1YLEA 1OYWA 1W4MA 4LMYA 3V7CA 5H2FC 3DLLF 4HYEA 1O3RA 3DR6A 4MJ8A 4C2XA 4A5NA 4I09A 3CF2A 4F93B 2GBYA 3VB2A 3HSEA 3CXQA 1J4JA 1OPCA 2B63J 2I00A 4CYCA 4XQFA 2UXNA 2Z11A 5LGTA 1RPWA 3G4SI 2IS4A 2ZBKA 2L4AA 1ARLA 2PRQA 3N5FA 4MFJA 1NG7A 2ORVA 2JLMA 3TCVA 3CLOA 3IU1A 4MEXF 3D68A 3VARA 5I0CA 1ACIA 3CF5F 3DFGA 2P4WA 2Z33A 2XRNA 2DT5A 3ECOA 3H5AA 2CV0A 2EILH 2ZW7A 3GLXA 4P96A 2VKEA 2VKVA 5AONA 3TDZC 1JKQC 2MC4A 3M1EA 4BYYA 1V0CA 3BG3A 4A0XA 3PNTA 1F57A 5THWA 3QP6A 4M74A 5K5QA 2D4PA 4FD5A 2RGVA 4UEZA 5F0FA 4CRZB 3HIFA 1V55H 3F8CA 3R6SA 4AD9A 5AG5A 4UCMA 3D8PA 3FIWA 5IT9K 2CTCA 4L9JA 4W9YA 3TC8A 2BHZA 3MVPA 5K8PA 2YR2A 4C3HJ 3KI9A 1OJLA 2HB6A 2F4MB 9ANTA 4E1PA 5J4YA 5FB2A 4DGWB 3PO3J 5AG4A 3JRAA 4LLLA 3OXGA 4QUSA 2QCOA 3WHBA 3UOEA 4QBJA 2E5NA 3GMEA 4BHBA 3JUWA 5IT9Z 3QPLA 4D7MA 4LIUA 4KN7X 3QRFF 2QSFX 1K4TA 1FYBA 4FCYA 3Q0UA 1V54H 3WU0A 1KBFA 2PJ2A 4II2A 3IWEA 1EH6A 1FSHA 3OYNA 2C6PA 2P5VA 3TO9A 2H6BA 4MQ9F 1VFCA 3G8WA 3D7GA 1RNLA 4TV7A 4B47A 2Y30A 4LFUA 1TW3A 2EV5A 1KMAA 4H6ZA 1OR7C 4ONUA 3K10A 1GXPA 5EG0A 3R5DA 3DQVC 2STTA 2B3VA 1ETOA 4A37A 2UZ3A 1KQ9A 1F4KA 2DPUA 4EJUA 3J81K 9WGAA 2OF7A 2ECBA 1TF9A 1VQLI 4XLPF 4DZJA 4YFNF 3CDLA 1BC8C 1STZA 4UIAA 1BJAA 2KPMA 2FOWA 3V7ZA 2G0EA 5IYDJ 3M1CA 2RN7A 3WTYC 4RI1A 1S7LA 2GU2A 4MTEA 4O5VA 2HXOA 1OKRA 2MD5A 2XKPA 1XDSA 3R1KA 1TQIA 1UHWA 3CDHA 2A3SA 4QWQA 4RS8A 3GYHX 1D8JA 1TBQR 5B66C 2Z0ZA 2LK2A 4JOMA 2BV6A 2HQYA 2CUJA 3TDUC 3O8GA 2XKOA 2OBPA 2OPTA 4PFPA 1XN7A 4KLVA 5DWMA 1DGWY 3LA3A 5CVUA 1TBRR 1UG0A 3F6VA 3RPUA 2EK5A 3K2AA 5J8FA 1W36C 4ZYQA 5JPHA 2TRTA 4MXUA 5LYDA 1SMTA 1ENHA 4Y49C 3HUVA 4YFKF 2MH2A 3ONQA 3RI4A 1IGBA 3GKRA 4KT5C 1XRYA 3KP2A 1GUUA 1IYKA 1TWCJ 2JSCA 4ITVA 2D4OA 2E34A 1TWHJ 1UJ8A 2L5QA 4IOAF 4HX7A 5D5WB 3UEYA 1F5TA 1TGSI 1FOYA 2JBJA 2UXXA 4QB9A 4LITA 3W91A 2HXIA 3DEUA 3FM3A 2JXDA 2ZENA 2Y31A 2HOAA 3S2HJ 4HW0A 2EB7A 2J87A 1YS7A 1FNOA 3FJUA 5FO5A 4BINA 4LK0F 4ZH4F 1XSDA 1IN7A 2DMUA 1LCPA 2O53A 3MMYB 4IQ4A 4PJ0C 2QQ0A 3OYFA 1SVLA 3LA2A 1QPMA 1T0FC 2W84A 1ETKA 4RAZA 4XLCA 5GP9A 1BI0A 1OVOA 2JPCA 2HQ5A 2JPBA 2YPRA 3FEEA 3QYFA 1Q2CA 1FYKA 2VBWA 1U6GA 1YMEA 4UV8A 1REPC 3IO1A 1Z3YA 4AG7A 3PM1A 3CXLA 4ZX9A 1OMUA 1XGSA 2PEXA 3MN2A 1JI8A 4Q36A 1ORKA 5J1YA 4IEJA 3QPSA 2VJJA 1LR7A 3DR8A 1IYLA 2Y2ZA 3Q9VA 4BS9A 1HW2A 2SGDI 2R7TA 3LSTA 1BIAA 3RQ4A 2L9SA 5J4VA 3NE7A 5F27A 2Y48A 3TX8A 3BP8A 3QP5A 2E1CA 3UY5A 5FKOA 2DEAA 3KZZA 4RAFA 3CO6C 2WCYA 2NOGA 1I21A 2O61A 4C2MJ 2QQCA 2L3DA 2DBBA 3BG9A 2ZMEA 3H3UA 3K2ZA 3OMYA 3RCOA 1QZZA 3RKYA 1T6SA 1UZCA 2ETHA 2QQ8A 2W82A 4A2UA 3G73A 3K7AJ 3ZMTA 1O3QA 1NUBA 1RIOH 1KYWA 5LYIA 3UKGA 2HKOA 1XGNA 3OSFA 1TZLA 3TOBA 4MHYA 4MPIA 1XDUA 2ZEFA 4KVOE 3KFWX 4NQWA 1H0ZA 3IH2A 1VQPI 1JQGA 4OKOA 2Q7BA 2CH0A 2QKMB 3F8KA 5C82A 5ICGA 4P4BA 1IRFA 4BUPA 4AIKA 3K1PA 1DS3I 2OZ6A 4L9MA 2OVOA 2DOFA 3DBHB 5K7HA 1ZARA 3PFYA 2L7MP 2FX0A 3GTLJ 5FLMJ 5HLGA 1SGQI 2DI3A 2SGPI 3HOSA 2ISZA 1SGYI 1KUYA 4IAVA 3RPUD 1LFPA 2V53A 1PUAA 3IWZA 2ZXVA 3NH4A 2DW4A 4D1QA 4FISA 4II9A 2L02A 2QQBA 1OCOH 4UVCA 2XAQA 3FSXA 2PJ6A 2AFZA 1WFXA 2BVMA 2O7OA 2FE7A 1ZAOA 2LREA 3KIOA 1T8IA 2E35A 3LSHA 2ROWA 3E3VA 2DPTA 1PUFB 4LX9A 2RREA 4W1UA 1DE4C 5LRGA 1SANA 2AFSA 3BI0A 3RIRA 4M9SA 1SVMA 3ESWB 2GXBA 1XMKA 4G8XA 2ODFA 3HOYJ 3GVAA 3DKYA 5IP7J 3V4GA 2BOAA 2IGOA 1HKTA 2EPFA 2QKLB 1K83J 1U8BA 3TO6A 2L9NA 1VQ4I 3S15J 1MMAA 3ECHA 3BT9A 2UVOA 5A28A 3BG7A 1AN1I 2CFOA 5KVRA 3HB9A 3GTPJ 2A4NA 3S9NA 1S7NA 5C4JJ 2KISA 1EF4A 1QBJA 3ASNH 1D8KA 2VI7A 4IHTA 5KAFC 1FIAA 4MY3A 5D6FA 2EFPA 3NQOA 1QMUA 1XMBA 2LF8A 4LIVA 4PK4A 2XEIA 3KP6A 3KHZA 2LY2A 3BR2A 1IY7A 2C27A 4O23A 1X3WB 5C44J 1QRYA 2ME6A 3H8FA 3BJOA 4P4EA 4C2ZA 1S3ZA 2PJBA 2KMQA 3S6HA 1D1CA 2R5YB 5FUXA 4HA8A 3CDIA 3H8EA 4PGGA 3GLJA 1I27A 4CGLA 3ULQB 2GANA 2NS8A 5LEJA 2LNBA 1FZPB 2XPWA 3MEXA 1VHOA 5ILUA 1IAWA 1XA6A 3D3SA 1S7KA 3KEQA 4F8ZA 4P10A 3S6KA 1X1CA 4CGZA 3F21A 2R7UA 1M4LA 4IUSA 4UEEA 4UIBA 4GXHA 2F48A 4M6VA 1MDMB 1P6RA 1IDZA 1Y0YA 2G0BA 1Q1VA 2PJCA 2O03A 4YFXF 4Y3OA 2E71A 4Y13A 4ZY1A 3E0JB 2ZOGA 3L7WA 2LB7A 2V8VA 1G3WA 1OCPA 3FBIB 4X2TA 5F04A 3GZ5A 1EJ9A 1A04A 3L2UA 1ZLKA 2HQNA 1F1ZA 3OS0A 4FX4A 1GDTA 2EINH 4AC0A 1X2NA 1A5JA 1VQNI 1WGTA 1VNDA 1G3YA 3HOTA 1ARMA 2PJ7A 3J7ZI 4E2AA 2OOTA 1PVEA 3TP0A 3CC7I 2A05A 2ID6A 3DWLE 4IL6C 2NVUB 2GZWA 4BEHA 3PL8A 3GFJA 2CW8A 4CCJA 3DTIA 4OLLA 5JGFA 3AG4H 1B8IB 3R4KA 2JVHA 4XLFA 1BBYA 2HU9A 4BXUA 3M4OJ 2QVOA 2WTEA 4IVNA 1SVOA 5JFRA 1KGSA 4KDPA 4JQFA 3PGPA 3M7GA 3RZOJ 4PJMA 1F2PA 1R9TJ 1QSRA 2NYXA 2LC2A 3S9MA 2VPLA 2X52A 2XEGA 5FUWA 3H5NA 3CO7C 1ZG5A 1JTXA 3OV8A 4FE4A 4HEA2 4FAIA 2VIXA 1LQ1A 2XB0X 2IA0A 3WC5A 2KHMA 3GYAA 3MGDA 5DD8A 5JQ4A 4S0HB 2XGEA 3PFIA 3A01B 3DP7A 1S9HA 5F49A 4IHSA 1LANA 4I01A 5CYVA 3SEZA 4HBLA 3GW2A 3FXTA 3OOUA 1VF9A 4G94A 2A69F 2M3AA 3GOXA 5DDGA 2ZEHA 1W0TA 3VYSB 1TIHA 3ZP5A 4XPDB 2BZTA 3SDBA 2K9QA 3CPAA 3JTGA 3I1UA 1B72A 3F8MA 5K8MA 1R5GA 5JVTA 3SI2A 1ERDA 2Y0SN 2L7KA 2YNDA 2X1DA 4GYIA 2BCOA 2WAQN 2W7NA 5IYCJ 5HNFA 4OOIA 1R4MB 3RQIA 3GWZA 1H8AC 1JUSA 2Z99A 4A3KJ 1MMSA 3LACA 1I5ZA 2OUMA 3WTZA 3S2DJ 3E0KA 4Q38A 4YIRX 1BC7C 4F52A 2NYQA 5LBQA 2HDWA 4C2TA 2DFFA 4A3DJ 3OIQA 2M8EA 2LUYA 1DP7P 4UHTA 1WJAA 5G21A 4RLQA 4ZYEA 3ZOBA 1DUXC 1Z7KB 5CCLA 3S16J 3TP3A 1FSEA 2LTPA 3CMYA 1HBXG 1A6IA 1ZELA 4ZYDA 2C6YA 1F43A 1SQHA 1TKHA 1Y0RA 2EBJA 2Q0YA 2VQHA 1PJRA 3AL0B 3KCCA 3B3SA 2X1EA 2V1CA 3SI0A 2BGCA 1IG7A 4KOTA 3J7AY 3FXOA 4WX9A 3E2IA 2CMPA 2DAOA 1RETA 2B4DB 2X7BA 3I9SA 3NH8A 5LRRA 2XROA 2XC7A 1HDPA 4KJZA 2B0UC 3PRTA 1EA3A 3TMOA 4C2UA 1W0UA 1CE3A 1TL8A 3OYGA 2Y0SA 2DXIA 2KMRA 2KMPA 4UVBA 4IRIA 5K8OA 1XG1A 2MBFA 2GOMA 2VLAA 2HV2A 1CGJI 3FF3A 4XN3A 4EWTA 3N05A 1HLVA 3KQZA 2W57A 3VOEA 4ABZA 2IJLA 3G2BA 3WHCA 1BJZA 3FF5A 2NRAC 5J1RA 1S60A 3R0JA 4P4IA 1XC5A 2AFXA 4B5PA 2EA4A 2ELKA 5DM7F 2R98A 3L1PA 3VSLA 1VQ5I 4ON0A 4R76A 3ZJ0A 2L7FP 4NBQA 3O8HA 1M4GA 2IBDA 3NRVA 2REFA 3CZXA 2BXZA 2HI3A 1MMNA 4EVIA 1KWMA 5KK1A 3DDDA 3B3VA 1H9GA 4OC2A 2K3FA 1VHSA 3ZN0A 2ADUA 1AU7A 1JUPA 3F6OA 2C1CA 4IZZA 1OCCH 3KE2A 1M4IA 4MHDA 3OIOA 1BL0A 2UWMA 3M3YJ 2AJ6A 1TTYA 3R5AA 2ZPAA 3FBUA 2VRWB 1SFOJ 4ENNA 3QQAA 4YEJA 5EG0B 1IOIA 2F5DA 1I3AA 1S7AA 3NH5A 3VDXA 5FJ8J 5F1JA 2XAJA 4KZTA 4BE2A 4NJQA 2OCEA 3JSPA 4WCGA 5GAHJ 1SFEA 5HODA 1QO0D 1W7PA 1K61A 2FIWA 3IC7A 1CP6A 3UR3C 2IQ6A 4F9UA 3PB6X 5EX0A 2LMDA 3HHGA 1HPTA 4WK8F 2PMZN 1XS9A 1WZ2A 1XSVA 5EC4A 2KZGA 2Z5UA 2R0QC 1QPIA 2BSWA 4CGPA 4XPLA 3DU6A 1BMOA 4CAEA 1TURA 3E7LA 3TEDA 1WTJA 1FOKA 2ZW5A 1T08B 3V7SA 3GTQJ 1H8LA 3IRQA 3WE3A 2X48A 5JLXA 1GVDA 1U8RA 4U7BA 3M8FA 4NSQA 1MIJA 1X10A 3EYIA 4NC6A 2K3PA 2PJAA 2IA1A 2M30A 1Y8RB 3FHZA 2GM4A 2IRFG 3KEYA 2K4JA 4KUAA 2E1MC 3G1LA 4XONA 1Z8LA 3MKWB 4E0AA 1WVRA 1GXQA 3DTEA 1WJFA 4BDZA 3GO5A 5CQEA 5L3BA 3I5UA 4QVTA 1RKWA 1FX7A 2VZZA 1MJBA 4ZY0A 2XB5A 3F23A 4HNTA 3SJEA 4NQWB 2DCEA 3HG9A 2QECA 4FTHA 3HRMA 1LPQA 2AQFA 4CUGA 1IU8A 4NNJA 1X58A 1HKQA 2IGMA 3KLNA 3E6CC 4OAZA 2V79A 1W5CC 5E18F 5FLVA 2XHKA 1I39A 4KVXA 4I0BA 1TWFJ 4CGNA 3I56I 4HZFA 4L5IA 1XMXA 4P55A 4L8AA 1WI9A 3PUFA 5CVIA 1XCVA 3R9EA 1WJCA 2EQRA 3BR6A 1PTRA 4MO7A 3R5CA 4ETSA 2YSRA 2HFHA 1UAAA 1EV7A 2F8HA 3E5XA 3I54A 3L2CA 2HWVA 1VQ7I 3W2AA 2KMOA 2LDUA 4OIDA 4G7OF 3V7RA 3RDIA 5K1YA 4CYPA 3DKXA 2WVJA 4DZPA 4A24A 1SFKA 2H5MA 1HDQA 4JZ0A 1I3QJ 4BJTA 1RO5A 3ABMH 3S14J 2BEIA 1Z6TA 1ZKGA 3BZKA 3QOPA 2P0WA 4OIPF 3R96A 4CS0B 1IO2A 5M5XJ 1M44A 2VPRA 3QPHA 1VQKI 3WG7H 4MRIA 2PJ0A 1D1BA 4QTRA 3VWDA 3E6MA 4KFCA 4IRGA 1P7JA 2LBFB 2WADA 2Z1DA 3RKXA 2RQPA 4RM2A 2PC1A 4M3SA 1M1EB 1G4DA 4JD6A 2RAEA 1P4AA 1POGA 2BY0A 1Y8FA 3FVLA 2R5YA 4LGWA 4RB3C 1RTQA 4D5FA 2A6TA 4M6HA 4MFPA 3B35A 3B3WA 1XFOA 1YSJA 1Y0UA 1H88C 1ZHFA 1YRNA 3KKWA 1OZPA 2ORWA 5G20A 4G6TB 5FGMA 1W7PD 3H0GJ 2QYVA 3LL7A 4ZZDA 3IKTA 4BHPA 4MCRA 2PJRA 2FSWA 3DV8A 1KQ0A 1MMGA 2HZTA 4AIHA 2H8WA 3ZXSA 2NU1I 1FAQA 2BW3A 2GWRA 5ILSA 4BDYA 2HPIA 3J7AO 1IICA 2M7BA 1LNWA 1AYEA 2R5ZB 1NE9A 2FSRA 3S3MA 4Z6YA 5F47A 1IXRC 4MLOA 3LSRA 2D45A 3IGRA 5ISVA 4FD4A 5HDNA 3IIBA 3KR4A 4OMEA 1AKHA 2GA2A 2O4HA 4HPQA 3FXLA 2ZEGA 3HUGA 3BLNA 4A0ZA 5K7FA 3HKZA 4PCQA 1ZTRA 5EEGA 3IU2A 4M6GA 5HLIA 4MFDA 5LHIA 2JA6J 4U0WA 2BE5F 5L3FA 1KZFA 1MGTA 3EUHC 2ESNA 1WGXA 4AM3A 3O3KA 4UB6C 2DPSA 4B44A 2GIZA 1LDJA 2M5XA 3E1SA 1CG2A 2X51A 2B4BA 2ZMEC 4XNFA 3SYTA 2H27A 1MJAA 3RU0A 3CC2I 5IOZA 1S8NA 3G1MA 2PDOA 3KZIC 2W85A 2LH9A 1VZ0A 4HDUA 2VE8A 1YE9A 5CQGA 3QYBA 3PIPF 3LNQA 1N75A 3ZQ7A 5E3QA 5J40A 4YIFA 3ABUA 4JYWA 4O3MA 3CESA 1ETYA 5E20A 4HLYA 1UMQA 2WPWA 5KTAA 1E17A 2M0MA 2V1XA 5F08A 5G22A 1YHQI 1QSMA 2ATRA 1U9NA 4DYOA 3FWEA 2O9LA 4GS4A 4RUHA 4MNUA 5LFAA 3WU2C 3EETA 4CHUA 2JRTA 3KY9A 4HKFA 5F64A 4CYNA 3DU5A 1Z3XA 3HGGA 2B9SA 5FRNA 2F5IA 1JJ8C 1MNEA 1XOVA 3BY6A 4CCNA 3IP4B 4SGBI 2RKHA 4XNHC 4MCPA 2ZFWA 3FECA 5AG7A 1Q2YA 1K7TA 4MEYF 3EDPA 2L9RA 3RYPA 3B3CA 1X3ZB 4AVBA 3JTHA 2UUZA 3D7DA 2R7QA 5FRMA 5HS9A 1UWYA 4BBHA 1R3NA 4CYQA 1BUSA 2GKTI 2YUSA 2V6CA 3JW4A 5C3EJ 2PMHA 5CNPA 2EZLA 3FRMA 2W1OA 1AA7A 3V42A 1TUSA 2YX7A 3I9V2 4N4OB 3B8GA 3U1KA 2QM3A 3QPTA 1YLOA 4UBRA 2WAFA 1SD6A 3HM5A 1FLIA 1O4XA 1QHGA 4WXDA 1WJDA 5GADJ 1YYVA 3CMEI 1NK3P 2VE9A 1FYMA 3QNVA 3GUDA 5HOOA 2Q8KA 4EJOA 2PBIA 4IK2A 1D0YA 2HQRA 1VQ9I 2PVWA 4LJZF 2Z3MA 2IVMA 4CAVA 5EJCA 1EKEA 2W0TA 4MY0A 2V8DA 3C1DA 4K3NA 1R5HA 3FC3A 3MCZA 1UVFA 4EGZA 2GXAA 2DJIA 5EYRA 3WABA 3ISPA 4EM0B 2ABZA 4MHGA 4Q5SF 1ZYRF 4MMOA 3BR3A 1BPNA 4R8FA 4CRYB 2MYSA 1KQ8A 3IAS2 3IRRA 3SJMA 4MHZA 2KL4A 2XSDC 2E2IJ 1K7UA 3FEDA 2ZXHA 3P9KA 3V8JA 1IV6A 2KCXA 3VWBA 2AS5F 3R60A 1XD7A 3BC8A 1R1VA 3OSGA 2GKRI 2VUMJ 2Q0OA 2K9HA 4HG2A 5FKMA 1T39A 3EUKL 5DM6F 3HOXJ 5H20A 2XEJA 3MD2A 5J6XA 4MFKA 4UXIA 3D2PA 3K70D 3I53A 4BQAA 2VC1A 4HF1A 5J8CA 2ELIA 1OCRH 3NFZA 3D7FA 5D5VB 1O7LA 1DS2I 4D0PA 2CWFA 2GQQA 5DCMB 4ANJA 1T95A 1TBOA 3A0BC 3CP8A 2DU9A 3BJIA 2VQLA 3FIXA 5HMNA 1QHHD 1RZ4A 4R1HA 5D5UB 2PVVA 5FUYA 3AL0C 5D8KB 1XE4A 1OCTC 2R5ZA 2RDPA 2G9DA 3BR1A 2V7FA 1Y1VJ 1HQCA 2ECCA 2L4MA 3PZJA 1GV5A 3CMMA 4L9TA 5D4RA 1Y1WJ 2Z10A 3LODA 4CAXA 2ZEMA 3J7YJ 4CGOA 4Q48A 2P7VB 2BUSA 1T56A 1W3SA 5FLXZ 1OYYA 4N0BA 4A38A 1FOWA 2ZSIB 1YQEA 3E6DA 1I50J 1W1WE 3U1DA 3VYTB 1Q9BA 2E60A 4RDUA 3E5UA 4KITB 1B9NA 2QEXI 2Q44A 4FUUA 3SJFA 3T8WA 1XGOA 1Y1BA 1R4NB 2L8EA 2P81A 2ZSHB 4LUAA 2WV1A 2X6OA 4BNCA 3L00A 3CCEI 5J47A 1E3PA 3Q3SA 4UY8I 1P9GA 2VXKA 3OS2A 4PJLA 3I58A 3NARA 2ZO4A 1TW2A 2F5VA 3B6CA 3EQLF 3K1MA 3MAJA 3TO7A 3S1QJ 4E6KG 1G2HA 2NSMA 2BY3A 3LWUA 2PJPA 5CBMA 3UFFA 3SDGA 3C2BA 3I71A 4LB5A 1OYIA 4MFQA 4BMHA 4F91B 1XX5A 2PCUA 1NSAA 4ESJA 3K0LA 2CQKA 4ZDPA 4XIDA 4AVAA 2EFOA 2FCKA 1QVUA 5J3LA 2JRMA 3KP4A 1ZG8A 2IPQX 2IA2A 1T38A 1W5TA 6PAXA 1NXUA 1YTYA 2RFHA 2H1LA 3ZPLA 2ARHA 2F4OB 2V77A 2VL1A 4KUBA 1FTZA 4MFLA 3LAJA 2FT0A 1K78B 2J5OA 4IQJA 3ZMZA 4PXDA 1IY5A 3FM5A 4A94A 1FIPA 4MTDA 3E6BA 5L3GA 5F48A 3HUGB 5EMIA 3CCVI 5BQTA 3CCRI 1Z7LA 2L7ZA 4Z2YA 2G7UA 2OQRA 1P4NA 3OXFA 4NHJA 2Z9OA 2IL4A 2XGDA 1LR8A 5HQ8A 2IGKA 3C18A 3PIOF 3K9UA 4G7HF 4OIQF 4NB5A 4F7ZA 1CQTA 2CNTA 2HTJA 2X6XA 4I0AA 4I02A 3KL9A 4GM5A 3PDNA 1V1IA 4MHNA 4YU9A 2WY8Q 5FVJA 1CHOI 1UHMA 1Y9KA 3H5ZA 1SFXA 4KOSA 2ZC2A 1Z77A 2HUZA 1JKRC 1JWQA 3LFKA 4D9JA 1YU6C 2Z16A 2JYYA 2K40A 4CSWA 1Y7EA 1HA8A 3DSBA 4NC7A 1LB2A 5FD6A 1SC7A 2STWA 3RPQA 3CD6I 1Q1HA 1CT2I 2KDOA 5HS8A 2SGEI 1LKXA 2PR8A 2JZYA 4I2OA 4R3KA 2PI0A 5BMZA 4DYCA 4A3BJ 1F36A 4XK4A 5E1ZB 4CCOA 3ZQHA 1RC9A 3H9QA 3GTGJ 1Z0XA 2I8DA 1Q7LA 4AVPA 2OU2A 4HSRA 2FU4A 2J8NA 4LQ6A 4X8IA 4XKBA 5IP6A 2LG4A 3M8JA 3SGBI 2XV4S 4WF2A 3G3ZA 4IOCF 3WGHA 4XKVA 1VHEA 4QC6A 3GUXA 5FROA 2XSJC 2XUBA 3ZMDA 3KYLA 4XICA 1ZG9A 2IS6A 2D5VA 2CUFA 2FD5A 3VYRB 3QTLD 4ZX8A 5CKTA 3N7ZA 4GI3C 2WUUA 4RS2A 3NEUA 3VWEA 2CJSC 3SEQA 1LR9A 2DFIA 1CJWA 1BM9A 1V5FA 3LMSA 4LG0A 3AKZA 3DF8A 2ZB9A 1AOYA 1XBTA 1UG2A 2CUZA 4UUSA 3HOZJ 1CT4I 5GPCA 4FKDA 3ZQQA 2DXQA 3KP3A 3E5QA 2DK8A 1TQPA 4BY7J 4DBRA 3S93A 1KUXA 4C68A 4RAYA 3BOQA 2YGWA 2D1VA 3WTUC 3WT4A 4LLGF 3LSIA 4A6EA 3LSJA 1R22A 4FETA 5FKKA 2FUG2 2VEZA 5E3NA 4ZJZA 4A3CJ 1HF0A 1ZLIA 1MBKA 2LY1A 1EH7A 4M3GA 4A69C 1MKMA 4MHPA 1IOFA 1FBSA 2EFQA 1YG2A 4L5EA 2PX9A 4KIFA 2DJNA 1GVJA 3WE2A 3NE8A 4JXRA 4Q7AA 3H4QA 2YS9A 5J1QA 2DDBA 2EH3A 3ZGKA 1N77A 3BWGA 5HDGA 2R8VA 3GY9A 4CZZA 4CA0A 2R7VA 2QYOA 1YOVB 4FHTA 1QNTA 2XVCA 4RMNA 2HS5A 5ICEA 1Z21A 3CCYA 4FASD 4A3IJ 2O8KA 4HAMA 2YU9J 2TDXA 1LEBA 3R95A 2GOXB 4KYWA 3PB8X 4AIDA 3OR2C 1MBHA 1Y56A 2M87A 4J01A 4IHMA 3HXLA 1BO4A 3F8NA 1WGCA 4P9UA 2CW7A 1JHHA 2LSOA 1YIJI 5IV0A 2OA4A 2GXGA 1Y9WA 4R57A 2JDDA 3OYHA 1WKMA 3ZMSA 1J75A 2J8RA 1O3SA 3D2MA 4LK1F 3T1BA 1S29A 1TNSA 1A36A 1P7IA 4EJWA 1OISA 2M9HA 1DGRM 4XLNF 3TGNA 2W24A 4M6XA 2PSWA 4I76A 1U9OA 3BZ6A 2YNCC 4MCSA 2LD5A 4BGDA 3HJEA 5M5YJ 2LOOA 3T8TA 1K79A 2FA5A 4G12A 4RGRA 2QBYB 4GXOA 3TJQA 4B6DA 3SJGA 4B6ZA 5CLSA 1OMIA 3F8FA 5DYMA 1JXSA 1PDNC 4IF5A 2VKDA 4HPSA 1HJAI 4B8XA 4P4JA 2DQLA 1DU0A 3L2VA 1J9IA 3R5BA 1S6LA 2CW0F 2DPDA 4NXYA 1UCRA 2FE3A 3GB0A 2F5FA 4I7HA 2B5GB 3K2KA 1ZRFA 4W97A 2QJ8A 2E1NA 1LE8A 1Z6RA 1ELLP 4DQ2A 2R1IA 4FD6A 1TBXA 3VDUA 3Q9SA 2PG4A 3CCSI 1FMVA 2QLZA 3K6GA 4YG2F 2VQYA 2E5ZA 1XBUA 4UCNA 3SI1A 2X6YA 3QB8A 2MABA 1X74A 2ZEOA 2O8XA 3CQZJ 4DYRA 4DYQA 3C26A 3EYYA 3ELKA 2FS5A 1YITI 3FH4A 4LQGA 4EJVA 2ELJA 4HV6A 3S8PA 1R71A 2WAEA 2IMOA 3P7NA 2V1DA 1GT0C 3H92A 2ENZA 3H9JA 1Y8QB 2L0KA 5M3FJ 3L2QA 3ABTA 1TXRA 2BO9A 2PE3A 2C6CA 1J2XA 1M8BA 4PV6A 4HX4A 1SGEI 5ERIA 2P6GA 3HRSA 3C7JA 3GIUA 4NGSA 2N8GA 2E2JJ 1IUYA 3FK6A 1N25A 3S32A 1I6XA 1MW7A 2V8GA 1GYTA 1IJWC 2J5PA 1J0RA 2MW8A 4IF4A 3S17J 4OVOA 5GTHC 4A3FJ 2VKHA 5GPAA 2ZFUA 4E1RA 3AG3H 3D0SA 3PSIA 1KA8A 4B3XA 4UXJA 1N71A 4X3RA 4PXCA 3CUOA 5DUIA 5EGOB 1KBEA 1Z9UA 5LHGA 3ZQCA 1IXCA 1KZHA 3OS1A 3F5BA 1HW5A 4Z65A 3FX3A 2K5TA 2BXYA 4A95A 5I4MA 2B4DA 3O6BB 1WWZA 2CTBA 2FBHA 2VJIA 3DLJA 3WC6A 2PJ4A 2CRGA 4U9ZA 1BN5A 2DMNA 3FXJA 4ORFA 3NAUA 3SHFA 4B3AA 1JT0A 4IHYA 3J80K 2X0LA 5TGTA 2E5RA 2ID3A 1A31A 4LG3A 2FIAA 3GFIA 5K5RA 1ZH5A 5L3DA 2QSHX 2WB1A 2VBYA 4IHWA 2EA2A 1HDUA 2P6FA 5CPRB 4C2YA 4R87A 1V5EA 2EZKA 5ILVA 1ULNA 2KRHA 2PMUA 1A35A 4OU0A 3H8GA 2CWEA 5G1ZA 2XAHA 2LR8A 2P5LC 1X4PA 3BZCA 4M9XA 2F6CA 3S1NJ 4HRIA 1GLNA 3D4UA 2R3SA 3FXQA 4UA3A 2QENA 2R7RA 4PSXA 1KU7A 2ZJ2A 3K1NA 1RI7A 4PGHA 3I4MJ 2CWGA 3A9LA 4L0YB 4P6YA 2L9VA 2KJCA 5DTDA 5HLHA 3BCAA 1FBUA 3KPHA 4HOBA 2K5CA 2MC3A 1YK3A 2O28A 2OAZA 3TL4X 2VJ4A 1IGNA 4NEXA 2XF6A 1S5LC 3WU1B 3HKZN 1R6RA 5EZGA 1P9ZA 1YREA 4XOTA 4B13A 4ESFA 4GYGA 5HDKA 1XTAA 3I59B 3TOAA 5BPIA 3CUQB 2DMPA 2H1KA 4DBQA 2Z3LA 1W7PB 1ZREA 2I79A 2CU7A 2ZMEB 3A01A 4UFWA 1J59A 3OIPA 3JAMZ 4QLCU 5EDNA 3EFAA 5IYBJ 1SGDI 3B3TA 2WB1N 2KZVA 4UUTA 4CCKA 1A6QA 2YNCA 3ISXA 1BR2A 2CQNA 4A5MA 5JHFA 1YI2I 5LLQA 4JXQA 3SXYA 3FMCA 4KICA 3HYIA 3BPVA 4RB0A 2GLOA 1R5ID 2YQPA 2LF7A 2B0LA 3KETA 1DDNA 5JR3A 8CPAA 4PK2A 4XR6A 2CSOA 4CCMA 5HVQC 1WSUA 1YO5C 1FBQA 1MSFC 2P6TA 2VB6A 3FK7A 1NHAA 1U5TB 1S7FA 5DUKA 1FY7A 2R7WA 4A32A 1R7JA 1R58A 4V2FA 1AWCA 3E59A 5L3CA 5IB0A 3KLOA 2LKSA 3CCUI 3HOUJ 1K7AA 2ENNA 3JRBA 3HSRA 1YR0A 2B58A 4BBRJ 3K4CA 4C30A 4RGXA 3OYIA 2W4SA 1Z1DA 3CC4I 3D5RC 4E4HA 3HL2A 1SAUA 5ICCA 2VJ5A 3CUQA 5KCMA 4B14A 4ONWA 2UV1A 4FQGA 4ZC3A 4CICA 4EATA 4B1RA 2EIKH 4BQQA 3WTTC 2JBKA 1PYVA 2HR3A 3TW6A 1O7FA 5KHDA 2IS1A 3MN8A 5ICFA 2O3FA 5JM6A 1S5KA 2IGNA 2K9MA 4XPKA 1FTTA 4M3EA 2O6GE 2ZOFA 2DDAA 2M0CA 2WA0A 4RLFA 4OADA 4G7ZF 1ZGAA 4OC5A 1IN5A 1O57A 4CZCA 1XX6A 2V1CC 3SZPA 1NMTA 4HNUA 3G71I 2PN6A 3A2KA 4GGGA 1M8CA 1E0EA 5JI6A 4DJLA 2GREA 3S3NA 4CXFA 4M71A 4B43A 2P5KA 1WH5A 3CJRB 1C0WA 2R7XA 1JJ6C 2Q4VA 3IUOA 1BR1A 3CXPA 2JDCA 2PRBA 1PUFA 1XMTA 4UFXA 3UGIA 4K2EA 2R7OA 3W2WA 5D8NA 4PQAA 4OC0A 5IB9A 3EXNA 3IJ3A 3RYRA 4EVYA 2R7ZJ 4J19A 1D0XA 1IXSB 3KQXA 2ZEEA 1OYVI 4EEFG 1FC3A 1JUMA 1MBJA 4XKWA 3FMQA 2DT6A 4DOZA 3HDDA 4BEHB 2CV1A 4B09A 3RO0A 3ERED 2N17A 2AE6A 4BAYA 2A5YB 2AXLA 4A3LJ 2QQDA 1SD7A 3SQNA 5EBVA 2HVQA 3JVNA 4L9NA 2EFWA 1FNNA 2V1UA 3CJNA 4HQEA 4IPAA 3ZRGA 2V6EA 2KIMA 4EMSA 4XBFA 2YX4A 3C2GA 5BWAB 2N1AB 5TJJA 2JZMA 4UF4A 2P8TA 3H3ZA 2XPUA 3LMMA 4XOPA 3ROUA 2EUIA 1QQ9A 3A03A 1TQMA 2ZXWH 3HBLA 3T8RA 3JRHA 3DPTA 4OIOF 2H6CA 2FXFA 3B02A 4MBUA 1BIBA 2FF4A 4A3EJ 1N78A 3TT2A 3RZDJ 2E36A 4H4KC 2VZYA 3OYMA 4KISA 1LAPA 4PK3A 1G3SA 3GEZA 3ZMUA 1HDDC 4M3BA 2ZW4A 1UFMA 4M73A 1YVOA 4BH9A 4EM2A 3PFOA 5JLWA 3HZJA 4G6QA 1ON1A 1I1DA 4IX7A 3RBUA 4L9VA 4QSHA 1YVKA 2VT2A 2HQAA 3DEWA 3IFEA 2GAUA 4XPDC 4ZTJA 1ZLHA 3TFYA 4Y7NJ 2LLKA 5LRJA 2HYFA 2BVLA 4GFBA 3I59A 4XLAA 1Z2LA 2DYRH 2IJZA 4WJBA 3VDPA 3REOA 4A12A 1PJUA 2PJ5A 2X6WA 4XRMA 5FFZA 3IH3A 5LEKA 2X9DA 3KP5A 3HRTA 4D5CA 5LRKA 3GCMA 1T98A 1J5YA 2HTSA 2RVCA 1LVKA 3OXLA 1Z5RA 4BE1A 2Z3KA 1IF1A 4DIQA 3DBRB 1HSJA 1YJ9I 2F5CA 2FBKA 1U5TC 1LE8B 1S72I 2CQ7A 1FEXA 1MZBA 3MWMA 3UNGC 3HPHA 4N9HA 2PJ8A 2FOKA 5KTCA 1SD4A 2NAZA 5E8GA 2VBXA 1RRJA 2XRLA 4KOWA 2AHQA 2OR4A 2VN2A 4KSIA 5F0CA 5FD5A 4E8OA 3GTOJ 4KLWA 5K8NA 2PIZA 3A1YA 1Y6IA 2CGPA 3C2HA 1Z2IA 4HQMA 4I99C 5H6RA 1F9NA 3OL4A 2PMZA 4U9YA 4ZDOA 2M5WA 2NU4I 2EK9A 4OINF 1FOXA 1LJ9A 1VI0A 4RGSA 2Q4ZA 3HOVJ 4B4CA 2R4GA 4CYCB 5GAEJ 5CJ9A 1OBRA 4KVME 2OC6A 2IEKA 4FX0A 2Y9YA 1R49A 2MLGA 3R61A 1ETWA 1MBGA 1KUVA 3LWFA 4HNVA 4R7MA 4WWVA 6CPAA 2IP2A 2JT1A 1P4WA 3P9CA 5DV5A 1U6MA 2X1CA 4CPAA 1BOBA 2QGUA 4G9YA 5IY5H 2V4JC 4U7DA 4WXHA 1IRZA 4RA2A 5HLTA 1S20A 3M9AA 1CX8A 2DTZA 2QQ9A 3LAPA 2ZEPA 2BYVE 3WODF 4XRFA 1R23A 3IWFA 3OR1C 2EO8A 1WRJA 5LRSA 3V38A 1IV8A 3W6VA 2Q43A 2K02A 4XKCA 3FZVA 1X4SA 3FB3A 3ISZA 4KMUX 4HNXB 1AHDP 3F3XA 4A3MJ 2CJJA 5AIPA 2NVYJ 4K30A 2VODA 2EBIA 2HNHA 4E7LA 2EWBA 2NVTJ 5E3PA 4KT6A 4JCVE 5HVGA 2O0YA 3FISA 2KRCA 2LY9A 4II3A 3WTVC 2UZKA 2WC2A 3S1MJ 3R9FA 2WY7Q 3ZQIA 4C7HA 2JA2A 2R7FA 3UGLA 4KA4A 4M85A 3FHNA 3AAFA 3FX6A 1TNTA 4KOVA 3FBNB 3IWWA 3RZAA 4XRSA 2EIJH 1CF7B 4X1EA 4ENKA 4PDKA 2B5GA 5H86A 1Y0NA 3DBLB 1ODDA 3QAYA 2OTLI 2ZXJA 1CP7A 1BW6A 4EGYA 1BAVA 1PCAA 1YW9A 2FQ4A 4ZTFA 3EUAA 5CPAA 2DFHA 4C3IJ 4BKXA 3LSMA 1IIDA 4JX5A 2OB0A 2DMTA 1YW6A 4UUSB 2DYSH 2AQEA 1Y39A 4AG9A 4F6AA 3GZNB 1IRGA 3HPGA 2A6EF 3PP9A 1K4SA 1MH4A 1L0CA 1D3YA 1LDDA 1NG6A 3PB7X 4UFVA 4N9IA 1W5SA 1FT7A 4AU7A 5GTIC 3HGYA 3PQKA 1U5KA 4CDGA 4XSXF 4GRIA 4U0YA 1JE8A 2QUFA 2A20A 1LUJB 2A68F 3GLLA 1W36D 4O6JA 1V1HA 1TP4A 3KGQA 4A39A 1VQMI 3PB4X 3K4KA 2BUEA 2J9AA 2KLOA 1ZRCA 3MZHA 3W6SA 1R1UA 2CUEA 1IN4A 3D1NI 3CCQI 1YFHA 1CF7A 2FVGA 4JYKA 1VQOI 3B6AA 3L2RA 4RM3A 1PYTB 4I49A 2MSYA 3ASOH 3JRGA 1MMDA 1YX0A 1BPMA 3CPXA 1UELB 2NS0A 3BTIA 4L0ZB 2PR1A 4KORA 1KU3A 2PFBA 5HXDA 3D5LA 2MH9A 2XF7A 2VOOA 1I1GA 3FNCA 2JA7J 2GE3A 4R8HA 4XSZF 2XEFA 1JGGA 2EV6A 1UHSA 3TW7A 2ARPF 3OL3A 1RXTA 2OZGA 2H09A 2M2EA 3W3CA 4R3LA 5FLXK 1UUCA 2DF5A 2MG4A 3HTUA 4NGNA 4ZZLA 2WPXA 4IO9F 5DWNA 1PP7U 1E3OC 2QZ8A 1ETVA 3LQRA 1TOTA 5B1AH 2NU3I 1YS6A 4N4NB 2AFOA 2V8HA 1ZR4A 3TKYA 2JTVA 4ASNA 4IKFA 1JKOC 2HC9A 4U87A 4BACA 3K4NA 1ETXA 2ZKZA 4M3DA 1LOKA 4V19K 3DXJF 3O2PE 2IXSA 4M72A 3EUHA 3U9GA 5IT3A 2E2HJ 3GX4X 1HEEA 2FBIA 2XDVA 3RSNA 3V8LA 1R00A 2CO5A 1PCEA 5E3MA 3DPLC 3Q5FA 2PLYA 4RAGA 4UXNA 1YGHA 1S7OA 3VFZA 5FUVA 1FYLA 1TF8A 4ENJA 2B7EA 3BJ7A 2CG4A 2R7HA 4P45A 2IT0A 2K27A 1PU9A 5F46A 4HF2A 3T0YA 4ZGYB 2XAUA 3PJRA 4PXBA 2NVXJ 2HYJA 1T33A 2SGFI 1OLTA 3D00A 2FNFX 2HDCA 1F2OA 3KASA 1AKHB 1GV2A 1S7EA 2M8GX 3GF2A 3HTSB 5J1UA 2E7WA 2GLJA 1D1AA 1KU2A 3G3SA 2Q2EA 5KNLA 1HC8A 2CYYA 2R92J 2RV8A 3B2YA 3FXUA 1SD5A 5CVVA 1H0MA 2YUUA 3MFKA 2ZEDA 3VEPA 1G8XA 7WGAA 4KSFA 3CLQA 3S6GA 4A2ZA 1NK2P 2RNJA 3I4PA 3H0DA 1DPRA 1XPXA 3KP7A 1I12A 4KMFA 3SGQI 4XORA 3BR5A 3H5RA 1KONA 4NJRA 4Y52J 4DNCA 2ZXIA 1FWZA 3D66A 2HKXA 3OYCA 2KQRA 3KYCB 3Q0VA 2DLLA 4R9MA 2VXZA 1Z05A 5D4SA 2BW3B 3MZYA 5DEQA 3FYNA 3J81Z 2WSAA 4V2GA 1IZ1A 4OC3A 1XB4A 3VODA 2R7SA 3ZN1A 1ITYA 5JHUA 4BXXJ 4H2KA 4M6IA 4G6DA 1U5TA 4QPOA 1PTQA 1KYZA 4UVAA 4NGPA 1JTYA 3LD2A 4OAYA 2NS7A 3DKWA 3CUQC 4WXCA 3R9GA 1MH3A 2ISYA 3I3GA 5D5XB 3CCLI 3PNYA 4B10A 1B1BA 2F2EA 3BTJA 2E1MB 1D0ZA 2I10A 7CPAA 5LD2C 2TCTA 3HSFA 3UGDA 1QGPA 4CYOA 2WYRA 1RFHA 2DTRA 2O5RA 1Z4RA 5F0HA 2NXNB 2LYCA 5FFXA 4AWXB 3P2FA 2J9RA 1I1SA 4MI4A 1P92A 4UWIA 1LFWA 5HNHA 4XLHA 4BY1J 2QF7A 1Y7RA 3IV5A 2W48A 5FKLA 4MFZA 3OYLA 1QSTA 5LHHA 1A2ZA 2LEOA 1DQUA 3SZGA 1MDMA 2RB7A 3PBEA 2PQ8A 1HXDA 2YU3A 5CVJA 3VH9A 4PXEA 4MIMA 2COMA 2X85A 2OZHA 2J8MA 3HHHA 4CCLA 3S6FA 4FE7A 2WV0A 3GXOA 3OYKA 3BTLA 1ON2A 4KOXA 1CM0A 1XSXA 4E7IA 4PPZA 3P5JA 2KIQA 1IRXA 2Y75A 1YJWI 4F3QA 5GAGJ 3CT9A 4MGRA 1P4XA 1K7VA 2EV0A 2POKA 5HH1A 2NMTA 4A0YA 3BXMA 3FSYA 3JSOA 3T90A 3CTAA 3JRDA 1WKXA 1NH3A 3Q0WA 2DO7A 1ELMP 2CNSA 3N4MA 1ZK8A 2ELHA 4AVZA 3RYOA 1D5VA 3BG6A 2NU0I 4NGTA 5L3EA 5F1RA 2DT7B 2PJ9A 1P2FA 2KCWA 4E7ZA 2AFWA 5JVGF 4Y33A 4ZYAA 4ZBGA 1YRNB 2ZCWA 2HEOA 2PJ3A 3DNSA 4DJAA 1X2MA 3FXMA 4F0XA 1V4RA 2ZJPF 2JN6A 4C9YA 2HVRA 4ZI6A 2M4KA 1G59A 3FDYA 3QU3A 3ZZIA 4RB2C 4UB8C 4M3FA 2DA6A 2VI6A 3SFIA 1Z8WA 2CQQA 3H3VK 4A3JJ 2FXAA 4GO1A 5IX3A 4BE0A 1SAXA 5EGOA 2E19A 1U2WA 3PFEA 1QU3A 4KOYA 4MFEA 4PFOA 1Z7UA 2M34A 3ABLH 4Y49B 1SEUA 2GA1A 2QBYA 4C7IA 3E97A 5JHWC 2KIUA 1GHEA 4FD7A 1MBFA 3QOEA 4FBEA 1IC8A 3JR9A 4R6TA 2W25A 4JX4A 2DODA 2A61A 4EM1A 3GTMJ 3CXSA 1T2KA 3WTSC 5D8LB 1X1AA 2QSGX 3N97A 1ZG1A 1LEAA 5BOXA 4JJXA 3ZQFA 4IJAA 1H9TA 4AYBN 1Z9CA 1H89C 3OWCA 3FMSA 1JHFA 1UB9A 2JMWA 4E70A 3JRCA 3JREA 4B48A 2OV7A 4PJNA 2CWHA 2Z3OA 3KR5A 4P4DA 4U88A 1B59A 1YJNI 5HI7A 2IS2A 3KZWA 5B1BH 2DKVA 5E17F 5H84A 1R1TA 3WGIA 3D7HA 3I0TA 4B5PB 3LSGA 1ULKA 4QIWN 4FT8A 3AG2H 4AYBA 1OR7A 2XIGA 3CJTB 3B73A 2Q51A 4BHCA 1WH7A 3FKJA 2JQ7A 2N71A 4AVCA 4RGUA 1ULYA 4XRSG 1LAMA 2BY2A 4J3GA 2RIJA 3DCFA 2ICWG 1V3FA 2LP0A 2AXTC 1QQIA 2H94A 3X2QH 2EZIA 4IHVA 1P0HA 3QWLA 1UVGA 2KFDA 1HDLA 2EWNA 4JWPA 4M9ZA 2DFEA 1HW1A 3TBIA 2ZELA 4XL9A 2K86A 2Y69H 1X1BA 4X0GA 1X4OA 4NGRA 1ZR2A 3S3OA 2DIPA 1CBXA 4TWEA 2EZHA 2FNPA 2N52A 2NOJB 2LBFA 2OZUA 1APLC 4TNUA 4X5KA 2XF5A 5B3SH 3KEOA 1IW7F 1TWAJ 1XGMA 4Q4ZF 4YRHA 1E3HA 2BHYA 2M45A 4ZDLA 1RUOA 4OC1A 2GFQA 2E1OA 2VASA 1WJBA 3TE4A 4PUSA 2BBYA 3WC7A 1DPUA 2MD0A 1HKSA 3ZMVA 2P7CB 1ZG7A 5AGEA 2P6AC 1WK4A 3RNZA 1LFUP 1FJLA 1Z8TA 3M07A 3ZR8X 1IY6A 2ESHA 2GIVA 2DQRA 2L7XA 3CDXA 1EE3P 4CO8A 1B6AA 1ZLJA 5EZHA 2GKVA 3JTKA 5IP9J 3DLAA 3KZYA 3LSPA 4A93J 5DCFA 3F72A 5D29A 5BS6A 1TLHB 4L18B 3NA6A 4UCPA 3L2WA 5D6EA 1YLFA 2DA1A 1ZQ3P 2REEA 3PNVA 4BXFA 3UEJA 3ZCOA 4HDVA 1M4DA 3SFZA 5JH9A 1CGII 1USTA 1R43A 5GCNA 1WJEA 3BQZA 1Z91A 3QODA 3HOWJ 2RC4A 1WQ2A 1MJ9A 5E8IA 4HLXA 4A6DA 4LD5A 3OYDA 2LKXA 2LFBA 4J00A 3ZQLA 2CV2A 2JUCA 4YELA 1LFBA 3ABKH 2VOPA 1QSNA 3TTHA 2KP6A 4NUBA 3JAMK 1OQYA 2D2WA 2CNMA 2VXDA 3WTXC 2FQ3A 1BA5A 3SHPA 1XF8A 3FKIJ 1XMAA 2LRDA 3KYDB 2G7HA 2CFXA 4A3GJ 3ZQGA 2DA5A 1VQ8I 2F4IA 2JK3A 3V8KA 3JRUA 3OYBA 2CXAA 2K85A 4NDLA 1TT0A 1HOMA 1YW4A 3T9YA 3PEIA 1ETQA 4I6ZA 1QVTA 1VDDA 3K4JA 3D67A 4D7NA 3LQQA 2IW5A 5DD4A 3PB9X 5ELYA 4AIJA 1HCRA 2M4GA 3QYEA 4ZYGA 4G1PA 3COAC 1SFUA 4LG0B 2V9PA 1YIOA 2WZNA 4NF1A 2F5EA 4CYDA 3MRUA 1YX5A 3I3LA 1G3TA 4ZY2A 4BU2A 2VT3A 2GVIA 4B11A 1TWGJ 1LDKB 5E96A 4AMLA 3JRIA 1ZRDA 3DGVA 1DP3A 2OJED 1TKFA 2B3UA 2Q7SA 1FT9A 1RR7A 1VIXA 3IHUA 1XCBA 4E7HA 2FL4A 1SGRI 1YW7A 2G3TA 2ODDA 2L01A 4OC4A 5LYFA 3CJQB 2L2OA 2VQCA 4YIIA 4CAWA 4A31A 4IXAA 3A0HC 2OD1A 4UXHA 2MGQA 1R57A 1X12A 3J80Z 2A6HF 3MKLA 2VC0A 4MCQA 5KTDA 1QA6A 3H36A 1ON0A 2CIJA 5EEHA 1L3LA 3F9KA 2ME0A 1PPFI 4B12A 3B7IA 4FWUA 1LVAA 1YX3A 4RB1A 3SXNA 4EV0A 2XPVA 4CAFA 5K7ZA 1KU9A 3I4NJ 4A33A 4I98B 5M3MJ 1X3UA 3I64A 2K9LA 1B72B 2Z2SB 4JK1X 4PZJA 2BL1A 3WR7A 1CSOI 5E79C 3TQNA 4JX6A 1S3JA 4HV5A 3F0AA 3IKVA 5FKNA 5M5WJ 4YRVA 3QU6A 3OY9A 2NNYA 2E7XA 1SGPI 1X1DA 3FXRA 1Y1CA 1CGPA 2Q2EB 5E3RA 2C6GA 4YWYA 1V5GA 3K4BA 3K69A 3W2VA 5LGUA 2DOEA 3F8BA 5LYLA 2XASA 1FMWA 2K9NA 1CT0I 4C3JJ 4KOUA 4MQVA 4F9VA 4OIWA 4KS9A 3VYUB 3QWPA 1XIXA 2OQGA 2A07F 4R79A 2WWYA 2KKOA 3ERMA 3GFMA 2JUGA 3L2NA 4NGMA 1NSLA 4PSWA 4Y15A 5HS7A 2AFUA 1R0RI 2I5UA 2JEVA 3D5SC 4ESBA 3BQYA 5EX3A 4UEFA 3K9TA 3BCBA 1SMYF 3LA7A 2JVGA 2SGQI 2JA1A 3PQJA 5EEAA 4EJTA 5DS9A 2VBZA 5BPDA 4HNYB 4CH7A 1FPQA 5H6QA 5BNGA 2R93J 4JLYA 3OYAA 2QMLA 4AB7A 4ENMA 1GHCA 2JEWA 4NC8A 3WG9A 2HZDA 5E1XA 1JGSA 2VQGA 1U3EM 2Z3PA 1BOAA 4LB6B 3RTRA 4RBOA 3BPXA 3HH2C 2CF4A 2R7DA 2EJRA 3GZ6A 3BLYA 3WGGA 1HSTA 1ONVA 3GFLA 1WHUA 2BY1A 2MFZA 2Y9ZA 2NVQJ 4E7KA 2COBA 3BDDA 4U0VA 2DA4A 3R0AA 1XEBA 2Z3YA 3GTJJ 1J09A 2EVNA 3P2HA 4UUVA 4H6UA 3EC4A 3LSKA 3OYJA 1P9QC 5TRDA 2I3CA 5EF6A 5E3LA 2G9WA 1B6BA 4GDFA 5E1WA 3OL0A 1ZG3A 1MBEA 2EFNA 3MQ0A 3FMRA 2OCCH 2NNNA 3FXKA 2QA4I 2XAFA 3H9GA 1RUNA 1SGNI 2D1HA 2ZNZA 2DOAA 2CQXA 1BW5A 3OYEA 3VSKA 3MKZA 2DMQA 3SXOA 1VKCA 4H0EA 5A2QZ 2XGXA 5DCMA 1XJOA 3W6XA 2DK5A 3OVOA 3HRUA 5IPAA 4P5OA 1HEVA 1BI1A 2FNAA 2OTJI 2LVSA 3IWGA 3RKQA 3F0CA 4HSTA 2CS3A 2JWTA 1TC3C 1Z67A 3H1CA 3C3WA 1Q2DA 1O3TA 1IDYA 1WCMJ 4KIBA 2KJBA 3AG1H 1B9MA 1D5YA 4OP4A 1BR4A 4U5YA 4XM3A 3V8IA 4KIGA 3HLPA 5LGNA 1BI3A 4S05A 3CCJI 3EY5A 3I55I 4HNWB 4RN7A 2H8RA 5E3OA 2VONA 3HC7A 3S9LA 2M7AA 3AFHA 3LFUA 4XN0A 4EQQA 2QQAA 1QZYA 2JW6A 1CPSA 5A27A 3A02A 1PP8F 3KHXA 4NCZA 1E2XA 1N13A 3BTCA 3SZTA 2V9KA 1ULMA 4EFDA 4KUMA 4UV9A 3BHXA 2E73A 1WPKA 4YGOA 4OMZA 2QIRA 4BD9A 1L0OC 3RJPA 4IHXA 2NU2I 5AG6A 3K70C 3DTKA 1MNDA 3MKYB 2OH1A 2QWWA 1BI2A 1WJ5A 2FMLA 3P9IA 2QPOA 2PIYA 1YTPA 3W6KB 4P4FA 4DUKA 2K4BA 1R79A 2EIMH 4NGQA 3VATA 2JJ7A 1FP1D 2FRHA 1AMPA 5F6FA 1X19A 2K7LA 1Z4EA 1RKTA 3S2WA 2GLFA 1CPXA 1QSOA 1U0JA 1VQ6I 4WWCA 2IAIA 4M6YA 2AFMA 3MZ8A 2HYGD 1RESA 2P6EA 1PUEE 2PJ1A 3VE5A 4AXVA 5HVHA 2FEZA 3K4LA 2HGCA 2KRFA 1OFCX 3OOPA 3G6EI 2QVPA 1IN6A 1T0FA 2KIFA 4Q47A 3T5XA 4DW6A 1DTDA 4KSAA 3RAMA 4JP0A 2XGCA 3PO2J 2Y0MA 4LOCA 3NWTA 4ZYHA 3GBGA 2W00A 2YNEA 2DA7A 3A4CA 5C4XJ 3PUBA 4F0YA 1J7KA 4UWJA 3SJXA 1BLLE 4F55A 1JT6A 2DN0A 1TKJA 1IUFA 1OCZH 5B5EC 2HPMA 3CCMI 2KMUA 3BROA 2QQEA 2M1BA 4B5OA 2MA3A 4BJ5C 4BQNA 1RR8C 4HX8A 5A2QK 2KDZA 2B8TA 1LRZA 2F7VA 1UHAA 2HOEA 1VGYA 3L9FA 1MT1A 3L09A 3IEHA 2CY2A 4XLEA 3BI1A 2Z3NA 3F22A 4AUXA 2JA5J 1FP2A 3DEEA 3PBBA 4L89A 3QAHA 2DA3A 4JBAA 2HDDA 4YFJA 1MK4A 1ZO0A 4GCVA 2ACJA 1UFHA 5F09A 2VBQA 2ERWA 1AUGA 1QZEA 2ANPA 4XNHB 2FJ1A 3IAM2 5DS0A 5CCMA 2A5WA 3H35A 2L54A 1IB1E 3U2RA 3VPRA 1WWXA 4A30A 4P1WA 3W6JB 3B4VC 1B87A 4OWRB 4P9FA 4BJ6C 1DU6A 4BBSJ 4QPQA 5IOYA 2X3TA 3U21A 2ZNYA 4XMYA 5CVRA 2VL8A 2WBMA 4HGUA 3EO4A 4CGMA 1B4AA 1R36A 1ZN2A 2V26A 3KX2A 3MEKA 1YW8A 1TT5B 2JA8J 3RKWA 2F3CI 5KAIC 3ML6A 2HOTA 2JSPA 1IW4A 2BEOA 3NWSA 2DB6A 1Z8XA 4X6AJ 4F92B 5HVFA 3HEFA 3IH4A 2ZJRF 3BJAA 3BG5A 3G1OA 3IL2A 3GTKJ 2OD5A 1YQAA 2Q1ZB 3BJ8A 4NFRA 5C88A 4BL0B 4OAEA 4L5JA 3WTWC 2Q04A 4BQOA 3OWTA 3M8EA 2AO9A 1USSA 2PJRB 1U78A 1OMTA 1I6HJ 1FARA 4E7SA 4E7JA 5TISC 1MNMC 2BOLA 4Y17A 3CP2A 3K4MA 2G3AA 2EK8A 2ZW6A 1W4RA 2ZJQF 1IN8A 1MSEC 4P44A 1ZGWA 3EPZA 2X4HA 3BJ6A 2LKPA 4IRHA 4S04A 1B8IA 2V1NA 1K6YA 3PSFA 4Y4RA 2WGCA 2V9VA 1G6NA 1M1DA 5DAEA 4H89A 3CZ6A 2HOSA 2XAGA 3CMAI 4EMEA 3S1RJ 2DA2A 1K6OA 5ED4A 4KN4X 4UNOA 2MLKA 2RQQA 4OMYA 2K9SA 2WAQA 1TIQA 1NTCA 4HF0A 2RNGA 1MD0A 3LOCA 3IC1A 5K5OA 2HVSA 2FMYA 4LLNA 1WI3A 3DPUA 1K4JA 4OIRF 3SEKC 1TBNA
chains in the Genus database with same CATH topology
2Q4YA 2P6SA 5AIQA 1VTNC 1EH8A 1ZGJA 4KNYA 1K78A 2Z3KA 1YLEA 3DR6A 1OYWA 1W4MA 4LMYA 3V7CA 4MJ8A 4C2XA 4HYEA 1O3RA 4A5NA 4I09A 3VB2A 3CXQA 3HSEA 1J4JA 1OPCA 2I00A 2UXNA 2Z11A 5LGTA 2ZBKA 2L4AA 3TCVA 4MFJA 2JLMA 3CLOA 3IU1A 4MEXF 5I0CA 3DFGA 2P4WA 2Z33A 2XRNA 2DT5A 3ECOA 2ZW7A 3GLXA 4P96A 5AONA 3TDZC 1V0CA 4BYYA 3M1EA 4A0XA 3QP6A 4M74A 5K5QA 2D4PA 4FD5A 2RGVA 4CRZB 3HIFA 3F8CA 3R6SA 5AG5A 4AD9A 4UCMA 3D8PA 5IT9K 4L9JA 2YR2A 5FB2A 5AG4A 4LLLA 4QUSA 4QBJA 4BHBA 3JUWA 5IT9Z 4KN7X 3QRFF 3WU0A 3IWEA 1EH6A 1FSHA 2P5VA 3TO9A 2H6BA 4MQ9F 3G8WA 1RNLA 4TV7A 4LFUA 1TW3A 2EV5A 4H6ZA 4ONUA 1GXPA 3DQVC 2STTA 2B3VA 1KQ9A 1F4KA 2DPUA 4EJUA 3J81K 4XLPF 4YFNF 1BC8C 1STZA 1BJAA 4RI1A 2RN7A 3WTYC 1S7LA 4MTEA 4O5VA 1OKRA 2MD5A 2XKPA 1XDSA 3R1KA 1TQIA 1UHWA 3CDHA 2A3SA 4QWQA 4RS8A 3GYHX 1D8JA 2Z0ZA 2BV6A 2HQYA 3TDUC 2XKOA 2OBPA 4KLVA 1XN7A 5DWMA 3LA3A 5CVUA 3RPUA 3F6VA 5J8FA 2EK5A 5JPHA 1SMTA 4Y49C 4YFKF 2MH2A 3RI4A 3GKRA 4KT5C 3KP2A 1IYKA 2JSCA 2D4OA 4HX7A 5D5WB 4QB9A 1F5TA 2UXXA 3W91A 3DEUA 3FM3A 4HW0A 2EB7A 1YS7A 5FO5A 4LK0F 4ZH4F 1XSDA 1IN7A 3LA2A 2Z3OA 1QPMA 2W84A 4RAZA 1BI0A 2JPCA 2JPBA 2YPRA 1Q2CA 1FYKA 2VBWA 1U6GA 4UV8A 1REPC 4AG7A 1XGSA 2PEXA 4Q36A 3DR8A 1IYLA 3Q9VA 1HW2A 3LSTA 1BIAA 3NE7A 2Y48A 3BP8A 3QP5A 2E1CA 3UY5A 3KZZA 3CO6C 1I21A 2O61A 2L3DA 2DBBA 2ZMEA 3H3UA 3K2ZA 3RKYA 1QZZA 1T6SA 2ETHA 4A2UA 3G73A 3ZMTA 1O3QA 1RIOH 1KYWA 2HKOA 1XGNA 3TOBA