1M8CA

Solution structure of the t state of turkey ovomucoid at ph 2.5
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
LAAVSVDCSEYPKDACTLEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ovomucoid
publication title Two conformational states of Turkey ovomucoid third domain at low pH: three-dimensional structures, internal dynamics, and interconversion kinetics and thermodynamics.
pubmed doi rcsb
molecule tags Hydrolase inhibitor
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2002-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1m8cA00
1CT2I 1SGYI 2M5XA 2QQDA 2JYYA 1SGQI 1UVGA 1MT1A 1CGJI 1NUBA 1M8CA 1LR8A 1IY6A 2B0UC 1HDLA 1PJUA 1Y1BA 1FYBA 1OVOA 1PPFI 2N71A 1DS2I 1SGNI 1H0ZA 1LR9A 1UUCA 2KCXA 2SGQI 1TURA 1HJAI 1TGSI 1SGDI 1N13A 2P6AC 2KMPA 1M8BA 1TIHA 2QQCA 1Z7KB 2GKVA 3OVOA 5JHWC 1SGRI 2OVOA 1CHOI 1IY5A 2N52A 2GKTI 1BUSA 1CGII 1OMTA 1YTPA 2SGEI 1UVFA 1OMUA 2F3CI 3B4VC 1KMAA 3SEKC 1CSOI 2NU0I 1DS3I 1R0RI 2GKRI 1TBRR 1SGEI 3QTLD 2WCYA 2ARPF 2NU3I 1BMOA 2KMQA 1CT0I 1HPTA 2JZMA 2ERWA 1TBQR 3TJQA 4OVOA 1CT4I 1SGPI 2NU4I 2SGDI 1AN1I 2KMRA 2N17A 2LEOA 2NU2I 1LR7A 2NU1I 1OYVI 1PCEA 4GI3C 1YU6C 3SGQI 3SGBI 5DAEA 2BUSA 1TUSA 1CE3A 4HGUA 4SGBI 2SGPI 2V53A 2SGFI 2JXDA 1Y1CA 2KMOA 2XRCA 1IW4A 3HH2C
chains in the Genus database with same CATH superfamily
1CT2I 1SGYI 1Y8FA 2B8TA 2CWHA 2M5XA 2QQDA 3D00A 2JYYA 1TBOA 4FKDA 1SGQI 1UVGA 1MT1A 2Y0MA 1K7VA 4AMLA 1CGJI 5FUWA 1FY7A 1NUBA 1M8CA 1LR8A 1K7TA 1RFHA 2B0UC 1IY6A 1HDLA 5EX3A 1PJUA 1X4SA 3UGIA 4L9MA 1Y1BA 1P9GA 1FYBA 2QPOA 1OVOA 1PPFI 2N71A 1DS2I 3UGLA 1V1HA 3FSYA 3OXLA 2YQPA 1SGNI 2OU2A 3R5DA 3R5CA 1KBEA 1LR9A 1UUCA 2KCXA 2E73A 7WGAA 1H0ZA 1MJ9A 3PDNA 1K7UA 2SGQI 2L8EA 3TO9A 4B6DA 5J8CA 2UVOA 1TURA 1HJAI 1TBNA 1TGSI 2WGCA 3RU0A 2CWFA 4DNCA 1SGDI 1XX6A 5FUYA 1N13A 2LUYA 2P6AC 1P9ZA 1R79A 2KMPA 1M8BA 1TIHA 2QQCA 3QWPA 1Z7KB 2DB6A 2GKVA 3FSXA 3OVOA 1Q9BA 4UXHA 3UEJA 1SGRI 2OVOA 1CHOI 5JHWC 2V1CA 3OL0A 1IY5A 2E5RA 2N52A 2ELIA 1W3SA 2GKTI 1BUSA 1CGII 1MJBA 1OMTA 2GIVA 5FUVA 3UEYA 3E2IA 1YTPA 3TO7A 2SGEI 2DIPA 1W4RA 2DKVA 1PTQA 2LB7A 2RC4A 2GVIA 1UVFA 3E59A 1OMUA 2F3CI 3CXLA 1FARA 3TOBA 5J8FA 1S20A 3B4VC 5FUXA 1XBTA 1KMAA 3SEKC 1CSOI 2CJSC 2JW6A 3UFFA 9WGAA 5CCLA 2NU0I 3GOXA 3OXGA 2V1CC 4MPIA 5E3RA 3VDPA 1DS3I 2J9RA 3MEKA 3TO6A 1R0RI 1WGTA 1U5KA 3R5BA 5HQ8A 5HI7A 2GKRI 2VRWB 1TBRR 1SGEI 3QAHA 3UGDA 2RIJA 2WCYA 3QTLD 4E1PA 2ARPF 1PTRA 1VDDA 2JA1A 2NU3I 4UXJA 1BMOA 3R5AA 1NXUA 2KMQA 1CT0I 1HPTA 1WTJA 2JZMA 5EX0A 2ENNA 3VDUA 2OZUA 2ERWA 1TBQR 3TJQA 2QQ0A 3OXFA 4OVOA 1WGCA 3UOEA 1CT4I 1SGPI 4JCVE 2PQ8A 1XA6A 2UZ3A 1ULMA 2N1AB 2ORWA 3FC3A 1V1IA 3BJIA 2NU4I 1HEVA 1ULNA 1AN1I 2KMRA 2SGDI 1X74A 5E3QA 2N17A 3TOAA 2LEOA 3VE5A 2NU2I 4E1RA 1FAQA 1LR7A 1PCEA 1OYVI 2L7XA 1UHAA 1MJAA 2NU1I 2ODDA 2OD1A 2W0TA 1YU6C 2YUUA 4GI3C 3SGQI 3SGBI 2FNFX 2X52A 4A24A 5DAEA 1Z2IA 2BUSA 1TUSA 2ORVA 1WKXA 2QQEA 4HGUA 4SGBI 1CE3A 5E3PA 2X3TA 2SGPI 4UXIA 2V53A 1KBFA 2K9HA 5CCMA 2SGFI 2CWGA 2A20A 2JXDA 1Y1CA 2KMOA 2XRCA 4WP4A 1IW4A 1TOTA 1ULKA 2ROWA 2WVJA 2J87A 3HH2C 3KY9A 2ENZA
chains in the Genus database with same CATH topology
1CT2I 1SGYI 1Y8FA 2B8TA 2M5XA 2QQDA 3D00A 2JYYA 1TBOA 4FKDA 1SGQI 1UVGA 1MT1A 1CGJI 5FUWA 1NUBA 1M8CA 1LR8A 1IY6A 1RFHA 2B0UC 1HDLA 5EX3A 1PJUA 1X4SA 3UGIA 4L9MA 1Y1BA 1FYBA 2QPOA 1OVOA 1PPFI 2N71A 1DS2I 3UGLA 1V1HA 3OXLA 2YQPA 1SGNI 1H0ZA 1KBEA 1LR9A 1UUCA 2KCXA 2E73A 3PDNA 2SGQI 2L8EA 1TURA 1HJAI 1TBNA 1TGSI 3RU0A 1SGDI 1XX6A 5FUYA 1N13A 2LUYA 2P6AC 1R79A 2KMPA 1M8BA 1TIHA 2QQCA 3QWPA 1Z7KB 2DB6A 2GKVA 3OVOA 4UXHA 5JHWC 3UEJA 1SGRI 2OVOA 1CHOI 2V1CA 3OL0A 1IY5A 2E5RA 2N52A 2ELIA 1W3SA 2GKTI 1BUSA 1CGII 1OMTA 5FUVA 3UEYA 3E2IA 1YTPA 2SGEI 2DIPA 1W4RA 1PTQA 2GVIA 1UVFA 3E59A 1OMUA 2F3CI 3CXLA 1FARA 3B4VC 5FUXA 1XBTA 1KMAA 3SEKC 1CSOI 2CJSC 2JW6A 3UFFA 5CCLA 3GOXA 2NU0I 3OXGA 2V1CC 3VDPA 1DS3I 2J9RA 3MEKA 1R0RI 1U5KA 5HQ8A 5HI7A 2GKRI 2VRWB 1TBRR 1SGEI 4E1PA 3UGDA 3QTLD 2WCYA 2ARPF 1PTRA 1VDDA 2JA1A 2NU3I 4UXJA 1BMOA 2KMQA 1CT0I 1HPTA 2JZMA 5EX0A 3VDUA 2ENNA 2ERWA 1TBQR 3TJQA 2QQ0A 3OXFA 4OVOA 1CT4I 1SGPI 4JCVE 1XA6A 2UZ3A 2ORWA 2N1AB 3FC3A 1V1IA 3BJIA 2NU4I 2SGDI 1AN1I 2KMRA 1X74A 2N17A 2LEOA 3VE5A 2NU2I 4E1RA 1FAQA 1LR7A 1PCEA 1OYVI 2L7XA 2NU1I 2W0TA 2ODDA 2OD1A 2YUUA 4GI3C 1YU6C 4B6DA 3SGQI 3SGBI 2FNFX 4A24A 5DAEA 2BUSA 1TUSA 2ORVA 2QQEA 1CE3A 4HGUA 4SGBI 2SGPI 4UXIA 2V53A 1KBFA 2K9HA 5CCMA 2SGFI 2A20A 2JXDA 1Y1CA 2KMOA 2XRCA 1IW4A 1TOTA 2ROWA 2WVJA 2J87A 3HH2C 3KY9A 2ENZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CT2 I;  1SGY I;  2M5X A;  2QQD A;  2JYY A;  1SGQ I;  1UVG A;  1MT1 A;  1CGJ I;  1NUB A;  1M8C A;  1LR8 A;  1IY6 A;  2B0U C;  1HDL A;  1PJU A;  1Y1B A;  1FYB A;  1OVO A;  1PPF I;  2N71 A;  1DS2 I;  1SGN I;  1H0Z A;  1LR9 A;  1UUC A;  2KCX A;  2SGQ I;  1TUR A;  1HJA I;  1TGS I;  1SGD I;  1N13 A;  2P6A C;  2KMP A;  1M8B A;  1TIH A;  2QQC A;  1Z7K B;  2GKV A;  3OVO A;  5JHW C;  1SGR I;  2OVO A;  1CHO I;  1IY5 A;  2N52 A;  2GKT I;  1BUS A;  1CGI I;  1OMT A;  1YTP A;  2SGE I;  1UVF A;  1OMU A;  2F3C I;  3B4V C;  1KMA A;  3SEK C;  1CSO I;  2NU0 I;  1DS3 I;  1R0R I;  2GKR I;  1TBR R;  1SGE I;  3QTL D;  2WCY A;  2ARP F;  2NU3 I;  1BMO A;  2KMQ A;  1CT0 I;  1HPT A;  2JZM A;  2ERW A;  1TBQ R;  3TJQ A;  4OVO A;  1CT4 I;  1SGP I;  2NU4 I;  2SGD I;  1AN1 I;  2KMR A;  2N17 A;  2LEO A;  2NU2 I;  1LR7 A;  2NU1 I;  1OYV I;  1PCE A;  4GI3 C;  1YU6 C;  3SGQ I;  3SGB I;  5DAE A;  2BUS A;  1TUS A;  1CE3 A;  4HGU A;  4SGB I;  2SGP I;  2V53 A;  2SGF I;  2JXD A;  1Y1C A;  2KMO A;  2XRC A;  1IW4 A;  3HH2 C; 
#chains in the Genus database with same CATH topology
 1CT2 I;  1SGY I;  1Y8F A;  2B8T A;  2CWH A;  2M5X A;  2QQD A;  3D00 A;  2JYY A;  1TBO A;  4FKD A;  1SGQ I;  1UVG A;  1MT1 A;  2Y0M A;  1K7V A;  4AML A;  1CGJ I;  5FUW A;  1FY7 A;  1NUB A;  1M8C A;  1LR8 A;  1K7T A;  1RFH A;  2B0U C;  1IY6 A;  1HDL A;  5EX3 A;  1PJU A;  1X4S A;  3UGI A;  4L9M A;  1Y1B A;  1P9G A;  1FYB A;  2QPO A;  1OVO A;  1PPF I;  2N71 A;  1DS2 I;  3UGL A;  1V1H A;  3FSY A;  3OXL A;  2YQP A;  1SGN I;  2OU2 A;  3R5D A;  3R5C A;  1KBE A;  1LR9 A;  1UUC A;  2KCX A;  2E73 A;  7WGA A;  1H0Z A;  1MJ9 A;  3PDN A;  1K7U A;  2SGQ I;  2L8E A;  3TO9 A;  4B6D A;  5J8C A;  2UVO A;  1TUR A;  1HJA I;  1TBN A;  1TGS I;  2WGC A;  3RU0 A;  2CWF A;  4DNC A;  1SGD I;  1XX6 A;  5FUY A;  1N13 A;  2LUY A;  2P6A C;  1P9Z A;  1R79 A;  2KMP A;  1M8B A;  1TIH A;  2QQC A;  3QWP A;  1Z7K B;  2DB6 A;  2GKV A;  3FSX A;  3OVO A;  1Q9B A;  4UXH A;  3UEJ A;  1SGR I;  2OVO A;  1CHO I;  5JHW C;  2V1C A;  3OL0 A;  1IY5 A;  2E5R A;  2N52 A;  2ELI A;  1W3S A;  2GKT I;  1BUS A;  1CGI I;  1MJB A;  1OMT A;  2GIV A;  5FUV A;  3UEY A;  3E2I A;  1YTP A;  3TO7 A;  2SGE I;  2DIP A;  1W4R A;  2DKV A;  1PTQ A;  2LB7 A;  2RC4 A;  2GVI A;  1UVF A;  3E59 A;  1OMU A;  2F3C I;  3CXL A;  1FAR A;  3TOB A;  5J8F A;  1S20 A;  3B4V C;  5FUX A;  1XBT A;  1KMA A;  3SEK C;  1CSO I;  2CJS C;  2JW6 A;  3UFF A;  9WGA A;  5CCL A;  2NU0 I;  3GOX A;  3OXG A;  2V1C C;  4MPI A;  5E3R A;  3VDP A;  1DS3 I;  2J9R A;  3MEK A;  3TO6 A;  1R0R I;  1WGT A;  1U5K A;  3R5B A;  5HQ8 A;  5HI7 A;  2GKR I;  2VRW B;  1TBR R;  1SGE I;  3QAH A;  3UGD A;  2RIJ A;  2WCY A;  3QTL D;  4E1P A;  2ARP F;  1PTR A;  1VDD A;  2JA1 A;  2NU3 I;  4UXJ A;  1BMO A;  3R5A A;  1NXU A;  2KMQ A;  1CT0 I;  1HPT A;  1WTJ A;  2JZM A;  5EX0 A;  2ENN A;  3VDU A;  2OZU A;  2ERW A;  1TBQ R;  3TJQ A;  2QQ0 A;  3OXF A;  4OVO A;  1WGC A;  3UOE A;  1CT4 I;  1SGP I;  4JCV E;  2PQ8 A;  1XA6 A;  2UZ3 A;  1ULM A;  2N1A B;  2ORW A;  3FC3 A;  1V1I A;  3BJI A;  2NU4 I;  1HEV A;  1ULN A;  1AN1 I;  2KMR A;  2SGD I;  1X74 A;  5E3Q A;  2N17 A;  3TOA A;  2LEO A;  3VE5 A;  2NU2 I;  4E1R A;  1FAQ A;  1LR7 A;  1PCE A;  1OYV I;  2L7X A;  1UHA A;  1MJA A;  2NU1 I;  2ODD A;  2OD1 A;  2W0T A;  1YU6 C;  2YUU A;  4GI3 C;  3SGQ I;  3SGB I;  2FNF X;  2X52 A;  4A24 A;  5DAE A;  1Z2I A;  2BUS A;  1TUS A;  2ORV A;  1WKX A;  2QQE A;  4HGU A;  4SGB I;  1CE3 A;  5E3P A;  2X3T A;  2SGP I;  4UXI A;  2V53 A;  1KBF A;  2K9H A;  5CCM A;  2SGF I;  2CWG A;  2A20 A;  2JXD A;  1Y1C A;  2KMO A;  2XRC A;  4WP4 A;  1IW4 A;  1TOT A;  1ULK A;  2ROW A;  2WVJ A;  2J87 A;  3HH2 C;  3KY9 A;  2ENZ A; 
#chains in the Genus database with same CATH homology
 1CT2 I;  1SGY I;  1Y8F A;  2B8T A;  2M5X A;  2QQD A;  3D00 A;  2JYY A;  1TBO A;  4FKD A;  1SGQ I;  1UVG A;  1MT1 A;  1CGJ I;  5FUW A;  1NUB A;  1M8C A;  1LR8 A;  1IY6 A;  1RFH A;  2B0U C;  1HDL A;  5EX3 A;  1PJU A;  1X4S A;  3UGI A;  4L9M A;  1Y1B A;  1FYB A;  2QPO A;  1OVO A;  1PPF I;  2N71 A;  1DS2 I;  3UGL A;  1V1H A;  3OXL A;  2YQP A;  1SGN I;  1H0Z A;  1KBE A;  1LR9 A;  1UUC A;  2KCX A;  2E73 A;  3PDN A;  2SGQ I;  2L8E A;  1TUR A;  1HJA I;  1TBN A;  1TGS I;  3RU0 A;  1SGD I;  1XX6 A;  5FUY A;  1N13 A;  2LUY A;  2P6A C;  1R79 A;  2KMP A;  1M8B A;  1TIH A;  2QQC A;  3QWP A;  1Z7K B;  2DB6 A;  2GKV A;  3OVO A;  4UXH A;  5JHW C;  3UEJ A;  1SGR I;  2OVO A;  1CHO I;  2V1C A;  3OL0 A;  1IY5 A;  2E5R A;  2N52 A;  2ELI A;  1W3S A;  2GKT I;  1BUS A;  1CGI I;  1OMT A;  5FUV A;  3UEY A;  3E2I A;  1YTP A;  2SGE I;  2DIP A;  1W4R A;  1PTQ A;  2GVI A;  1UVF A;  3E59 A;  1OMU A;  2F3C I;  3CXL A;  1FAR A;  3B4V C;  5FUX A;  1XBT A;  1KMA A;  3SEK C;  1CSO I;  2CJS C;  2JW6 A;  3UFF A;  5CCL A;  3GOX A;  2NU0 I;  3OXG A;  2V1C C;  3VDP A;  1DS3 I;  2J9R A;  3MEK A;  1R0R I;  1U5K A;  5HQ8 A;  5HI7 A;  2GKR I;  2VRW B;  1TBR R;  1SGE I;  4E1P A;  3UGD A;  3QTL D;  2WCY A;  2ARP F;  1PTR A;  1VDD A;  2JA1 A;  2NU3 I;  4UXJ A;  1BMO A;  2KMQ A;  1CT0 I;  1HPT A;  2JZM A;  5EX0 A;  3VDU A;  2ENN A;  2ERW A;  1TBQ R;  3TJQ A;  2QQ0 A;  3OXF A;  4OVO A;  1CT4 I;  1SGP I;  4JCV E;  1XA6 A;  2UZ3 A;  2ORW A;  2N1A B;  3FC3 A;  1V1I A;  3BJI A;  2NU4 I;  2SGD I;  1AN1 I;  2KMR A;  1X74 A;  2N17 A;  2LEO A;  3VE5 A;  2NU2 I;  4E1R A;  1FAQ A;  1LR7 A;  1PCE A;  1OYV I;  2L7X A;  2NU1 I;  2W0T A;  2ODD A;  2OD1 A;  2YUU A;  4GI3 C;  1YU6 C;  4B6D A;  3SGQ I;  3SGB I;  2FNF X;  4A24 A;  5DAE A;  2BUS A;  1TUS A;  2ORV A;  2QQE A;  1CE3 A;  4HGU A;  4SGB I;  2SGP I;  4UXI A;  2V53 A;  1KBF A;  2K9H A;  5CCM A;  2SGF I;  2A20 A;  2JXD A;  1Y1C A;  2KMO A;  2XRC A;  1IW4 A;  1TOT A;  2ROW A;  2WVJ A;  2J87 A;  3HH2 C;  3KY9 A;  2ENZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...