3D00A

Crystal structure of a tungsten formylmethanofuran dehydrogenase subunit e (fmde)-like protein (syn_00638) from syntrophus aciditrophicus at 1.90 a resolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
190
structure length
184
Chain Sequence
b'MTARNILSYSYEEYVEKITAFHGYPAPGVLIGGFMVDLAVKNLPEGILYDAICETRTCLPDAVQLLTPCTFGNGWLTVLPMGLFAVSLYDKFTGEGVRVFLDVEKMGPWQEIRNWFLKLKSERLFKEIREAGPDILELRNVKLKPGFLEKKHKGKIVLCPQCREAYPAQDGELCLSCQGGSPYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tungsten formylmethanofuran dehydrogenase subunit E
publication title Structures of three members of Pfam PF02663 (FmdE) implicated in microbial methanogenesis reveal a conserved alpha+beta core domain and an auxiliary C-terminal treble-clef zinc finger.
pubmed doi rcsb
source organism Syntrophus aciditrophicus
molecule tags Metal binding protein
total genus 46
structure length 184
sequence length 190
ec nomenclature
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02663 FmdE FmdE, Molybdenum formylmethanofuran dehydrogenase operon
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.80 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3d00A02
3.30.1330.130 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3d00A01
2V1CA 3VDPA 3VDUA 1VDDA 2GLZA 3D00A 3VE5A
chains in the Genus database with same CATH superfamily
4X1IB 3DDNA 3RYCB 2KCXA 2P6AC 5G4VC 1BUSA 1HJAI 5ITZB 2KTUA 1CT0I 3N2GA 4F6RB 1X7PA 4G88A 3GHZA 4O2BA 3JAKB 5KMGB 1J7HA 2VAMA 5LA6A 1VH8A 3HKDA 2HP0B 3UOEA 3HWUA 3TD4A 3CG6A 3IMPA 1DS2I 3K14A 3B4VC 5CA1A 5J2TB 3FBAA 5IJ9A 3KE1A 1TVKB 3JALA 4UXIA 2LB7A 1GZ0A 4WP4A 1ULKA 1OYVI 3KY9A 3RYIA 1Y1CA 3Q8HA 3RYCA 3CD6F 3C9RA 4C4WC 5JHWC 1PCEA 2N71A 1WGCA 5EB0A 1SGQI 3UEYA 2R751 5KMGA 1VQPF 3NMUC 2Y0MA 5E3QA 5LP6A 4TUYB 2RHOA 2LBWA 1QAHA 4AMLA 1SGNI 5AVMA 5J2TA 4BT6A 2QQDA 3DC2A 4ZHVA 2B0UC 4ERHA 1PJUA 3VYTC 2GVIA 2W8BC 1IV3A 2ROWA 5EZYB 3S0HA 1Q8RA 3IKFA 3CC7F 1E7KA 4RQOA 4YJ3B 4TUYA 2CWHA 2UYNB 3CCLF 3SIVA 4GI3C 5MN5A 1W2BF 2SGFI 1TURA 1JFFB 2AMTA 4O4LB 2YUUA 1W3EX 2H8CA 2EWCA 4X1KA 1N13A 1KNKA 4TV9A 1FYBA 1GO1A 1NQ3A 3C9UA 2ENNA 4YJ2A 1W5EA 5J2UA 3OBWA 3E1YA 3K12A 2RIJA 2KMRA 4I55B 2QQCA 3R5AA 4O4JB 2Q1YA 1FAQA 2IAFA 2UYNA 2PQ8A 1CT2I 1U5KA 3R0PA 4EI8A 5HY4A 3R5DA 1JFFA 2HS3A 4NWOB 1IV4A 4O4LA 4NQ3A 3OXGA 3ZOPA 1TBOA 4WBNB 4OVOA 4DNCA 1YGYA 5IJ0A 4BVSA 1Q9BA 5IYZA 2CZWA 4X1YA 1ULMA 3FSYA 5CA0A 2KGWA 2JW6A 3RA6A 2KMPA 1H47A 3ZP7A 4O4HA 3BJIA 3V7EA 4E1PA 1PPFI 2GLZA 4FFBA 4I55A 4O4JA 3UGLA 1W581 3EORA 3WJQA 3CCSF 2B33A 1FSZA 2CWFA 2QQEA 2W0TA 3IEWA 1KD1H 3CPQA 2GKTI 5EYPB 3HKBB 5HXUA 1KQSF 2V9YA 3M4SA 5HWEA 4WBNA 1H48A 1ODEA 1Z5VA 1BMOA 2OTMA 2I6RA 3N4YA 3SGBI 1YU6C 2RB9A 3I55F 3LMEA 3M84A 3TO9A 1KNJA 4HNAA 5MN4A 1PTQA 1YJ9F 2JXDA 5LOVA 1SGPI 1NUBA 5FUVA 2HX0A 3UT5B 3JAWB 1KMAA 1Z7KB 3OVOA 3VO8A 3B6NA 3OBYA 3NK7A 3J80M 2CHTA 1NMUB 3HKBA 2LBTA 3VYSC 2HS0A 3LWPC 2CWGA 4E1RA 1OMTA 1H0ZA 3FPIA 5LA6B 1K7UA 2K9HA 3ESJA 3CCQF 3HKDB 1FY7A 4B6DA 1IY6A 1R1MA 3S0WA 5HY2A 5CA1B 3MCAB 4ZK7A 3LWQC 3UT5A 5HI7A 3RE3A 2VXYA 3JALB 3F0FA 3N2KA 4LNUA 3OW2F 1Y1BA 3RYIB 1W5FA 3FSXA 1GX1A 2VGNA 2AIFA 5EO3A 5JH7B 3M1XA 1FFXA 4JCVE 1TBNA 3JATA 3CC2F 3J7AR 1AN1I 4FKDA 1OAPA 5HP7A 1YHQF 1XBTA 2AIZP 5LP6B 3L7QA 2ARPF 5HY1A 3FD6A 2E73A 2ALEA 3LFOA 3FD5A 1W5BA 2I6DA 1VQ8F 4EI9A 1XA6A 2HS4A 4C8GA 3G6EF 5C8YB 2Z1EA 3WGMA 5DCVA 4BVRA 4O2AB 1LR9A 1MJ9A 1X25A 2OVOA 2R6R1 1KBEA 5JH7A 1X4SA 3CB2A 2YQPA 2KMQA 3E2IA 2ZODA 2ELIA 4B46A 1KBFA 2V1CA 5HXZA 2QPOA 2LCAA 1K8AH 1RLUA 4DXDA 2FNFX 3TOAA 1ZWZA 3LWVC 3GYQA 2BTQB 3CXLA 5HY0A 2Z01A 2CW4A 1M8BA 3V4DA 3CYPB 3HAXD 1SZQA 3E20B 4C81A 3RA5A 4I50A 5C8YA 1PTRA 1Y8FA 2ZAUA 2V1CC 3CCJF 1COMA 4XCQA 1NXUA 2PHNA 4X1KB 4U3JA 5LP6C 2DIPA 3QAHA 3SEKC 4TV9B 3JARB 2XRCA 4G4XA 4O2AA 5JCOA 5GIPC 4YJ2B 3ZP4A 3RU0A 5HQ8A 3PLAC 5B8FA 5J2UB 5FNVA 2UYKA 2OHWA 2CJSC 4EI7A 3CCUF 3QHDA 3C8LA 1UFYA 2UZHA 1W40A 1N8RH 3ZO8A 2N1AB 5CCLA 3MDOA 3VDUA 3VOBA 3CPWF 4KWEA 1TBQR 3JCMM 5IT9M 5IJ0B 3P10A 2OZUA 2X3TA 2HRYA 4BT3A 1Q7YH 3V3TA 1VDDA 5IYZB 3JARA 2DB6A 4X1YB 5CA0B 1W59A 2WCYA 2K1SA 3D54A 3VI6A 4IIJA 3WJPA 5GINC 1K7TA 2KTVA 4O4HB 3G4SF 2GZLA 4FFBB 2JA1A 2SGEI 3LWOC 1W5AA 2HP3A 3MCQA 3CMEF 2VAPA 2IQQA 4B5CA 1CN7A 2BTOA 4O4IA 3VCZA 1MJAA 3MBMA 1LR7A 3HTNA 3KHNA 3OL0A 3P0ZA 4UXHA 3HKEB 5FLXM 2Z1TA 3MQWA 5LYJA 4HNAB 1KC8H 1W55A 1W3SA 2QI2A 2HVYD 2Q1XA 3TOBA 3WGLA 3TJQA 5LOVB 2OTLF 3CCRF 1LR8A 4IHJA 3HKCB 3ON1A 3IKEA 3E22B 2SGQI 3SIUA 7WGAA 2GKRI 5EX3A 3K2XA 3VTIC 1JN1A 2ZOVA 4DRXB 1XV2A 2N17A 1CGII 2DYYA 5LXTA 1SA0A 1P9GA 3F6MA 1U40A 3HKEA 1K73H 4BY9D 5FUXA 1XRGA 3D01A 3S03A 3TD3A 1WKXA 2VGMA 1HDLA 3J81M 4BVQA 1TUBA 4ZHWA 1YJWF 4BT4A 1YJNF 3NVIB 1M1KH 1Q81H 5GONA 4A24A 1RFHA 3HKCA 3E22A 1UHAA 3N2KB 4LNUB 2A20A 4C82A 3O85A 1FNKA 4G4WA 1OMUA 3IEQA 4DRXA 1FFXB 2OTJF 3RYHB 3JATB 3PAFA 3WGNA 1IW4A 2QEXF 2RHLA 4X3LA 3R5CA 1CK2A 1CSOI 3CCVF 1VQ4F 1CHOI 5KX5A 3CXCF 3C9TA 4I4TB 3TO7A 1R0RI 2LBXA 1K9MH 2UYPA 2KMOA 3GOXA 1UI9A 1U3LA 1U3PA 2L7XA 1IV1A 1T0KB 2JZMA 1IPAA 2WVJA 1FNJA 1VQ6F 1TOTA 4X20B 3WPXA 1RQ7A 1VQ5F 2J9RA 5A2QM 1SGYI 4EB6A 3F0EA 2UVOA 1VHAA 5EAZA 3RYHA 1WGTA 5BMVA 1WTJA 5FJ4C 1R79A 5DAEA 1Z5WA 1H7MA 1JY8A 2N52A 1QU9A 2H6LA 1W57A 2N48A 3RYFA 5CCMA 3LYBA 1K7VA 4I4TA 4C8EA 1GO0A 1S72F 4I50B 3FFMA 4LCKA 3ELCA 3U0OA 3JVHA 3JASA 3R5BA 2QQ0A 4U3JB 2VAWA 4X20A 4RHAA 2ZVZA 3S06A 1Q86H 2SGPI 1VQNF 2OZBA 3HJWC 3FC3A 1P9ZA 2P6YA 3LWRC 2NU1I 2ORWA 4B45A 3S02A 2WGCA 5FNVB 1TUSA 2CVLA 5EWRA 1JJ2F 2NMUA 4ZHYB 2OD1A 2L8EA 2G9IA 2NU3I 1M90H 5JQGA 1YIJF 3VOAA 3TO6A 5CB4B 3BYQA 1QVGF 5HP8A 3WJRA 2LEOA 2F9ZC 1NJIH 1VK3A 2Z1FA 2FC3A 2HRUA 5EX0A 4X1IA 3V7QA 1SGEI 1X7OA 4IIJB 1YITF 1CLIA 2QA4F 3UEJA 3TD5A 5ITZA 2GIVA 3KJKA 4F6RA 4UXJA 3UGDA 3JAKA 4PWTA 1OFUA 4B62A 3F0DA 5JCOC 1M8CA 2HP0A 3QUWA 5CB4A 1YI2F 1T0AA 4O4IB 1CE3A 1Z2IA 3MEKA 4G4ZA 1TVKA 5GANK 3I3FA 1TIHA 2J87A 2JNBA 1VQKF 3SGQI 1UVGA 1UUCA 1W4RA 5LYJB 3F0GA 5MN6A 3WGJA 1PXWA 5G4UC 5J8CA 1V1HA 9WGAA 1DT9A 1UVFA 3IR9A 1DS3I 3UGIA 1SGRI 3WXMB 4IHJB 3AGKA 5EIBD 1HPTA 4R40B 3CCEF 3OXLA 1Q82H 4BT2A 1DBFA 1TGSI 3PDNA 3OONA 2ERWA 4SGBI 3VIUA 5LXTB 2M5XA 1SA0B 2UZ3A 2ZVYA 1VQ9F 2Z1UA 2QTPA 1VQ7F 1TBRR 3S0YA 2ENZA 1TUBB 2WALA 2ORVA 3ERNA 5EZYA 5GIOC 2NU4I 2DT4A 4M8IA 5JVDB 2YXZA 4YJ3A 3GTZA 2BO1A 5GONB 2F3CI 4L9MA 2GKVA 4G4YA 3QTLD 1W42A 2B8TA 4U39A 1MT1A 4BT5A 3NVKE 3VE5A 4G4VA 1FARA 3G71F 1RQ2A 1YTPA 4BT7A 5GAPK 2YYEA 3CC4F 2DKVA 2SGDI 5FUWA 1HEVA 2RHJA 4BVTA 1QVFF 5E3RA 4ZOLB 3C9SA 3P4EA 2CHSA 1XHOA 2CWJA 5KX5B 3KJJA 1SGDI 1JD1A 1RA4A 1W41A 1CT4I 2MQEA 5JVDA 1VQLF 2V53A 5J8FA 1CGJI 2FGYA 2RC4A 2IG8A 2VRWB 4C8IA 1S20A 1RLGA 1QD9A 4ZI7B 1XBIA 1OVOA 1IY5A 3UFFA 4EB6B 3VYUC 3WPWA 1VQVA 3T80A 5E3PA 5BMVB 1ONIA 4NUTA 5EIBC 4ZOLA 2NU2I 3KIZA 2CSLA 3NK6A 2ZF8A 1ULNA 3I7TA 5EB1B 1MJBA 3RYFB 2E5RA 2OU2A 1U43A 3WGKA 3JAMM 2NU0I 3OXFA 2ODDA 4MPIA 5FUYA 1VQMF 1X74A 2X52A 4ZHQB 3VDPA 3K0TA 3VMFB 2HQSC 3JASB 3QTYA 2JYYA 2RHHA 2BTUA 4TV8B 4ZI7A 1V1IA 2KG4A 3LDTA 5EYPA 4TZZA 3N4ZA 4E6EA 3CYQA 2BUSA 3N2GB 4O2BB 4X3MA 2H8EA 1SDSA 2UYJA 5JQGB 3QWPA 3HH2C 1XX6A 4BW0B 1X52A 4HGUA 3E59A 4ZHQA 1IV2A 2L26A 2LUYA 3I56F 1PF5A 2PMPA 3JAWA 1YQNA 5IJ9B 3CCMF 1VQOF 3CMAF 4TV8A 3D00A
chains in the Genus database with same CATH topology
2KCXA 2P6AC 5G4VC 1BUSA 1HJAI 2KTUA 1CT0I 1X7PA 3CG6A 1DS2I 3B4VC 4UXIA 1GZ0A 1OYVI 3KY9A 1Y1CA 3CD6F 4C4WC 5JHWC 1PCEA 2N71A 1SGQI 3UEYA 1VQPF 3NMUC 2LBWA 1SGNI 2QQDA 2B0UC 1PJUA 2GVIA 2ROWA 3CC7F 1E7KA 3CCLF 3SIVA 4GI3C 1W2BF 2SGFI 1TURA 2YUUA 1W3EX 1N13A 1FYBA 1GO1A 2ENNA 3OBWA 3E1YA 2KMRA 2QQCA 1FAQA 1CT2I 1U5KA 4EI8A 5HY4A 4NQ3A 3OXGA 1TBOA 4OVOA 4BVSA 2CZWA 2JW6A 3RA6A 2KMPA 3BJIA 3V7EA 4E1PA 1PPFI 2GLZA 3UGLA 3CCSF 2QQEA 2W0TA 1KD1H 3CPQA 2GKTI 5HXUA 1KQSF 5HWEA 1BMOA 3SGBI 1YU6C 3I55F 1PTQA 1YJ9F 2JXDA 1SGPI 1NUBA 5FUVA 1KMAA 1Z7KB 3OVOA 3OBYA 3NK7A 3J80M 1NMUB 3LWPC 4E1RA 1OMTA 1H0ZA 2K9HA 3CCQF 4B6DA 1IY6A 5HY2A 3MCAB 3LWQC 5HI7A 3OW2F 1Y1BA 5EO3A 2VGNA 2AIFA 4JCVE 1TBNA 3CC2F 3J7AR 1AN1I 4FKDA 1YHQF 1XBTA 2ARPF 5HY1A 2E73A 2ALEA 3LFOA 2I6DA 1VQ8F 4EI9A 1XA6A 3G6EF 5DCVA 4BVRA 1LR9A 2OVOA 1KBEA 1X4SA 2YQPA 2KMQA 3E2IA 2ELIA 1KBFA 2V1CA 5HXZA 2QPOA 1K8AH 2FNFX 1ZWZA 3LWVC 3GYQA 3CXLA 5HY0A 1M8BA 3HAXD 3E20B 3RA5A 1PTRA 1Y8FA 2V1CC 3CCJF 4XCQA 2DIPA 3SEKC 2XRCA 5GIPC 3RU0A 5HQ8A 3PLAC 2OHWA 2CJSC 4EI7A 3CCUF 1W40A 1N8RH 2N1AB 5CCLA 3VDUA 3CPWF 1TBQR 3JCMM 5IT9M 1Q7YH 3V3TA 1VDDA 2DB6A 2WCYA 3VI6A 5GINC 2KTVA 3G4SF 2JA1A 2SGEI 3LWOC 3CMEF 1CN7A 1LR7A 3OL0A 4UXHA 5FLXM 1KC8H 1W3SA 2QI2A 2HVYD 3TJQA 2OTLF 3CCRF 1LR8A 3ON1A 2SGQI 3SIUA 2GKRI 5EX3A 2N17A 1CGII 1K73H 4BY9D 5FUXA 2VGMA 3J81M 1HDLA 4BVQA 1YJWF 1YJNF 3NVIB 1M1KH 1Q81H 4A24A 1RFHA 2A20A 3O85A 1OMUA 2OTJF 3PAFA 1IW4A 2QEXF 4X3LA 1CK2A 1CSOI 3CCVF 1VQ4F 1CHOI 3CXCF 1R0RI 2LBXA 1K9MH 2KMOA 3GOXA 2L7XA 1T0KB 2JZMA 1IPAA 2WVJA 1VQ6F 1TOTA 1VQ5F 2J9RA 5A2QM 1SGYI 5FJ4C 1R79A 5DAEA 1H7MA 2N52A 5CCMA 1GO0A 1S72F 3FFMA 4LCKA 3D00A 2QQ0A 1VQNF 1Q86H 2SGPI 2OZBA 3HJWC 3FC3A 3LWRC 2NU1I 2ORWA 1TUSA 5EWRA 1JJ2F 2OD1A 2L8EA 2NU3I 1M90H 1YIJF 1QVGF 2LEOA 2F9ZC 1NJIH 2FC3A 5EX0A 3V7QA 1SGEI 1X7OA 1YITF 2QA4F 3UEJA 4UXJA 3UGDA 1M8CA 1YI2F 1CE3A 3MEKA 5GANK 1TIHA 2J87A 2JNBA 1VQKF 3SGQI 1UVGA 1UUCA 1W4RA 1PXWA 5G4UC 1V1HA 3IR9A 1UVFA 1DT9A 1DS3I 3UGIA 1SGRI 3WXMB 3AGKA 1HPTA 3CCEF 3OXLA 1Q82H 1TGSI 3PDNA 2ERWA 4SGBI 2M5XA 2UZ3A 1VQ9F 1VQ7F 1TBRR 2ENZA 2WALA 2ORVA 5GIOC 2NU4I 2BO1A 2F3CI 4L9MA 2GKVA 3QTLD 1W42A 2B8TA 1MT1A 3NVKE 3VE5A 1FARA 3G71F 1YTPA 5GAPK 1QVFF 3CC4F 2SGDI 5FUWA 4BVTA 1SGDI 1RA4A 1W41A 1CT4I 1VQLF 2V53A 1CGJI 2FGYA 2VRWB 1RLGA 1XBIA 1OVOA 1IY5A 3UFFA 4NUTA 2NU2I 3NK6A 2E5RA 3JAMM 2NU0I 3OXFA 2ODDA 5FUYA 1VQMF 1X74A 3VDPA 3VMFB 2JYYA 1V1IA 2KG4A 4TZZA 3N4ZA 2BUSA 4X3MA 1SDSA 3QWPA 3HH2C 1XX6A 4BW0B 1X52A 4HGUA 3E59A 2LUYA 3I56F 3CCMF 1VQOF 3CMAF 3N4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V1C A;  3VDP A;  3VDU A;  1VDD A;  2GLZ A;  3D00 A;  3VE5 A; 
#chains in the Genus database with same CATH topology
 4X1I B;  3DDN A;  3RYC B;  2KCX A;  2P6A C;  5G4V C;  1BUS A;  1HJA I;  5ITZ B;  2KTU A;  1CT0 I;  3N2G A;  4F6R B;  1X7P A;  4G88 A;  3GHZ A;  4O2B A;  3JAK B;  5KMG B;  1J7H A;  2VAM A;  5LA6 A;  1VH8 A;  3HKD A;  2HP0 B;  3UOE A;  3HWU A;  3TD4 A;  3CG6 A;  3IMP A;  1DS2 I;  3K14 A;  3B4V C;  5CA1 A;  5J2T B;  3FBA A;  5IJ9 A;  3KE1 A;  1TVK B;  3JAL A;  4UXI A;  2LB7 A;  1GZ0 A;  4WP4 A;  1ULK A;  1OYV I;  3KY9 A;  3RYI A;  1Y1C A;  3Q8H A;  3RYC A;  3CD6 F;  3C9R A;  4C4W C;  5JHW C;  1PCE A;  2N71 A;  1WGC A;  5EB0 A;  1SGQ I;  3UEY A;  2R75 1;  5KMG A;  1VQP F;  3NMU C;  2Y0M A;  5E3Q A;  5LP6 A;  4TUY B;  2RHO A;  2LBW A;  1QAH A;  4AML A;  1SGN I;  5AVM A;  5J2T A;  4BT6 A;  2QQD A;  3DC2 A;  4ZHV A;  2B0U C;  4ERH A;  1PJU A;  3VYT C;  2GVI A;  2W8B C;  1IV3 A;  2ROW A;  5EZY B;  3S0H A;  1Q8R A;  3IKF A;  3CC7 F;  1E7K A;  4RQO A;  4YJ3 B;  4TUY A;  2CWH A;  2UYN B;  3CCL F;  3SIV A;  4GI3 C;  5MN5 A;  1W2B F;  2SGF I;  1TUR A;  1JFF B;  2AMT A;  4O4L B;  2YUU A;  1W3E X;  2H8C A;  2EWC A;  4X1K A;  1N13 A;  1KNK A;  4TV9 A;  1FYB A;  1GO1 A;  1NQ3 A;  3C9U A;  2ENN A;  4YJ2 A;  1W5E A;  5J2U A;  3OBW A;  3E1Y A;  3K12 A;  2RIJ A;  2KMR A;  4I55 B;  2QQC A;  3R5A A;  4O4J B;  2Q1Y A;  1FAQ A;  2IAF A;  2UYN A;  2PQ8 A;  1CT2 I;  1U5K A;  3R0P A;  4EI8 A;  5HY4 A;  3R5D A;  1JFF A;  2HS3 A;  4NWO B;  1IV4 A;  4O4L A;  4NQ3 A;  3OXG A;  3ZOP A;  1TBO A;  4WBN B;  4OVO A;  4DNC A;  1YGY A;  5IJ0 A;  4BVS A;  1Q9B A;  5IYZ A;  2CZW A;  4X1Y A;  1ULM A;  3FSY A;  5CA0 A;  2KGW A;  2JW6 A;  3RA6 A;  2KMP A;  1H47 A;  3ZP7 A;  4O4H A;  3BJI A;  3V7E A;  4E1P A;  1PPF I;  2GLZ A;  4FFB A;  4I55 A;  4O4J A;  3UGL A;  1W58 1;  3EOR A;  3WJQ A;  3CCS F;  2B33 A;  1FSZ A;  2CWF A;  2QQE A;  2W0T A;  3IEW A;  1KD1 H;  3CPQ A;  2GKT I;  5EYP B;  3HKB B;  5HXU A;  1KQS F;  2V9Y A;  3M4S A;  5HWE A;  4WBN A;  1H48 A;  1ODE A;  1Z5V A;  1BMO A;  2OTM A;  2I6R A;  3N4Y A;  3SGB I;  1YU6 C;  2RB9 A;  3I55 F;  3LME A;  3M84 A;  3TO9 A;  1KNJ A;  4HNA A;  5MN4 A;  1PTQ A;  1YJ9 F;  2JXD A;  5LOV A;  1SGP I;  1NUB A;  5FUV A;  2HX0 A;  3UT5 B;  3JAW B;  1KMA A;  1Z7K B;  3OVO A;  3VO8 A;  3B6N A;  3OBY A;  3NK7 A;  3J80 M;  2CHT A;  1NMU B;  3HKB A;  2LBT A;  3VYS C;  2HS0 A;  3LWP C;  2CWG A;  4E1R A;  1OMT A;  1H0Z A;  3FPI A;  5LA6 B;  1K7U A;  2K9H A;  3ESJ A;  3CCQ F;  3HKD B;  1FY7 A;  4B6D A;  1IY6 A;  1R1M A;  3S0W A;  5HY2 A;  5CA1 B;  3MCA B;  4ZK7 A;  3LWQ C;  3UT5 A;  5HI7 A;  3RE3 A;  2VXY A;  3JAL B;  3F0F A;  3N2K A;  4LNU A;  3OW2 F;  1Y1B A;  3RYI B;  1W5F A;  3FSX A;  1GX1 A;  2VGN A;  2AIF A;  5EO3 A;  5JH7 B;  3M1X A;  1FFX A;  4JCV E;  1TBN A;  3JAT A;  3CC2 F;  3J7A R;  1AN1 I;  4FKD A;  1OAP A;  5HP7 A;  1YHQ F;  1XBT A;  2AIZ P;  5LP6 B;  3L7Q A;  2ARP F;  5HY1 A;  3FD6 A;  2E73 A;  2ALE A;  3LFO A;  3FD5 A;  1W5B A;  2I6D A;  1VQ8 F;  4EI9 A;  1XA6 A;  2HS4 A;  4C8G A;  3G6E F;  5C8Y B;  2Z1E A;  3WGM A;  5DCV A;  4BVR A;  4O2A B;  1LR9 A;  1MJ9 A;  1X25 A;  2OVO A;  2R6R 1;  1KBE A;  5JH7 A;  1X4S A;  3CB2 A;  2YQP A;  2KMQ A;  3E2I A;  2ZOD A;  2ELI A;  4B46 A;  1KBF A;  2V1C A;  5HXZ A;  2QPO A;  2LCA A;  1K8A H;  1RLU A;  4DXD A;  2FNF X;  3TOA A;  1ZWZ A;  3LWV C;  3GYQ A;  2BTQ B;  3CXL A;  5HY0 A;  2Z01 A;  2CW4 A;  1M8B A;  3V4D A;  3CYP B;  3HAX D;  1SZQ A;  3E20 B;  4C81 A;  3RA5 A;  4I50 A;  5C8Y A;  1PTR A;  1Y8F A;  2ZAU A;  2V1C C;  3CCJ F;  1COM A;  4XCQ A;  1NXU A;  2PHN A;  4X1K B;  4U3J A;  5LP6 C;  2DIP A;  3QAH A;  3SEK C;  4TV9 B;  3JAR B;  2XRC A;  4G4X A;  4O2A A;  5JCO A;  5GIP C;  4YJ2 B;  3ZP4 A;  3RU0 A;  5HQ8 A;  3PLA C;  5B8F A;  5J2U B;  5FNV A;  2UYK A;  2OHW A;  2CJS C;  4EI7 A;  3CCU F;  3QHD A;  3C8L A;  1UFY A;  2UZH A;  1W40 A;  1N8R H;  3ZO8 A;  2N1A B;  5CCL A;  3MDO A;  3VDU A;  3VOB A;  3CPW F;  4KWE A;  1TBQ R;  3JCM M;  5IT9 M;  5IJ0 B;  3P10 A;  2OZU A;  2X3T A;  2HRY A;  4BT3 A;  1Q7Y H;  3V3T A;  1VDD A;  5IYZ B;  3JAR A;  2DB6 A;  4X1Y B;  5CA0 B;  1W59 A;  2WCY A;  2K1S A;  3D54 A;  3VI6 A;  4IIJ A;  3WJP A;  5GIN C;  1K7T A;  2KTV A;  4O4H B;  3G4S F;  2GZL A;  4FFB B;  2JA1 A;  2SGE I;  3LWO C;  1W5A A;  2HP3 A;  3MCQ A;  3CME F;  2VAP A;  2IQQ A;  4B5C A;  1CN7 A;  2BTO A;  4O4I A;  3VCZ A;  1MJA A;  3MBM A;  1LR7 A;  3HTN A;  3KHN A;  3OL0 A;  3P0Z A;  4UXH A;  3HKE B;  5FLX M;  2Z1T A;  3MQW A;  5LYJ A;  4HNA B;  1KC8 H;  1W55 A;  1W3S A;  2QI2 A;  2HVY D;  2Q1X A;  3TOB A;  3WGL A;  3TJQ A;  5LOV B;  2OTL F;  3CCR F;  1LR8 A;  4IHJ A;  3HKC B;  3ON1 A;  3IKE A;  3E22 B;  2SGQ I;  3SIU A;  7WGA A;  2GKR I;  5EX3 A;  3K2X A;  3VTI C;  1JN1 A;  2ZOV A;  4DRX B;  1XV2 A;  2N17 A;  1CGI I;  2DYY A;  5LXT A;  1SA0 A;  1P9G A;  3F6M A;  1U40 A;  3HKE A;  1K73 H;  4BY9 D;  5FUX A;  1XRG A;  3D01 A;  3S03 A;  3TD3 A;  1WKX A;  2VGM A;  1HDL A;  3J81 M;  4BVQ A;  1TUB A;  4ZHW A;  1YJW F;  4BT4 A;  1YJN F;  3NVI B;  1M1K H;  1Q81 H;  5GON A;  4A24 A;  1RFH A;  3HKC A;  3E22 A;  1UHA A;  3N2K B;  4LNU B;  2A20 A;  4C82 A;  3O85 A;  1FNK A;  4G4W A;  1OMU A;  3IEQ A;  4DRX A;  1FFX B;  2OTJ F;  3RYH B;  3JAT B;  3PAF A;  3WGN A;  1IW4 A;  2QEX F;  2RHL A;  4X3L A;  3R5C A;  1CK2 A;  1CSO I;  3CCV F;  1VQ4 F;  1CHO I;  5KX5 A;  3CXC F;  3C9T A;  4I4T B;  3TO7 A;  1R0R I;  2LBX A;  1K9M H;  2UYP A;  2KMO A;  3GOX A;  1UI9 A;  1U3L A;  1U3P A;  2L7X A;  1IV1 A;  1T0K B;  2JZM A;  1IPA A;  2WVJ A;  1FNJ A;  1VQ6 F;  1TOT A;  4X20 B;  3WPX A;  1RQ7 A;  1VQ5 F;  2J9R A;  5A2Q M;  1SGY I;  4EB6 A;  3F0E A;  2UVO A;  1VHA A;  5EAZ A;  3RYH A;  1WGT A;  5BMV A;  1WTJ A;  5FJ4 C;  1R79 A;  5DAE A;  1Z5W A;  1H7M A;  1JY8 A;  2N52 A;  1QU9 A;  2H6L A;  1W57 A;  2N48 A;  3RYF A;  5CCM A;  3LYB A;  1K7V A;  4I4T A;  4C8E A;  1GO0 A;  1S72 F;  4I50 B;  3FFM A;  4LCK A;  3ELC A;  3U0O A;  3JVH A;  3JAS A;  3R5B A;  2QQ0 A;  4U3J B;  2VAW A;  4X20 A;  4RHA A;  2ZVZ A;  3S06 A;  1Q86 H;  2SGP I;  1VQN F;  2OZB A;  3HJW C;  3FC3 A;  1P9Z A;  2P6Y A;  3LWR C;  2NU1 I;  2ORW A;  4B45 A;  3S02 A;  2WGC A;  5FNV B;  1TUS A;  2CVL A;  5EWR A;  1JJ2 F;  2NMU A;  4ZHY B;  2OD1 A;  2L8E A;  2G9I A;  2NU3 I;  1M90 H;  5JQG A;  1YIJ F;  3VOA A;  3TO6 A;  5CB4 B;  3BYQ A;  1QVG F;  5HP8 A;  3WJR A;  2LEO A;  2F9Z C;  1NJI H;  1VK3 A;  2Z1F A;  2FC3 A;  2HRU A;  5EX0 A;  4X1I A;  3V7Q A;  1SGE I;  1X7O A;  4IIJ B;  1YIT F;  1CLI A;  2QA4 F;  3UEJ A;  3TD5 A;  5ITZ A;  2GIV A;  3KJK A;  4F6R A;  4UXJ A;  3UGD A;  3JAK A;  4PWT A;  1OFU A;  4B62 A;  3F0D A;  5JCO C;  1M8C A;  2HP0 A;  3QUW A;  5CB4 A;  1YI2 F;  1T0A A;  4O4I B;  1CE3 A;  1Z2I A;  3MEK A;  4G4Z A;  1TVK A;  5GAN K;  3I3F A;  1TIH A;  2J87 A;  2JNB A;  1VQK F;  3SGQ I;  1UVG A;  1UUC A;  1W4R A;  5LYJ B;  3F0G A;  5MN6 A;  3WGJ A;  1PXW A;  5G4U C;  5J8C A;  1V1H A;  9WGA A;  1DT9 A;  1UVF A;  3IR9 A;  1DS3 I;  3UGI A;  1SGR I;  3WXM B;  4IHJ B;  3AGK A;  5EIB D;  1HPT A;  4R40 B;  3CCE F;  3OXL A;  1Q82 H;  4BT2 A;  1DBF A;  1TGS I;  3PDN A;  3OON A;  2ERW A;  4SGB I;  3VIU A;  5LXT B;  2M5X A;  1SA0 B;  2UZ3 A;  2ZVY A;  1VQ9 F;  2Z1U A;  2QTP A;  1VQ7 F;  1TBR R;  3S0Y A;  2ENZ A;  1TUB B;  2WAL A;  2ORV A;  3ERN A;  5EZY A;  5GIO C;  2NU4 I;  2DT4 A;  4M8I A;  5JVD B;  2YXZ A;  4YJ3 A;  3GTZ A;  2BO1 A;  5GON B;  2F3C I;  4L9M A;  2GKV A;  4G4Y A;  3QTL D;  1W42 A;  2B8T A;  4U39 A;  1MT1 A;  4BT5 A;  3NVK E;  3VE5 A;  4G4V A;  1FAR A;  3G71 F;  1RQ2 A;  1YTP A;  4BT7 A;  5GAP K;  2YYE A;  3CC4 F;  2DKV A;  2SGD I;  5FUW A;  1HEV A;  2RHJ A;  4BVT A;  1QVF F;  5E3R A;  4ZOL B;  3C9S A;  3P4E A;  2CHS A;  1XHO A;  2CWJ A;  5KX5 B;  3KJJ A;  1SGD I;  1JD1 A;  1RA4 A;  1W41 A;  1CT4 I;  2MQE A;  5JVD A;  1VQL F;  2V53 A;  5J8F A;  1CGJ I;  2FGY A;  2RC4 A;  2IG8 A;  2VRW B;  4C8I A;  1S20 A;  1RLG A;  1QD9 A;  4ZI7 B;  1XBI A;  1OVO A;  1IY5 A;  3UFF A;  4EB6 B;  3VYU C;  3WPW A;  1VQV A;  3T80 A;  5E3P A;  5BMV B;  1ONI A;  4NUT A;  5EIB C;  4ZOL A;  2NU2 I;  3KIZ A;  2CSL A;  3NK6 A;  2ZF8 A;  1ULN A;  3I7T A;  5EB1 B;  1MJB A;  3RYF B;  2E5R A;  2OU2 A;  1U43 A;  3WGK A;  3JAM M;  2NU0 I;  3OXF A;  2ODD A;  4MPI A;  5FUY A;  1VQM F;  1X74 A;  2X52 A;  4ZHQ B;  3VDP A;  3K0T A;  3VMF B;  2HQS C;  3JAS B;  3QTY A;  2JYY A;  2RHH A;  2BTU A;  4TV8 B;  4ZI7 A;  1V1I A;  2KG4 A;  3LDT A;  5EYP A;  4TZZ A;  3N4Z A;  4E6E A;  3CYQ A;  2BUS A;  3N2G B;  4O2B B;  4X3M A;  2H8E A;  1SDS A;  2UYJ A;  5JQG B;  3QWP A;  3HH2 C;  1XX6 A;  4BW0 B;  1X52 A;  4HGU A;  3E59 A;  4ZHQ A;  1IV2 A;  2L26 A;  2LUY A;  3I56 F;  1PF5 A;  2PMP A;  3JAW A;  1YQN A;  5IJ9 B;  3CCM F;  1VQO F;  3CMA F;  4TV8 A;  3D00 A; 
#chains in the Genus database with same CATH homology
 2KCX A;  2P6A C;  5G4V C;  1BUS A;  1HJA I;  2KTU A;  1CT0 I;  1X7P A;  3CG6 A;  1DS2 I;  3B4V C;  4UXI A;  1GZ0 A;  1OYV I;  3KY9 A;  1Y1C A;  3CD6 F;  4C4W C;  5JHW C;  1PCE A;  2N71 A;  1SGQ I;  3UEY A;  1VQP F;  3NMU C;  2LBW A;  1SGN I;  2QQD A;  2B0U C;  1PJU A;  2GVI A;  2ROW A;  3CC7 F;  1E7K A;  3CCL F;  3SIV A;  4GI3 C;  1W2B F;  2SGF I;  1TUR A;  2YUU A;  1W3E X;  1N13 A;  1FYB A;  1GO1 A;  2ENN A;  3OBW A;  3E1Y A;  2KMR A;  2QQC A;  1FAQ A;  1CT2 I;  1U5K A;  4EI8 A;  5HY4 A;  4NQ3 A;  3OXG A;  1TBO A;  4OVO A;  4BVS A;  2CZW A;  2JW6 A;  3RA6 A;  2KMP A;  3BJI A;  3V7E A;  4E1P A;  1PPF I;  2GLZ A;  3UGL A;  3CCS F;  2QQE A;  2W0T A;  1KD1 H;  3CPQ A;  2GKT I;  5HXU A;  1KQS F;  5HWE A;  1BMO A;  3SGB I;  1YU6 C;  3I55 F;  1PTQ A;  1YJ9 F;  2JXD A;  1SGP I;  1NUB A;  5FUV A;  1KMA A;  1Z7K B;  3OVO A;  3OBY A;  3NK7 A;  3J80 M;  1NMU B;  3LWP C;  4E1R A;  1OMT A;  1H0Z A;  2K9H A;  3CCQ F;  4B6D A;  1IY6 A;  5HY2 A;  3MCA B;  3LWQ C;  5HI7 A;  3OW2 F;  1Y1B A;  5EO3 A;  2VGN A;  2AIF A;  4JCV E;  1TBN A;  3CC2 F;  3J7A R;  1AN1 I;  4FKD A;  1YHQ F;  1XBT A;  2ARP F;  5HY1 A;  2E73 A;  2ALE A;  3LFO A;  2I6D A;  1VQ8 F;  4EI9 A;  1XA6 A;  3G6E F;  5DCV A;  4BVR A;  1LR9 A;  2OVO A;  1KBE A;  1X4S A;  2YQP A;  2KMQ A;  3E2I A;  2ELI A;  1KBF A;  2V1C A;  5HXZ A;  2QPO A;  1K8A H;  2FNF X;  1ZWZ A;  3LWV C;  3GYQ A;  3CXL A;  5HY0 A;  1M8B A;  3HAX D;  3E20 B;  3RA5 A;  1PTR A;  1Y8F A;  2V1C C;  3CCJ F;  4XCQ A;  2DIP A;  3SEK C;  2XRC A;  5GIP C;  3RU0 A;  5HQ8 A;  3PLA C;  2OHW A;  2CJS C;  4EI7 A;  3CCU F;  1W40 A;  1N8R H;  2N1A B;  5CCL A;  3VDU A;  3CPW F;  1TBQ R;  3JCM M;  5IT9 M;  1Q7Y H;  3V3T A;  1VDD A;  2DB6 A;  2WCY A;  3VI6 A;  5GIN C;  2KTV A;  3G4S F;  2JA1 A;  2SGE I;  3LWO C;  3CME F;  1CN7 A;  1LR7 A;  3OL0 A;  4UXH A;  5FLX M;  1KC8 H;  1W3S A;  2QI2 A;  2HVY D;  3TJQ A;  2OTL F;  3CCR F;  1LR8 A;  3ON1 A;  2SGQ I;  3SIU A;  2GKR I;  5EX3 A;  2N17 A;  1CGI I;  1K73 H;  4BY9 D;  5FUX A;  2VGM A;  3J81 M;  1HDL A;  4BVQ A;  1YJW F;  1YJN F;  3NVI B;  1M1K H;  1Q81 H;  4A24 A;  1RFH A;  2A20 A;  3O85 A;  1OMU A;  2OTJ F;  3PAF A;  1IW4 A;  2QEX F;  4X3L A;  1CK2 A;  1CSO I;  3CCV F;  1VQ4 F;  1CHO I;  3CXC F;  1R0R I;  2LBX A;  1K9M H;  2KMO A;  3GOX A;  2L7X A;  1T0K B;  2JZM A;  1IPA A;  2WVJ A;  1VQ6 F;  1TOT A;  1VQ5 F;  2J9R A;  5A2Q M;  1SGY I;  5FJ4 C;  1R79 A;  5DAE A;  1H7M A;  2N52 A;  5CCM A;  1GO0 A;  1S72 F;  3FFM A;  4LCK A;  3D00 A;  2QQ0 A;  1VQN F;  1Q86 H;  2SGP I;  2OZB A;  3HJW C;  3FC3 A;  3LWR C;  2NU1 I;  2ORW A;  1TUS A;  5EWR A;  1JJ2 F;  2OD1 A;  2L8E A;  2NU3 I;  1M90 H;  1YIJ F;  1QVG F;  2LEO A;  2F9Z C;  1NJI H;  2FC3 A;  5EX0 A;  3V7Q A;  1SGE I;  1X7O A;  1YIT F;  2QA4 F;  3UEJ A;  4UXJ A;  3UGD A;  1M8C A;  1YI2 F;  1CE3 A;  3MEK A;  5GAN K;  1TIH A;  2J87 A;  2JNB A;  1VQK F;  3SGQ I;  1UVG A;  1UUC A;  1W4R A;  1PXW A;  5G4U C;  1V1H A;  3IR9 A;  1UVF A;  1DT9 A;  1DS3 I;  3UGI A;  1SGR I;  3WXM B;  3AGK A;  1HPT A;  3CCE F;  3OXL A;  1Q82 H;  1TGS I;  3PDN A;  2ERW A;  4SGB I;  2M5X A;  2UZ3 A;  1VQ9 F;  1VQ7 F;  1TBR R;  2ENZ A;  2WAL A;  2ORV A;  5GIO C;  2NU4 I;  2BO1 A;  2F3C I;  4L9M A;  2GKV A;  3QTL D;  1W42 A;  2B8T A;  1MT1 A;  3NVK E;  3VE5 A;  1FAR A;  3G71 F;  1YTP A;  5GAP K;  1QVF F;  3CC4 F;  2SGD I;  5FUW A;  4BVT A;  1SGD I;  1RA4 A;  1W41 A;  1CT4 I;  1VQL F;  2V53 A;  1CGJ I;  2FGY A;  2VRW B;  1RLG A;  1XBI A;  1OVO A;  1IY5 A;  3UFF A;  4NUT A;  2NU2 I;  3NK6 A;  2E5R A;  3JAM M;  2NU0 I;  3OXF A;  2ODD A;  5FUY A;  1VQM F;  1X74 A;  3VDP A;  3VMF B;  2JYY A;  1V1I A;  2KG4 A;  4TZZ A;  3N4Z A;  2BUS A;  4X3M A;  1SDS A;  3QWP A;  3HH2 C;  1XX6 A;  4BW0 B;  1X52 A;  4HGU A;  3E59 A;  2LUY A;  3I56 F;  3CCM F;  1VQO F;  3CMA F;  3N4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...