3D00A

Crystal structure of a tungsten formylmethanofuran dehydrogenase subunit e (fmde)-like protein (syn_00638) from syntrophus aciditrophicus at 1.90 a resolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
190
structure length
184
Chain Sequence
MTARNILSYSYEEYVEKITAFHGYPAPGVLIGGFMVDLAVKNLPEGILYDAICETRTCLPDAVQLLTPCTFGNGWLTVLPMGLFAVSLYDKFTGEGVRVFLDVEKMGPWQEIRNWFLKLKSERLFKEIREAGPDILELRNVKLKPGFLEKKHKGKIVLCPQCREAYPAQDGELCLSCQGGSPYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tungsten formylmethanofuran dehydrogenase subunit E
publication title Structures of three members of Pfam PF02663 (FmdE) implicated in microbial methanogenesis reveal a conserved alpha+beta core domain and an auxiliary C-terminal treble-clef zinc finger.
pubmed doi rcsb
source organism Syntrophus aciditrophicus
molecule tags Metal binding protein
total genus 46
structure length 184
sequence length 190
ec nomenclature
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02663 FmdE FmdE, Molybdenum formylmethanofuran dehydrogenase operon
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.80 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3d00A02
3.30.1330.130 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3d00A01
3VE5A 2V1CA 1VDDA 3D00A 2GLZA 3VDPA 3VDUA
chains in the Genus database with same CATH superfamily
1ULMA 2SGDI 1KNKA 5GAPK 4X1KB 3G71F 5FJ4C 1XA6A 2FNFX 5J2TA 1FAQA 1RFHA 5IYZA 3C9SA 1CLIA 1SA0B 1RLGA 1VDDA 2AIFA 5EYPA 3TD3A 4M8IA 1SGQI 1SDSA 2VRWB 2IQQA 5G4VC 2OTMA 1YI2F 2KMOA 3LWPC 1GZ0A 2GIVA 3SIVA 2V1CA 2QI2A 4XCQA 2B0UC 3CMEF 2Z1EA 1JD1A 2GLZA 1VQKF 2BTUA 3D01A 1W59A 3RE3A 1K7TA 5HY1A 5FUVA 3BYQA 1TVKB 2R6R1 1QAHA 3TO9A 2V9YA 3ON1A 1W57A 3KJJA 1UUCA 1N13A 2UYNA 3HKEB 4X1IB 5IJ9A 1CGII 5C8YB 3LWRC 3CCJF 5EAZA 1KQSF 5J8FA 4BVTA 3WPXA 4C4WC 1JY8A 3CPWF 1W3EX 1ULKA 3UFFA 2QQEA 2ODDA 3HTNA 5E3QA 2PMPA 5GIPC 2NU1I 2V1CC 1NJIH 2QTPA 2ORVA 1J7HA 4I50A 1R0RI 1WGCA 5CCLA 4WBNB 3JAMM 2N1AB 4TV9A 3HKCA 3V4DA 3UEJA 3HH2C 1VQ6F 2LUYA 3UGIA 3N4YA 1FNKA 5ITZA 2CHSA 2JNBA 1H48A 2Q1XA 1H0ZA 2HVYD 3VTIC 5CA1A 4ZHVA 1W40A 1Y1CA 3OXLA 1PJUA 4O2AA 4ERHA 4ZI7B 1GO0A 3QTLD 3TO6A 3VDUA 3RYFB 2CVLA 2I6DA 3CXLA 3JALB 1PTRA 3HAXD 2LCAA 4ZOLB 1VK3A 4LNUA 4KWEA 1TBOA 5IJ0A 4U3JB 3T80A 3RYHA 4X3LA 5GONA 3UEYA 5JCOA 4YJ2A 1W581 3TD5A 3LWVC 1DS2I 3QHDA 1VQVA 3HKBB 3LWOC 3KY9A 5LXTA 3VYSC 2QEXF 5HY2A 1YJNF 1K9MH 2VAMA 2LEOA 2PQ8A 1DBFA 4BW0B 2UYKA 2KGWA 5EX0A 2ZOVA 5CB4A 3K0TA 2CWJA 3JAWB 3JASB 3OXGA 3VOAA 1VQ8F 1Q81H 1ODEA 1P9GA 3N2KA 4EB6A 4O4LA 3Q8HA 4I55B 5EO3A 2OZBA 3QWPA 2R751 4L9MA 1YJ9F 1LR7A 3E22A 2XRCA 3SGQI 2CSLA 1CK2A 4O4JA 3HKDA 5EWRA 2HS0A 1YJWF 3CPQA 4C8IA 3R0PA 3K2XA 3VIUA 2UYPA 4WP4A 5JCOC 2K1SA 3HWUA 1ULNA 5JQGA 1RLUA 3MBMA 5BMVB 4F6RB 2SGFI 1RQ7A 2QQDA 1HEVA 5EIBC 5LOVA 1PCEA 5HP8A 5HXZA 2I6RA 4BT2A 2JXDA 4C82A 2QPOA 1PXWA 3M1XA 2X3TA 1W41A 3FBAA 3ELCA 3CCVF 5HY4A 5KMGB 5CA0A 5EX3A 5J2UA 1W42A 4TV8A 5KX5A 2L26A 2KG4A 2VXYA 1R79A 2J87A 5DAEA 3FC3A 2DT4A 4A24A 1MJAA 3SGBI 5EIBD 3JATB 1TOTA 1ONIA 3S0YA 2AMTA 2W8BC 1XBIA 3IEWA 1SGNI 1TBRR 2QQ0A 4O4IB 2WALA 1XV2A 3I3FA 3JVHA 1UHAA 4IIJB 1QU9A 2HS3A 3WGKA 1K7UA 4O4HA 3JAKA 1HPTA 3I7TA 2Z1TA 2CZWA 4I4TB 3RYCA 3R5AA 2P6YA 1H47A 3C9RA 4X20B 2MQEA 2YUUA 3TO7A 2HRYA 1RQ2A 3F0EA 4G4YA 3TJQA 5EZYB 3CD6F 4DNCA 2B33A 3KE1A 3ZP7A 2RHOA 1V1HA 2OZUA 2RHHA 2OU2A 1IV1A 2HX0A 4FFBB 4PWTA 3GHZA 1TVKA 5GINC 2IAFA 2CWGA 1TUBA 4ZHQA 1BMOA 9WGAA 3P10A 1YIJF 1W5EA 5LYJA 4JCVE 2YQPA 1WKXA 3IKEA 2DYYA 1X74A 5JH7A 1SGPI 3CCEF 1HDLA 5GIOC 2DIPA 2AIZP 4X1YA 2ZF8A 1Q7YH 5HP7A 3CC2F 2J9RA 1SGEI 4EI7A 2KTUA 1YTPA 2N17A 1R1MA 2NMUA 3S06A 2IG8A 2N48A 1S20A 1TGSI 3OXFA 3E59A 1KC8H 3QUWA 3CCLF 4FKDA 3CCUF 1PF5A 1Z2IA 5FNVA 2CJSC 2SGPI 2Y0MA 3RYFA 4B62A 3JALA 4DXDA 2JYYA 3S02A 1QD9A 3WGNA 4DRXB 3LWQC 2BUSA 1XHOA 4G4WA 1VQPF 1ZWZA 1IV3A 3V7QA 1TBNA 1FFXA 3TOBA 2QQCA 3U0OA 5LP6A 3FSXA 4EI9A 5IJ9B 2KMQA 2UYNB 1SGYI 1SGRI 5MN5A 4B46A 2KMRA 1VHAA 3CC7F 2UZHA 2H6LA 3B6NA 3V3TA 4TUYA 2YYEA 3JAWA 2LBWA 2GKVA 1CSOI 3E20B 3FPIA 3GYQA 1Z7KB 1T0KB 3I55F 1CT2I 5MN4A 3RU0A 2RHJA 2H8CA 4I55A 4IHJA 4I50B 1MT1A 2GVIA 3VOBA 2CWFA 1SZQA 3HKCB 4TV9B 3MQWA 2HP3A 2BO1A 5ITZB 3IEQA 3MCQA 3J80M 1YQNA 3DDNA 1M1KH 4BY9D 5LP6C 1CT4I 3I56F 5CA1B 1OVOA 1UFYA 3D00A 3D54A 4O2AB 4F6RA 5BMVA 1IY5A 4R40B 3VYUC 3CCQF 3FD6A 3VI6A 3UGLA 2N71A 4AMLA 1JFFA 5HQ8A 4HNAA 1VQNF 3ESJA 3M4SA 1P9ZA 4O2BB 5J8CA 3NVKE 1QVFF 4LNUB 4C8GA 4RHAA 1TIHA 5IJ0B 1E7KA 1OMTA 2FC3A 4ZK7A 4YJ2B 2JA1A 1UVFA 3L7QA 3G6EF 2KMPA 4BVSA 2HRUA 1GO1A 2G9IA 3JARA 4B5CA 5CB4B 1DT9A 2HP0B 2LB7A 4E1PA 5LA6A 4GI3C 4B6DA 2UYJA 5HI7A 2YXZA 1YITF 2VGNA 3F0FA 3OONA 4EB6B 3PDNA 3N4ZA 5JVDB 3VDPA 4O4LB 2PHNA 3UT5A 1X7PA 3S0HA 3TOAA 1X25A 3CMAF 2HS4A 4G4ZA 1NMUB 4YJ3A 3UGDA 3GOXA 4O4JB 3HKDB 4TZZA 3RYIB 4UXHA 4G88A 1AN1I 4X1KA 2CW4A 3NK7A 5JQGB 5IT9M 2LBXA 3B4VC 4UXJA 1Z5VA 1U40A 3C9UA 1SA0A 3FFMA 2M5XA 5LOVB 4SGBI 2BTQB 1U43A 2V53A 3IMPA 4MPIA 3OBWA 1XBTA 3SIUA 3R5DA 2L8EA 3MEKA 1CHOI 3CYPB 4G4VA 3NMUC 3WGLA 3E1YA 1FSZA 5HXUA 4BT6A 4RQOA 1W5FA 5MN6A 1U3PA 2ALEA 3N2GB 1UI9A 3WJRA 1YGYA 5CA0B 1PTQA 2ARPF 1KNJA 1WTJA 2JZMA 1OFUA 2RHLA 4NQ3A 4TV8B 5KX5B 2ENZA 2NU4I 4X1IA 3HKEA 1N8RH 2QA4F 3VE5A 3AGKA 5C8YA 1W5AA 3WJPA 2NU2I 3CYQA 3FSYA 2KTVA 4BT3A 4ZHWA 2OVOA 1IW4A 2BTOA 2W0TA 1TUSA 2UZ3A 1Q8RA 2SGEI 1CE3A 1V1IA 1K73H 2EWCA 3NVIB 3RA6A 1JN1A 4E6EA 2OTJF 4O4HB 4C8EA 3VO8A 2ORWA 3QTYA 3JAKB 3R5CA 3CG6A 1IY6A 3RYCB 1DS3I 2B8TA 1RA4A 5A2QM 3G4SF 4WBNA 4ZHYB 2E73A 2N52A 2CHTA 4U39A 5J2TB 3P4EA 2SGQI 5IYZB 3V7EA 1HJAI 3VMFB 5EYPB 2DKVA 2L7XA 4UXIA 3WGJA 1W4RA 2WGCA 2A20A 2H8EA 2Z1FA 4OVOA 4DRXA 1YU6C 1VQOF 1S72F 2ROWA 4ZI7A 1K7VA 5E3PA 2VAWA 3CCMF 1FYBA 1TUBB 4ZHQB 5HY0A 1U5KA 5LYJB 1YHQF 1U3LA 4ZOLA 1OMUA 2OHWA 4U3JA 2OD1A 2ZVYA 2F9ZC 5JH7B 3ZP4A 4HGUA 5FUWA 4EI8A 3CB2A 5DCVA 3HKBA 5EB0A 1UVGA 3M84A 4X1YB 3S0WA 2ENNA 2ELIA 1VQLF 3J7AR 3O85A 4NUTA 1VQ4F 1KD1H 2LBTA 3MDOA 1M90H 3K12A 1FNJA 3JASA 3LFOA 1IPAA 5FUXA 3CXCF 1W3SA 3F0GA 3K14A 2NU0I 3P0ZA 3CCRF 3NK6A 1Q9BA 3E2IA 3ZO8A 4BT7A 2X52A 2RIJA 2RB9A 3WJQA 2Z1UA 2ZAUA 3DC2A 3IKFA 1OYVI 2VGMA 5FNVB 2GKTI 3CC4F 3OBYA 1KBEA 1KBFA 4O2BA 2E5RA 4B45A 1TURA 3WPWA 1CT0I 3EORA 1FFXB 1OAPA 3S03A 5LP6B 4NWOB 5HWEA 1W5BA 5EB1B 2HQSC 1W2BF 4BVRA 3OL0A 3OVOA 1MJBA 2KCXA 3VCZA 2ZVZA 1Y1BA 1W55A 3RYHB 1X4SA 2HP0A 3SEKC 4X3MA 5GONB 4TUYB 3RA5A 3PAFA 3F0DA 3J81M 1JJ2F 1TBQR 3WGMA 5LXTB 3CCSF 5GANK 5CCMA 1IV4A 5KMGA 4G4XA 5JVDA 2ERWA 1VQ5F 4IHJB 3MCAB 1NUBA 3C8LA 1VQ7F 1GX1A 1IV2A 1Y8FA 1SGDI 5FUYA 7WGAA 2UVOA 1VQMF 3JATA 1Q86H 3C9TA 2WVJA 3N2KB 3RYIA 1FARA 3PLAC 1CN7A 1FY7A 2Q1YA 4C81A 1KMAA 2RC4A 2P6AC 4O4IA 1LR8A 3E22B 3FD5A 4IIJA 3JCMM 3UOEA 2GKRI 1QVGF 1BUSA 3OW2F 4HNAB 1CGJI 1JFFB 4I4TA 2K9HA 3LYBA 2OTLF 3TD4A 3KIZA 1Q82H 4BVQA 5JHWC 1VH8A 5AVMA 2ZODA 3HJWC 4X20A 1MJ9A 1M8CA 1XX6A 2DB6A 2WCYA 4E1RA 5EZYA 3N2GA 4BT5A 1WGTA 1XRGA 1X7OA 4FFBA 1NQ3A 3LMEA 2F3CI 1K8AH 3WXMB 1Z5WA 3JARB 4LCKA 1H7MA 3IR9A 1NXUA 5LA6B 5B8FA 3GTZA 2VAPA 3R5BA 3ZOPA 3F6MA 1X52A 3BJIA 4BT4A 3LDTA 1COMA 1T0AA 3UT5B 1LR9A 5J2UB 5FLXM 2NU3I 1M8BA 5G4UC 5E3RA 2Z01A 3KJKA 1PPFI 1VQ9F 3KHNA 2FGYA 2GZLA 4YJ3B 3VYTC 2CWHA 2JW6A 3ERNA 3QAHA
chains in the Genus database with same CATH topology
2SGDI 5GAPK 3G71F 5FJ4C 1XA6A 2FNFX 1FAQA 1RFHA 1RLGA 1VDDA 2AIFA 1SGQI 1SDSA 2VRWB 5G4VC 1YI2F 2KMOA 3LWPC 1GZ0A 3SIVA 2V1CA 2QI2A 4XCQA 2B0UC 3CMEF 2GLZA 1VQKF 5HY1A 5FUVA 3ON1A 1UUCA 1N13A 3CCJF 1CGII 3LWRC 1KQSF 4BVTA 4C4WC 3CPWF 1W3EX 3UFFA 2QQEA 2ODDA 5GIPC 2NU1I 2V1CC 1NJIH 2ORVA 1R0RI 5CCLA 3JAMM 2N1AB 3UEJA 3HH2C 1VQ6F 2LUYA 3UGIA 3N4YA 2JNBA 1H0ZA 2HVYD 1W40A 1Y1CA 3OXLA 1PJUA 1GO0A 3QTLD 3VDUA 2I6DA 3CXLA 1PTRA 3HAXD 1TBOA 4X3LA 3UEYA 3LWVC 1DS2I 3LWOC 2QEXF 3KY9A 1K9MH 1YJNF 5HY2A 2LEOA 4BW0B 5EX0A 3OXGA 1VQ8F 1Q81H 5EO3A 2OZBA 3QWPA 4L9MA 1YJ9F 1LR7A 2XRCA 3SGQI 1CK2A 5EWRA 1YJWF 3CPQA 2SGFI 2QQDA 1PCEA 5HXZA 2JXDA 2QPOA 1PXWA 1W41A 3CCVF 5HY4A 5EX3A 1W42A 2KG4A 1R79A 2J87A 5DAEA 3FC3A 4A24A 3SGBI 1TOTA 1XBIA 1SGNI 1TBRR 2QQ0A 2WALA 1HPTA 2CZWA 2YUUA 3TJQA 3CD6F 1V1HA 5GINC 1BMOA 1YIJF 4JCVE 2YQPA 1X74A 1SGPI 3CCEF 1HDLA 5GIOC 2DIPA 1Q7YH 3CC2F 2J9RA 1SGEI 4EI7A 2KTUA 1YTPA 2N17A 1TGSI 3OXFA 3E59A 1KC8H 3CCLF 4FKDA 3CCUF 2CJSC 2SGPI 2JYYA 1VQPF 3LWQC 2BUSA 1ZWZA 3V7QA 1TBNA 2QQCA 4EI9A 2KMQA 1SGYI 1SGRI 2KMRA 3CC7F 3V3TA 2LBWA 2GKVA 1CSOI 3E20B 3GYQA 1Z7KB 1T0KB 3I55F 1CT2I 3RU0A 1MT1A 2GVIA 2BO1A 3J80M 1M1KH 4BY9D 3I56F 1CT4I 1OVOA 3D00A 1IY5A 3CCQF 3VI6A 3UGLA 2N71A 1VQNF 5HQ8A 3NVKE 1QVFF 1TIHA 1E7KA 1OMTA 2FC3A 2JA1A 1UVFA 3G6EF 2KMPA 4BVSA 1GO1A 1DT9A 4E1PA 4GI3C 4B6DA 5HI7A 1YITF 2VGNA 3PDNA 3N4ZA 3VDPA 1X7PA 3CMAF 1NMUB 3UGDA 3GOXA 4TZZA 4UXHA 1AN1I 3NK7A 5IT9M 2LBXA 3B4VC 4UXJA 3FFMA 2M5XA 4SGBI 2V53A 3OBWA 1XBTA 3SIUA 2L8EA 3MEKA 1CHOI 3NMUC 3E1YA 5HXUA 2ALEA 1PTQA 2ARPF 2JZMA 4NQ3A 2ENZA 2NU4I 1N8RH 2QA4F 3VE5A 3AGKA 2NU2I 2KTVA 2OVOA 1IW4A 2W0TA 1TUSA 2UZ3A 2SGEI 1CE3A 1V1IA 1K73H 3NVIB 3RA6A 2OTJF 2ORWA 3CG6A 1IY6A 1DS3I 2B8TA 1RA4A 5A2QM 3G4SF 2E73A 2N52A 2SGQI 3V7EA 1HJAI 3VMFB 2L7XA 4UXIA 1W4RA 2A20A 4OVOA 1YU6C 1VQOF 1S72F 2ROWA 3CCMF 1FYBA 5HY0A 1U5KA 1YHQF 1OMUA 2OHWA 2OD1A 2F9ZC 5DCVA 4HGUA 5FUWA 4EI8A 1UVGA 2ENNA 2ELIA 1VQLF 3J7AR 3O85A 4NUTA 1VQ4F 1KD1H 1M90H 3LFOA 1IPAA 5FUXA 3CXCF 1W3SA 2NU0I 3CCRF 3NK6A 3E2IA 1OYVI 2VGMA 2GKTI 3CC4F 3OBYA 1KBEA 1KBFA 2E5RA 1TURA 1CT0I 5HWEA 1W2BF 4BVRA 3OL0A 3OVOA 2KCXA 1Y1BA 1X4SA 3RA5A 3SEKC 4X3MA 3PAFA 3J81M 1JJ2F 1TBQR 3CCSF 5GANK 5CCMA 2ERWA 1VQ5F 3MCAB 1NUBA 1VQ7F 1Y8FA 1SGDI 5FUYA 1VQMF 1Q86H 2WVJA 1FARA 3PLAC 1CN7A 1KMAA 2P6AC 1LR8A 3JCMM 2GKRI 1QVGF 1BUSA 3OW2F 1CGJI 2K9HA 2OTLF 1Q82H 4BVQA 5JHWC 3HJWC 1M8CA 1XX6A 2DB6A 2WCYA 4E1RA 1X7OA 2F3CI 1K8AH 3WXMB 4LCKA 1H7MA 3IR9A 1X52A 3BJIA 5FLXM 1LR9A 2NU3I 1M8BA 5G4UC 1PPFI 1VQ9F 2FGYA 2JW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VE5 A;  2V1C A;  1VDD A;  3D00 A;  2GLZ A;  3VDP A;  3VDU A; 
#chains in the Genus database with same CATH topology
 1ULM A;  2SGD I;  1KNK A;  5GAP K;  4X1K B;  3G71 F;  5FJ4 C;  1XA6 A;  2FNF X;  5J2T A;  1FAQ A;  1RFH A;  5IYZ A;  3C9S A;  1CLI A;  1SA0 B;  1RLG A;  1VDD A;  2AIF A;  5EYP A;  3TD3 A;  4M8I A;  1SGQ I;  1SDS A;  2VRW B;  2IQQ A;  5G4V C;  2OTM A;  1YI2 F;  2KMO A;  3LWP C;  1GZ0 A;  2GIV A;  3SIV A;  2V1C A;  2QI2 A;  4XCQ A;  2B0U C;  3CME F;  2Z1E A;  1JD1 A;  2GLZ A;  1VQK F;  2BTU A;  3D01 A;  1W59 A;  3RE3 A;  1K7T A;  5HY1 A;  5FUV A;  3BYQ A;  1TVK B;  2R6R 1;  1QAH A;  3TO9 A;  2V9Y A;  3ON1 A;  1W57 A;  3KJJ A;  1UUC A;  1N13 A;  2UYN A;  3HKE B;  4X1I B;  5IJ9 A;  1CGI I;  5C8Y B;  3LWR C;  3CCJ F;  5EAZ A;  1KQS F;  5J8F A;  4BVT A;  3WPX A;  4C4W C;  1JY8 A;  3CPW F;  1W3E X;  1ULK A;  3UFF A;  2QQE A;  2ODD A;  3HTN A;  5E3Q A;  2PMP A;  5GIP C;  2NU1 I;  2V1C C;  1NJI H;  2QTP A;  2ORV A;  1J7H A;  4I50 A;  1R0R I;  1WGC A;  5CCL A;  4WBN B;  3JAM M;  2N1A B;  4TV9 A;  3HKC A;  3V4D A;  3UEJ A;  3HH2 C;  1VQ6 F;  2LUY A;  3UGI A;  3N4Y A;  1FNK A;  5ITZ A;  2CHS A;  2JNB A;  1H48 A;  2Q1X A;  1H0Z A;  2HVY D;  3VTI C;  5CA1 A;  4ZHV A;  1W40 A;  1Y1C A;  3OXL A;  1PJU A;  4O2A A;  4ERH A;  4ZI7 B;  1GO0 A;  3QTL D;  3TO6 A;  3VDU A;  3RYF B;  2CVL A;  2I6D A;  3CXL A;  3JAL B;  1PTR A;  3HAX D;  2LCA A;  4ZOL B;  1VK3 A;  4LNU A;  4KWE A;  1TBO A;  5IJ0 A;  4U3J B;  3T80 A;  3RYH A;  4X3L A;  5GON A;  3UEY A;  5JCO A;  4YJ2 A;  1W58 1;  3TD5 A;  3LWV C;  1DS2 I;  3QHD A;  1VQV A;  3HKB B;  3LWO C;  3KY9 A;  5LXT A;  3VYS C;  2QEX F;  5HY2 A;  1YJN F;  1K9M H;  2VAM A;  2LEO A;  2PQ8 A;  1DBF A;  4BW0 B;  2UYK A;  2KGW A;  5EX0 A;  2ZOV A;  5CB4 A;  3K0T A;  2CWJ A;  3JAW B;  3JAS B;  3OXG A;  3VOA A;  1VQ8 F;  1Q81 H;  1ODE A;  1P9G A;  3N2K A;  4EB6 A;  4O4L A;  3Q8H A;  4I55 B;  5EO3 A;  2OZB A;  3QWP A;  2R75 1;  4L9M A;  1YJ9 F;  1LR7 A;  3E22 A;  2XRC A;  3SGQ I;  2CSL A;  1CK2 A;  4O4J A;  3HKD A;  5EWR A;  2HS0 A;  1YJW F;  3CPQ A;  4C8I A;  3R0P A;  3K2X A;  3VIU A;  2UYP A;  4WP4 A;  5JCO C;  2K1S A;  3HWU A;  1ULN A;  5JQG A;  1RLU A;  3MBM A;  5BMV B;  4F6R B;  2SGF I;  1RQ7 A;  2QQD A;  1HEV A;  5EIB C;  5LOV A;  1PCE A;  5HP8 A;  5HXZ A;  2I6R A;  4BT2 A;  2JXD A;  4C82 A;  2QPO A;  1PXW A;  3M1X A;  2X3T A;  1W41 A;  3FBA A;  3ELC A;  3CCV F;  5HY4 A;  5KMG B;  5CA0 A;  5EX3 A;  5J2U A;  1W42 A;  4TV8 A;  5KX5 A;  2L26 A;  2KG4 A;  2VXY A;  1R79 A;  2J87 A;  5DAE A;  3FC3 A;  2DT4 A;  4A24 A;  1MJA A;  3SGB I;  5EIB D;  3JAT B;  1TOT A;  1ONI A;  3S0Y A;  2AMT A;  2W8B C;  1XBI A;  3IEW A;  1SGN I;  1TBR R;  2QQ0 A;  4O4I B;  2WAL A;  1XV2 A;  3I3F A;  3JVH A;  1UHA A;  4IIJ B;  1QU9 A;  2HS3 A;  3WGK A;  1K7U A;  4O4H A;  3JAK A;  1HPT A;  3I7T A;  2Z1T A;  2CZW A;  4I4T B;  3RYC A;  3R5A A;  2P6Y A;  1H47 A;  3C9R A;  4X20 B;  2MQE A;  2YUU A;  3TO7 A;  2HRY A;  1RQ2 A;  3F0E A;  4G4Y A;  3TJQ A;  5EZY B;  3CD6 F;  4DNC A;  2B33 A;  3KE1 A;  3ZP7 A;  2RHO A;  1V1H A;  2OZU A;  2RHH A;  2OU2 A;  1IV1 A;  2HX0 A;  4FFB B;  4PWT A;  3GHZ A;  1TVK A;  5GIN C;  2IAF A;  2CWG A;  1TUB A;  4ZHQ A;  1BMO A;  9WGA A;  3P10 A;  1YIJ F;  1W5E A;  5LYJ A;  4JCV E;  2YQP A;  1WKX A;  3IKE A;  2DYY A;  1X74 A;  5JH7 A;  1SGP I;  3CCE F;  1HDL A;  5GIO C;  2DIP A;  2AIZ P;  4X1Y A;  2ZF8 A;  1Q7Y H;  5HP7 A;  3CC2 F;  2J9R A;  1SGE I;  4EI7 A;  2KTU A;  1YTP A;  2N17 A;  1R1M A;  2NMU A;  3S06 A;  2IG8 A;  2N48 A;  1S20 A;  1TGS I;  3OXF A;  3E59 A;  1KC8 H;  3QUW A;  3CCL F;  4FKD A;  3CCU F;  1PF5 A;  1Z2I A;  5FNV A;  2CJS C;  2SGP I;  2Y0M A;  3RYF A;  4B62 A;  3JAL A;  4DXD A;  2JYY A;  3S02 A;  1QD9 A;  3WGN A;  4DRX B;  3LWQ C;  2BUS A;  1XHO A;  4G4W A;  1VQP F;  1ZWZ A;  1IV3 A;  3V7Q A;  1TBN A;  1FFX A;  3TOB A;  2QQC A;  3U0O A;  5LP6 A;  3FSX A;  4EI9 A;  5IJ9 B;  2KMQ A;  2UYN B;  1SGY I;  1SGR I;  5MN5 A;  4B46 A;  2KMR A;  1VHA A;  3CC7 F;  2UZH A;  2H6L A;  3B6N A;  3V3T A;  4TUY A;  2YYE A;  3JAW A;  2LBW A;  2GKV A;  1CSO I;  3E20 B;  3FPI A;  3GYQ A;  1Z7K B;  1T0K B;  3I55 F;  1CT2 I;  5MN4 A;  3RU0 A;  2RHJ A;  2H8C A;  4I55 A;  4IHJ A;  4I50 B;  1MT1 A;  2GVI A;  3VOB A;  2CWF A;  1SZQ A;  3HKC B;  4TV9 B;  3MQW A;  2HP3 A;  2BO1 A;  5ITZ B;  3IEQ A;  3MCQ A;  3J80 M;  1YQN A;  3DDN A;  1M1K H;  4BY9 D;  5LP6 C;  1CT4 I;  3I56 F;  5CA1 B;  1OVO A;  1UFY A;  3D00 A;  3D54 A;  4O2A B;  4F6R A;  5BMV A;  1IY5 A;  4R40 B;  3VYU C;  3CCQ F;  3FD6 A;  3VI6 A;  3UGL A;  2N71 A;  4AML A;  1JFF A;  5HQ8 A;  4HNA A;  1VQN F;  3ESJ A;  3M4S A;  1P9Z A;  4O2B B;  5J8C A;  3NVK E;  1QVF F;  4LNU B;  4C8G A;  4RHA A;  1TIH A;  5IJ0 B;  1E7K A;  1OMT A;  2FC3 A;  4ZK7 A;  4YJ2 B;  2JA1 A;  1UVF A;  3L7Q A;  3G6E F;  2KMP A;  4BVS A;  2HRU A;  1GO1 A;  2G9I A;  3JAR A;  4B5C A;  5CB4 B;  1DT9 A;  2HP0 B;  2LB7 A;  4E1P A;  5LA6 A;  4GI3 C;  4B6D A;  2UYJ A;  5HI7 A;  2YXZ A;  1YIT F;  2VGN A;  3F0F A;  3OON A;  4EB6 B;  3PDN A;  3N4Z A;  5JVD B;  3VDP A;  4O4L B;  2PHN A;  3UT5 A;  1X7P A;  3S0H A;  3TOA A;  1X25 A;  3CMA F;  2HS4 A;  4G4Z A;  1NMU B;  4YJ3 A;  3UGD A;  3GOX A;  4O4J B;  3HKD B;  4TZZ A;  3RYI B;  4UXH A;  4G88 A;  1AN1 I;  4X1K A;  2CW4 A;  3NK7 A;  5JQG B;  5IT9 M;  2LBX A;  3B4V C;  4UXJ A;  1Z5V A;  1U40 A;  3C9U A;  1SA0 A;  3FFM A;  2M5X A;  5LOV B;  4SGB I;  2BTQ B;  1U43 A;  2V53 A;  3IMP A;  4MPI A;  3OBW A;  1XBT A;  3SIU A;  3R5D A;  2L8E A;  3MEK A;  1CHO I;  3CYP B;  4G4V A;  3NMU C;  3WGL A;  3E1Y A;  1FSZ A;  5HXU A;  4BT6 A;  4RQO A;  1W5F A;  5MN6 A;  1U3P A;  2ALE A;  3N2G B;  1UI9 A;  3WJR A;  1YGY A;  5CA0 B;  1PTQ A;  2ARP F;  1KNJ A;  1WTJ A;  2JZM A;  1OFU A;  2RHL A;  4NQ3 A;  4TV8 B;  5KX5 B;  2ENZ A;  2NU4 I;  4X1I A;  3HKE A;  1N8R H;  2QA4 F;  3VE5 A;  3AGK A;  5C8Y A;  1W5A A;  3WJP A;  2NU2 I;  3CYQ A;  3FSY A;  2KTV A;  4BT3 A;  4ZHW A;  2OVO A;  1IW4 A;  2BTO A;  2W0T A;  1TUS A;  2UZ3 A;  1Q8R A;  2SGE I;  1CE3 A;  1V1I A;  1K73 H;  2EWC A;  3NVI B;  3RA6 A;  1JN1 A;  4E6E A;  2OTJ F;  4O4H B;  4C8E A;  3VO8 A;  2ORW A;  3QTY A;  3JAK B;  3R5C A;  3CG6 A;  1IY6 A;  3RYC B;  1DS3 I;  2B8T A;  1RA4 A;  5A2Q M;  3G4S F;  4WBN A;  4ZHY B;  2E73 A;  2N52 A;  2CHT A;  4U39 A;  5J2T B;  3P4E A;  2SGQ I;  5IYZ B;  3V7E A;  1HJA I;  3VMF B;  5EYP B;  2DKV A;  2L7X A;  4UXI A;  3WGJ A;  1W4R A;  2WGC A;  2A20 A;  2H8E A;  2Z1F A;  4OVO A;  4DRX A;  1YU6 C;  1VQO F;  1S72 F;  2ROW A;  4ZI7 A;  1K7V A;  5E3P A;  2VAW A;  3CCM F;  1FYB A;  1TUB B;  4ZHQ B;  5HY0 A;  1U5K A;  5LYJ B;  1YHQ F;  1U3L A;  4ZOL A;  1OMU A;  2OHW A;  4U3J A;  2OD1 A;  2ZVY A;  2F9Z C;  5JH7 B;  3ZP4 A;  4HGU A;  5FUW A;  4EI8 A;  3CB2 A;  5DCV A;  3HKB A;  5EB0 A;  1UVG A;  3M84 A;  4X1Y B;  3S0W A;  2ENN A;  2ELI A;  1VQL F;  3J7A R;  3O85 A;  4NUT A;  1VQ4 F;  1KD1 H;  2LBT A;  3MDO A;  1M90 H;  3K12 A;  1FNJ A;  3JAS A;  3LFO A;  1IPA A;  5FUX A;  3CXC F;  1W3S A;  3F0G A;  3K14 A;  2NU0 I;  3P0Z A;  3CCR F;  3NK6 A;  1Q9B A;  3E2I A;  3ZO8 A;  4BT7 A;  2X52 A;  2RIJ A;  2RB9 A;  3WJQ A;  2Z1U A;  2ZAU A;  3DC2 A;  3IKF A;  1OYV I;  2VGM A;  5FNV B;  2GKT I;  3CC4 F;  3OBY A;  1KBE A;  1KBF A;  4O2B A;  2E5R A;  4B45 A;  1TUR A;  3WPW A;  1CT0 I;  3EOR A;  1FFX B;  1OAP A;  3S03 A;  5LP6 B;  4NWO B;  5HWE A;  1W5B A;  5EB1 B;  2HQS C;  1W2B F;  4BVR A;  3OL0 A;  3OVO A;  1MJB A;  2KCX A;  3VCZ A;  2ZVZ A;  1Y1B A;  1W55 A;  3RYH B;  1X4S A;  2HP0 A;  3SEK C;  4X3M A;  5GON B;  4TUY B;  3RA5 A;  3PAF A;  3F0D A;  3J81 M;  1JJ2 F;  1TBQ R;  3WGM A;  5LXT B;  3CCS F;  5GAN K;  5CCM A;  1IV4 A;  5KMG A;  4G4X A;  5JVD A;  2ERW A;  1VQ5 F;  4IHJ B;  3MCA B;  1NUB A;  3C8L A;  1VQ7 F;  1GX1 A;  1IV2 A;  1Y8F A;  1SGD I;  5FUY A;  7WGA A;  2UVO A;  1VQM F;  3JAT A;  1Q86 H;  3C9T A;  2WVJ A;  3N2K B;  3RYI A;  1FAR A;  3PLA C;  1CN7 A;  1FY7 A;  2Q1Y A;  4C81 A;  1KMA A;  2RC4 A;  2P6A C;  4O4I A;  1LR8 A;  3E22 B;  3FD5 A;  4IIJ A;  3JCM M;  3UOE A;  2GKR I;  1QVG F;  1BUS A;  3OW2 F;  4HNA B;  1CGJ I;  1JFF B;  4I4T A;  2K9H A;  3LYB A;  2OTL F;  3TD4 A;  3KIZ A;  1Q82 H;  4BVQ A;  5JHW C;  1VH8 A;  5AVM A;  2ZOD A;  3HJW C;  4X20 A;  1MJ9 A;  1M8C A;  1XX6 A;  2DB6 A;  2WCY A;  4E1R A;  5EZY A;  3N2G A;  4BT5 A;  1WGT A;  1XRG A;  1X7O A;  4FFB A;  1NQ3 A;  3LME A;  2F3C I;  1K8A H;  3WXM B;  1Z5W A;  3JAR B;  4LCK A;  1H7M A;  3IR9 A;  1NXU A;  5LA6 B;  5B8F A;  3GTZ A;  2VAP A;  3R5B A;  3ZOP A;  3F6M A;  1X52 A;  3BJI A;  4BT4 A;  3LDT A;  1COM A;  1T0A A;  3UT5 B;  1LR9 A;  5J2U B;  5FLX M;  2NU3 I;  1M8B A;  5G4U C;  5E3R A;  2Z01 A;  3KJK A;  1PPF I;  1VQ9 F;  3KHN A;  2FGY A;  2GZL A;  4YJ3 B;  3VYT C;  2CWH A;  2JW6 A;  3ERN A;  3QAH A; 
#chains in the Genus database with same CATH homology
 2SGD I;  5GAP K;  3G71 F;  5FJ4 C;  1XA6 A;  2FNF X;  1FAQ A;  1RFH A;  1RLG A;  1VDD A;  2AIF A;  1SGQ I;  1SDS A;  2VRW B;  5G4V C;  1YI2 F;  2KMO A;  3LWP C;  1GZ0 A;  3SIV A;  2V1C A;  2QI2 A;  4XCQ A;  2B0U C;  3CME F;  2GLZ A;  1VQK F;  5HY1 A;  5FUV A;  3ON1 A;  1UUC A;  1N13 A;  3CCJ F;  1CGI I;  3LWR C;  1KQS F;  4BVT A;  4C4W C;  3CPW F;  1W3E X;  3UFF A;  2QQE A;  2ODD A;  5GIP C;  2NU1 I;  2V1C C;  1NJI H;  2ORV A;  1R0R I;  5CCL A;  3JAM M;  2N1A B;  3UEJ A;  3HH2 C;  1VQ6 F;  2LUY A;  3UGI A;  3N4Y A;  2JNB A;  1H0Z A;  2HVY D;  1W40 A;  1Y1C A;  3OXL A;  1PJU A;  1GO0 A;  3QTL D;  3VDU A;  2I6D A;  3CXL A;  1PTR A;  3HAX D;  1TBO A;  4X3L A;  3UEY A;  3LWV C;  1DS2 I;  3LWO C;  2QEX F;  3KY9 A;  1K9M H;  1YJN F;  5HY2 A;  2LEO A;  4BW0 B;  5EX0 A;  3OXG A;  1VQ8 F;  1Q81 H;  5EO3 A;  2OZB A;  3QWP A;  4L9M A;  1YJ9 F;  1LR7 A;  2XRC A;  3SGQ I;  1CK2 A;  5EWR A;  1YJW F;  3CPQ A;  2SGF I;  2QQD A;  1PCE A;  5HXZ A;  2JXD A;  2QPO A;  1PXW A;  1W41 A;  3CCV F;  5HY4 A;  5EX3 A;  1W42 A;  2KG4 A;  1R79 A;  2J87 A;  5DAE A;  3FC3 A;  4A24 A;  3SGB I;  1TOT A;  1XBI A;  1SGN I;  1TBR R;  2QQ0 A;  2WAL A;  1HPT A;  2CZW A;  2YUU A;  3TJQ A;  3CD6 F;  1V1H A;  5GIN C;  1BMO A;  1YIJ F;  4JCV E;  2YQP A;  1X74 A;  1SGP I;  3CCE F;  1HDL A;  5GIO C;  2DIP A;  1Q7Y H;  3CC2 F;  2J9R A;  1SGE I;  4EI7 A;  2KTU A;  1YTP A;  2N17 A;  1TGS I;  3OXF A;  3E59 A;  1KC8 H;  3CCL F;  4FKD A;  3CCU F;  2CJS C;  2SGP I;  2JYY A;  1VQP F;  3LWQ C;  2BUS A;  1ZWZ A;  3V7Q A;  1TBN A;  2QQC A;  4EI9 A;  2KMQ A;  1SGY I;  1SGR I;  2KMR A;  3CC7 F;  3V3T A;  2LBW A;  2GKV A;  1CSO I;  3E20 B;  3GYQ A;  1Z7K B;  1T0K B;  3I55 F;  1CT2 I;  3RU0 A;  1MT1 A;  2GVI A;  2BO1 A;  3J80 M;  1M1K H;  4BY9 D;  3I56 F;  1CT4 I;  1OVO A;  3D00 A;  1IY5 A;  3CCQ F;  3VI6 A;  3UGL A;  2N71 A;  1VQN F;  5HQ8 A;  3NVK E;  1QVF F;  1TIH A;  1E7K A;  1OMT A;  2FC3 A;  2JA1 A;  1UVF A;  3G6E F;  2KMP A;  4BVS A;  1GO1 A;  1DT9 A;  4E1P A;  4GI3 C;  4B6D A;  5HI7 A;  1YIT F;  2VGN A;  3PDN A;  3N4Z A;  3VDP A;  1X7P A;  3CMA F;  1NMU B;  3UGD A;  3GOX A;  4TZZ A;  4UXH A;  1AN1 I;  3NK7 A;  5IT9 M;  2LBX A;  3B4V C;  4UXJ A;  3FFM A;  2M5X A;  4SGB I;  2V53 A;  3OBW A;  1XBT A;  3SIU A;  2L8E A;  3MEK A;  1CHO I;  3NMU C;  3E1Y A;  5HXU A;  2ALE A;  1PTQ A;  2ARP F;  2JZM A;  4NQ3 A;  2ENZ A;  2NU4 I;  1N8R H;  2QA4 F;  3VE5 A;  3AGK A;  2NU2 I;  2KTV A;  2OVO A;  1IW4 A;  2W0T A;  1TUS A;  2UZ3 A;  2SGE I;  1CE3 A;  1V1I A;  1K73 H;  3NVI B;  3RA6 A;  2OTJ F;  2ORW A;  3CG6 A;  1IY6 A;  1DS3 I;  2B8T A;  1RA4 A;  5A2Q M;  3G4S F;  2E73 A;  2N52 A;  2SGQ I;  3V7E A;  1HJA I;  3VMF B;  2L7X A;  4UXI A;  1W4R A;  2A20 A;  4OVO A;  1YU6 C;  1VQO F;  1S72 F;  2ROW A;  3CCM F;  1FYB A;  5HY0 A;  1U5K A;  1YHQ F;  1OMU A;  2OHW A;  2OD1 A;  2F9Z C;  5DCV A;  4HGU A;  5FUW A;  4EI8 A;  1UVG A;  2ENN A;  2ELI A;  1VQL F;  3J7A R;  3O85 A;  4NUT A;  1VQ4 F;  1KD1 H;  1M90 H;  3LFO A;  1IPA A;  5FUX A;  3CXC F;  1W3S A;  2NU0 I;  3CCR F;  3NK6 A;  3E2I A;  1OYV I;  2VGM A;  2GKT I;  3CC4 F;  3OBY A;  1KBE A;  1KBF A;  2E5R A;  1TUR A;  1CT0 I;  5HWE A;  1W2B F;  4BVR A;  3OL0 A;  3OVO A;  2KCX A;  1Y1B A;  1X4S A;  3RA5 A;  3SEK C;  4X3M A;  3PAF A;  3J81 M;  1JJ2 F;  1TBQ R;  3CCS F;  5GAN K;  5CCM A;  2ERW A;  1VQ5 F;  3MCA B;  1NUB A;  1VQ7 F;  1Y8F A;  1SGD I;  5FUY A;  1VQM F;  1Q86 H;  2WVJ A;  1FAR A;  3PLA C;  1CN7 A;  1KMA A;  2P6A C;  1LR8 A;  3JCM M;  2GKR I;  1QVG F;  1BUS A;  3OW2 F;  1CGJ I;  2K9H A;  2OTL F;  1Q82 H;  4BVQ A;  5JHW C;  3HJW C;  1M8C A;  1XX6 A;  2DB6 A;  2WCY A;  4E1R A;  1X7O A;  2F3C I;  1K8A H;  3WXM B;  4LCK A;  1H7M A;  3IR9 A;  1X52 A;  3BJI A;  5FLX M;  1LR9 A;  2NU3 I;  1M8B A;  5G4U C;  1PPF I;  1VQ9 F;  2FGY A;  2JW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...