3D00A

Crystal structure of a tungsten formylmethanofuran dehydrogenase subunit e (fmde)-like protein (syn_00638) from syntrophus aciditrophicus at 1.90 a resolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
190
structure length
184
Chain Sequence
MTARNILSYSYEEYVEKITAFHGYPAPGVLIGGFMVDLAVKNLPEGILYDAICETRTCLPDAVQLLTPCTFGNGWLTVLPMGLFAVSLYDKFTGEGVRVFLDVEKMGPWQEIRNWFLKLKSERLFKEIREAGPDILELRNVKLKPGFLEKKHKGKIVLCPQCREAYPAQDGELCLSCQGGSPYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of three members of Pfam PF02663 (FmdE) implicated in microbial methanogenesis reveal a conserved alpha+beta core domain and an auxiliary C-terminal treble-clef zinc finger.
pubmed doi rcsb
source organism Syntrophus aciditrophicus
molecule tags Metal binding protein
molecule keywords Tungsten formylmethanofuran dehydrogenase subunit E
total genus 46
structure length 184
sequence length 190
ec nomenclature
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02663 FmdE FmdE, Molybdenum formylmethanofuran dehydrogenase operon
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.80 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3d00A02
3.30.1330.130 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3d00A01
1VDDA 3VDPA 3VDUA 3D00A 2GLZA 3VE5A 2V1CA
chains in the Genus database with same CATH superfamily
1TVKA 2Z1EA 2HQSC 3QUWA 4AMLA 2ENNA 3D00A 1QVGF 3JAKB 5J2UA 3OBYA 2W0TA 4O2AA 1U3PA 3CC7F 4O4LB 1YIJF 2CVLA 5LP6C 1K8AH 1TBQR 2CWHA 2KGWA 2SGFI 3TOAA 1QU9A 2ERWA 2N48A 2YUUA 5GONB 3VIUA 1MJAA 3CCVF 2ROWA 5G4VC 5ITZA 1KNKA 1W55A 3F0DA 3RYFB 2G9IA 3WJPA 2OTLF 4I50B 1DBFA 1XBTA 1VHAA 2CWJA 1CE3A 2UZ3A 3IEWA 1KBFA 3T80A 3IKEA 1Z2IA 1XRGA 2UYKA 3ZP7A 1SA0A 4NUTA 3PAFA 2LB7A 3NVIB 3HJWC 2KG4A 5A2QM 2ENZA 4RQOA 5GAPK 1OFUA 4X1KB 4FFBA 5IJ9A 3UGIA 1IPAA 4X1YA 3J7AR 1DS3I 1W42A 2UYJA 1IV4A 1FFXA 1H47A 2XRCA 5KMGA 3VOAA 3S03A 1FNJA 2LUYA 1U3LA 4G4YA 4B5CA 1PTQA 3M4SA 3GYQA 1VQ4F 2LBWA 5IYZB 3RYIA 3P4EA 1CLIA 4YJ3A 4ZHVA 1VQ6F 2N71A 2K1SA 4ZI7A 2RHHA 1V1HA 2JZMA 1W40A 1FNKA 3OONA 4IIJB 5CB4B 2LEOA 1W59A 3JASA 3HKEA 2DIPA 4GI3C 2LCAA 2RC4A 5FJ4C 2MQEA 1ULMA 3CCEF 5JH7B 2QI2A 2HX0A 3UEYA 2OZUA 1S20A 1U5KA 1RA4A 1Z5WA 1FARA 3PDNA 2H6LA 4EI7A 3LWOC 2OU2A 5LP6B 4G4ZA 2H8EA 4BT6A 1W4RA 2BTUA 4HNAA 5MN5A 3S0YA 2VXYA 1JD1A 2QQEA 4YJ3B 2NU0I 5JHWC 3VYTC 2M5XA 1HEVA 2JNBA 1VQKF 3HKCB 5J8CA 1N8RH 3CCLF 2PHNA 2SGQI 1CT4I 1P9GA 1WGTA 4IIJA 3WPXA 5G4UC 3E1YA 2IAFA 3UT5B 4X1IB 3C8LA 2QPOA 1JJ2F 2KMRA 3F0EA 3IEQA 3VYUC 4MPIA 1UVFA 3HKDA 1VQLF 3GOXA 3KY9A 1P9ZA 3FFMA 3WJRA 2ZVZA 2H8CA 2Z1FA 3P0ZA 5HY4A 1QVFF 1PF5A 3FSYA 3UEJA 4BVTA 3TO9A 1Q7YH 1TVKB 5LOVA 4HGUA 2NU1I 5HP7A 3CCSF 4X1KA 1JFFB 2L26A 2HRYA 3JVHA 2OHWA 4TUYA 4ZI7B 5IT9M 1X25A 2K9HA 5EYPB 3RYIB 2ZVYA 3WGLA 3TO6A 4EB6A 1BUSA 1Z7KB 4U39A 3GTZA 2ZODA 3OXFA 5GONA 4O4JB 3G71F 1VQNF 2PQ8A 1OAPA 1PPFI 1JY8A 1RLUA 4ERHA 3IR9A 4O2AB 3CMAF 1CN7A 1CGJI 2ORVA 1JFFA 5JCOA 1X7OA 5LYJA 5JVDB 2J9RA 1VQMF 4X1IA 3N2KA 2ZF8A 1W5AA 2YXZA 3CPWF 2RB9A 1Q9BA 3S02A 3ZOPA 1PXWA 4XCQA 1R1MA 2AIZP 3R5DA 2BUSA 1YI2F 1H48A 3TOBA 3UGDA 4O4LA 1VQ9F 5JQGA 5HY1A 1PJUA 4F6RA 2RHLA 5E3RA 2RHOA 3KJKA 1UVGA 4IHJA 5FNVB 1IY6A 3RA5A 3I55F 3BYQA 4BY9D 2SGPI 5CA1B 2DKVA 5FUYA 2R751 5CA0B 2N17A 2I6RA 1VK3A 4TV9A 2ALEA 1M1KH 2ZOVA 3M84A 1YJWF 1WKXA 1VH8A 2VGNA 4RHAA 1W3EX 2ELIA 1LR7A 1R0RI 1Y1CA 2UVOA 4I55A 1VQ8F 1V1IA 2QQ0A 1TBRR 2B33A 3BJIA 5IYZA 4JCVE 2BO1A 3TJQA 3UFFA 1UUCA 3UOEA 2HP0B 2Z1TA 5EAZA 2AMTA 1VQVA 3LYBA 1YJ9F 3JALA 4C8IA 5LP6A 3VE5A 1X74A 4DNCA 1VQPF 2WGCA 1CT2I 1GZ0A 4DRXB 4E1RA 1T0KB 2V9YA 5J2TA 2UYNB 1W3SA 3F0FA 1RFHA 2E5RA 2GKVA 4ZHQA 1MT1A 1W5EA 2IG8A 5BMVB 1NQ3A 3CB2A 3CYQA 2Y0MA 9WGAA 5C8YB 1SGDI 1TUSA 3F0GA 3MCAB 5LXTB 2OTJF 1LR9A 3MCQA 2X3TA 2UYNA 3VOBA 2FGYA 1H7MA 1TUBB 1XHOA 3RE3A 1ULNA 2VGMA 2WCYA 4OVOA 2N52A 1FSZA 2B8TA 3P10A 1NJIH 3V3TA 2V1CA 2WALA 1KBEA 1YTPA 2WVJA 1SA0B 4ZOLB 5EIBC 5J2UB 4TUYB 4G4VA 5EO3A 3I56F 2CWFA 4KWEA 3I3FA 5LOVB 1JN1A 5HXUA 4TZZA 3R5BA 2HVYD 4BVRA 1VQOF 1T0AA 3N4ZA 1PCEA 1GO0A 3NVKE 1X7PA 4EI9A 1K73H 4SGBI 3WXMB 5LXTA 1AN1I 1Q81H 1W5FA 3ERNA 1W581 1QAHA 1RQ2A 3SGQI 1H0ZA 2KMOA 2I6DA 2YQPA 3LWQC 3LFOA 3G4SF 1SDSA 4I50A 4I4TB 5EX3A 2RIJA 5DAEA 3LDTA 5ITZB 1IY5A 2J87A 2LBTA 1CT0I 3HKBB 2QQDA 1ZWZA 5EZYB 3SGBI 2SGDI 3CXLA 3JARB 5LA6B 3RYHB 1YHQF 3CXCF 4O2BB 4C8EA 5KX5A 3NMUC 3QAHA 1UFYA 2EWCA 3MBMA 1SGRI 2SGEI 1SGYI 2CHTA 2Q1YA 3K2XA 3JAMM 2IQQA 1FAQA 3KE1A 4I55B 4WP4A 1PTRA 3RYCA 1W41A 2DB6A 3K14A 2QQCA 4WBNB 4X20B 3CCUF 1E7KA 3HKEB 3HKBA 4O4JA 1K9MH 3HAXD 3KJJA 5CA1A 3I7TA 4BT4A 5AVMA 3CD6F 2L7XA 3J80M 2OTMA 2JW6A 2BTOA 3WGMA 2A20A 3V7EA 2Q1XA 5EWRA 2ARPF 1HJAI 5E3QA 3VI6A 2VRWB 3CC4F 3HTNA 1WTJA 3LWPC 4C4WC 1YU6C 2JYYA 1YITF 2KTUA 3ON1A 3ZP4A 4I4TA 4U3JA 4O4IA 3JCMM 3O85A 4ZHQB 3TD5A 2FC3A 1CGII 2HS0A 3LMEA 2NU2I 5EYPA 3DDNA 4O4HA 1R79A 4BW0B 4NWOB 3LWRC 1KC8H 1SGQI 1XX6A 2NU3I 4BT5A 4FFBB 5HI7A 5EZYA 1CHOI 3TD4A 4DRXA 5IJ9B 1J7HA 2KTVA 4BT7A 1VQ5F 2PMPA 3JAWB 1K7TA 4B6DA 5J8FA 3QWPA 4B45A 7WGAA 1HPTA 3KIZA 3K0TA 3K12A 3C9UA 3WPWA 2DT4A 1NXUA 1OMUA 5EIBD 2CWGA 1COMA 1W5BA 5GINC 2Z01A 1M90H 1ODEA 3IKFA 3JAWA 3ELCA 5IJ0A 1KMAA 3JAKA 3Q8HA 4DXDA 2ZAUA 5DCVA 3R5CA 3V4DA 4E6EA 2YYEA 2GKRI 3C9TA 2W8BC 5E3PA 1X52A 3AGKA 2Z1UA 3FPIA 4O4HB 3RA6A 3NK6A 2OVOA 3WGKA 3PLAC 5EB1B 2X52A 4ZHWA 1K7VA 4O4IB 2UYPA 2JA1A 1CK2A 3CPQA 3LWVC 3HKDB 1S72F 1VQ7F 1UI9A 1YJNF 2OD1A 1DT9A 2V1CC 2LBXA 4UXHA 2ODDA 2GLZA 2QA4F 4TV9B 1SGEI 2L8EA 1FYBA 3HH2C 2CW4A 4LNUB 3HKCA 5EX0A 4G4WA 4ZHYB 2OZBA 3VCZA 3E59A 5BMVA 5MN6A 3CCQF 2ORWA 1IW4A 2BTQB 4O2BA 3OW2F 3CC2F 3MQWA 3OBWA 4UXIA 1IV1A 3U0OA 3D54A 3JARA 5LA6A 5GIPC 2QTPA 1IV3A 1M8BA 2FNFX 3JALB 1TGSI 2P6AC 3OXLA 3E2IA 4HNAB 1W57A 1BMOA 3C9RA 4M8IA 3R5AA 5JCOC 3RYCB 4X3LA 5HP8A 3N2GB 2N1AB 4X3MA 3CG6A 1RLGA 2JXDA 1NUBA 5JQGB 5LYJB 4LNUA 1NMUB 1YQNA 3N2GA 2E73A 1K7UA 5GIOC 3G6EF 2NMUA 1SGPI 4X20A 2P6YA 1SGNI 4C82A 2KCXA 1MJ9A 5KMGB 3RYFA 4X1YB 3V7QA 1RQ7A 4IHJB 5FNVA 3FBAA 1Q8RA 1OYVI 1W2BF 3B6NA 5KX5B 3B4VC 3JATB 5FUVA 4G88A 5FLXM 5FUWA 2R6R1 1TBOA 1XV2A 3TD3A 3NK7A 2GZLA 3VYSC 5GANK 2GIVA 1KD1H 3SIUA 2UZHA 2QEXF 3S06A 3IMPA 5JVDA 1KQSF 1GX1A 1Z5VA 5FUXA 3FSXA 4E1PA 3MEKA 2VAPA 3VDUA 4BT2A 1WGCA 3WGJA 3OXGA 5CCMA 3ESJA 1N13A 4ZK7A 1KNJA 5HXZA 3OVOA 3GHZA 2F9ZC 2HS3A 5EB0A 1GO1A 1YGYA 3MDOA 2GKTI 1U43A 4PWTA 4B62A 3WJQA 1DS2I 4EB6B 3CCJF 3WGNA 4ZOLA 1MJBA 2HRUA 4UXJA 4U3JB 2CHSA 5JH7A 2CSLA 3JATA 4YJ2B 3TO7A 3QTLD 1U40A 1Y1BA 3D01A 1Y8FA 1TOTA 1VDDA 5HQ8A 3HWUA 4EI8A 3VDPA 1TUBA 3J81M 5HWEA 1Q86H 2RHJA 5IJ0B 2KMQA 3E20B 3FC3A 3CCMF 2AIFA 1CSOI 1UHAA 4F6RB 1TURA 2HP3A 3CYPB 3OL0A 3RU0A 4A24A 3KHNA 5J2TB 1OMTA 3L7QA 3N4YA 4TV8A 1ULKA 5CCLA 3UGLA 3UT5A 4C8GA 3EORA 1FY7A 1XA6A 5CA0A 1FFXB 4BVQA 3M1XA 1HDLA 1TBNA 5CB4A 3E22A 3R0PA 5C8YA 1XBIA 2F3CI 2CJSC 4NQ3A 3CMEF 2V53A 4C81A 4YJ2A 2DYYA 1QD9A 2B0UC 2VAMA 4BT3A 3QHDA 3S0HA 3CCRF 3E22B 4WBNA 2GVIA 3FD5A 1OVOA 4FKDA 2CZWA 3ZO8A 4G4XA 3VTIC 3SIVA 1Q82H 1LR8A 1X4SA 3N2KB 1SZQA 2HP0A 3F6MA 3DC2A 4TV8B 4LCKA 1TIHA 4BVSA 5HY2A 2NU4I 3FD6A 2VAWA 3VO8A 4L9MA 5MN4A 2KMPA 3SEKC 3C9SA 3RYHA 3QTYA 1ONIA 4B46A 5B8FA 3VMFB 4R40B 3S0WA 1M8CA 5HY0A 1IV2A 2HS4A 3JASB
chains in the Genus database with same CATH topology
2ENNA 3D00A 1QVGF 3OBYA 2W0TA 3CC7F 1YIJF 1K8AH 1TBQR 2SGFI 2ERWA 2YUUA 3CCVF 2ROWA 5G4VC 2OTLF 1XBTA 1CE3A 2UZ3A 1KBFA 4NUTA 3PAFA 3NVIB 3HJWC 2KG4A 5A2QM 2ENZA 5GAPK 3UGIA 1IPAA 3J7AR 1DS3I 1W42A 2XRCA 2LUYA 1PTQA 3GYQA 1VQ4F 2LBWA 1VQ6F 2N71A 1V1HA 2JZMA 1W40A 2LEOA 2DIPA 4GI3C 5FJ4C 3CCEF 2QI2A 3UEYA 1U5KA 1RA4A 4EI7A 1FARA 3PDNA 3LWOC 1W4RA 2QQEA 2NU0I 5JHWC 2M5XA 2JNBA 1VQKF 1N8RH 3CCLF 2SGQI 1CT4I 5G4UC 3E1YA 1JJ2F 2QPOA 2KMRA 1UVFA 1VQLF 3GOXA 3KY9A 3FFMA 5HY4A 1QVFF 3UEJA 4BVTA 1Q7YH 4HGUA 2NU1I 3CCSF 5IT9M 2OHWA 2K9HA 1BUSA 1Z7KB 3OXFA 3G71F 1VQNF 1PPFI 3IR9A 3CMAF 1CN7A 1CGJI 2ORVA 1X7OA 2J9RA 1VQMF 3CPWF 1PXWA 4XCQA 2BUSA 1YI2F 3UGDA 1VQ9F 5HY1A 1PJUA 1UVGA 1IY6A 3RA5A 3I55F 4BY9D 2SGPI 5FUYA 2N17A 2ALEA 1M1KH 1YJWF 2VGNA 1W3EX 2ELIA 1LR7A 1R0RI 1Y1CA 1VQ8F 1V1IA 2QQ0A 1TBRR 3BJIA 4JCVE 2BO1A 3TJQA 3UFFA 1UUCA 1YJ9F 3VE5A 1X74A 1VQPF 1CT2I 1GZ0A 4E1RA 1T0KB 1W3SA 1RFHA 2E5RA 2GKVA 1MT1A 1SGDI 1TUSA 3MCAB 2OTJF 1LR9A 2FGYA 1H7MA 2VGMA 2WCYA 4OVOA 2N52A 2B8TA 1NJIH 3V3TA 2V1CA 2WALA 1KBEA 1YTPA 2WVJA 5EO3A 3I56F 5HXUA 4TZZA 2HVYD 4BVRA 1VQOF 3N4ZA 1PCEA 1GO0A 3NVKE 1X7PA 4EI9A 1K73H 4SGBI 3WXMB 1AN1I 1Q81H 3SGQI 1H0ZA 2KMOA 2I6DA 2YQPA 3G4SF 3LFOA 3LWQC 1SDSA 5EX3A 5DAEA 1IY5A 2J87A 1CT0I 2QQDA 1ZWZA 3SGBI 2SGDI 3CXLA 1YHQF 3CXCF 3NMUC 1SGRI 2SGEI 1SGYI 1FAQA 1PTRA 1W41A 2DB6A 2QQCA 1E7KA 3CCUF 1K9MH 3HAXD 3CD6F 2L7XA 3J80M 3V7EA 2JW6A 2A20A 5EWRA 2ARPF 1HJAI 3VI6A 2VRWB 3CC4F 3LWPC 4C4WC 1YU6C 2JYYA 1YITF 2KTUA 3ON1A 3JCMM 3O85A 2FC3A 1CGII 4BW0B 2NU2I 1KC8H 1R79A 3LWRC 1SGQI 1XX6A 2NU3I 5HI7A 1CHOI 2KTVA 1VQ5F 4B6DA 3QWPA 1HPTA 1OMUA 5GINC 1M90H 1KMAA 5DCVA 2GKRI 3RA6A 1X52A 3AGKA 3NK6A 2OVOA 3PLAC 2JA1A 1CK2A 3CPQA 3LWVC 1S72F 1VQ7F 1YJNF 2OD1A 1DT9A 2V1CC 2LBXA 4UXHA 2ODDA 2GLZA 2QA4F 1SGEI 2L8EA 1FYBA 3HH2C 5EX0A 2OZBA 3E59A 3CCQF 2ORWA 1IW4A 3OW2F 3CC2F 3OBWA 4UXIA 5GIPC 1M8BA 2FNFX 1TGSI 2P6AC 3OXLA 3E2IA 1BMOA 4X3LA 2N1AB 4X3MA 3CG6A 1RLGA 2JXDA 1NUBA 1NMUB 2E73A 5GIOC 3G6EF 1SGPI 1SGNI 2KCXA 3V7QA 1OYVI 1W2BF 3B4VC 5FUVA 5FLXM 5FUWA 1TBOA 3NK7A 5GANK 1KD1H 3SIUA 2QEXF 1KQSF 5FUXA 4E1PA 3MEKA 3VDUA 3OXGA 5CCMA 1N13A 5HXZA 3OVOA 2F9ZC 1GO1A 2GKTI 1DS2I 3CCJF 4UXJA 3QTLD 4EI8A 1Y1BA 3JAMM 1Y8FA 1TOTA 1VDDA 5HQ8A 3VDPA 3J81M 5HWEA 1Q86H 2KMQA 3E20B 3FC3A 3CCMF 2AIFA 1CSOI 1TURA 3OL0A 3RU0A 4A24A 1OMTA 3N4YA 5CCLA 3UGLA 1XA6A 4BVQA 1HDLA 1TBNA 1XBIA 2F3CI 2CJSC 3CMEF 4NQ3A 2V53A 2B0UC 3CCRF 2GVIA 1OVOA 4FKDA 2CZWA 3SIVA 1Q82H 1LR8A 1X4SA 4LCKA 1TIHA 4BVSA 5HY2A 2NU4I 4L9MA 2KMPA 3SEKC 3VMFB 5HY0A 1M8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VDD A;  3VDP A;  3VDU A;  3D00 A;  2GLZ A;  3VE5 A;  2V1C A; 
#chains in the Genus database with same CATH topology
 1TVK A;  2Z1E A;  2HQS C;  3QUW A;  4AML A;  2ENN A;  3D00 A;  1QVG F;  3JAK B;  5J2U A;  3OBY A;  2W0T A;  4O2A A;  1U3P A;  3CC7 F;  4O4L B;  1YIJ F;  2CVL A;  5LP6 C;  1K8A H;  1TBQ R;  2CWH A;  2KGW A;  2SGF I;  3TOA A;  1QU9 A;  2ERW A;  2N48 A;  2YUU A;  5GON B;  3VIU A;  1MJA A;  3CCV F;  2ROW A;  5G4V C;  5ITZ A;  1KNK A;  1W55 A;  3F0D A;  3RYF B;  2G9I A;  3WJP A;  2OTL F;  4I50 B;  1DBF A;  1XBT A;  1VHA A;  2CWJ A;  1CE3 A;  2UZ3 A;  3IEW A;  1KBF A;  3T80 A;  3IKE A;  1Z2I A;  1XRG A;  2UYK A;  3ZP7 A;  1SA0 A;  4NUT A;  3PAF A;  2LB7 A;  3NVI B;  3HJW C;  2KG4 A;  5A2Q M;  2ENZ A;  4RQO A;  5GAP K;  1OFU A;  4X1K B;  4FFB A;  5IJ9 A;  3UGI A;  1IPA A;  4X1Y A;  3J7A R;  1DS3 I;  1W42 A;  2UYJ A;  1IV4 A;  1FFX A;  1H47 A;  2XRC A;  5KMG A;  3VOA A;  3S03 A;  1FNJ A;  2LUY A;  1U3L A;  4G4Y A;  4B5C A;  1PTQ A;  3M4S A;  3GYQ A;  1VQ4 F;  2LBW A;  5IYZ B;  3RYI A;  3P4E A;  1CLI A;  4YJ3 A;  4ZHV A;  1VQ6 F;  2N71 A;  2K1S A;  4ZI7 A;  2RHH A;  1V1H A;  2JZM A;  1W40 A;  1FNK A;  3OON A;  4IIJ B;  5CB4 B;  2LEO A;  1W59 A;  3JAS A;  3HKE A;  2DIP A;  4GI3 C;  2LCA A;  2RC4 A;  5FJ4 C;  2MQE A;  1ULM A;  3CCE F;  5JH7 B;  2QI2 A;  2HX0 A;  3UEY A;  2OZU A;  1S20 A;  1U5K A;  1RA4 A;  1Z5W A;  1FAR A;  3PDN A;  2H6L A;  4EI7 A;  3LWO C;  2OU2 A;  5LP6 B;  4G4Z A;  2H8E A;  4BT6 A;  1W4R A;  2BTU A;  4HNA A;  5MN5 A;  3S0Y A;  2VXY A;  1JD1 A;  2QQE A;  4YJ3 B;  2NU0 I;  5JHW C;  3VYT C;  2M5X A;  1HEV A;  2JNB A;  1VQK F;  3HKC B;  5J8C A;  1N8R H;  3CCL F;  2PHN A;  2SGQ I;  1CT4 I;  1P9G A;  1WGT A;  4IIJ A;  3WPX A;  5G4U C;  3E1Y A;  2IAF A;  3UT5 B;  4X1I B;  3C8L A;  2QPO A;  1JJ2 F;  2KMR A;  3F0E A;  3IEQ A;  3VYU C;  4MPI A;  1UVF A;  3HKD A;  1VQL F;  3GOX A;  3KY9 A;  1P9Z A;  3FFM A;  3WJR A;  2ZVZ A;  2H8C A;  2Z1F A;  3P0Z A;  5HY4 A;  1QVF F;  1PF5 A;  3FSY A;  3UEJ A;  4BVT A;  3TO9 A;  1Q7Y H;  1TVK B;  5LOV A;  4HGU A;  2NU1 I;  5HP7 A;  3CCS F;  4X1K A;  1JFF B;  2L26 A;  2HRY A;  3JVH A;  2OHW A;  4TUY A;  4ZI7 B;  5IT9 M;  1X25 A;  2K9H A;  5EYP B;  3RYI B;  2ZVY A;  3WGL A;  3TO6 A;  4EB6 A;  1BUS A;  1Z7K B;  4U39 A;  3GTZ A;  2ZOD A;  3OXF A;  5GON A;  4O4J B;  3G71 F;  1VQN F;  2PQ8 A;  1OAP A;  1PPF I;  1JY8 A;  1RLU A;  4ERH A;  3IR9 A;  4O2A B;  3CMA F;  1CN7 A;  1CGJ I;  2ORV A;  1JFF A;  5JCO A;  1X7O A;  5LYJ A;  5JVD B;  2J9R A;  1VQM F;  4X1I A;  3N2K A;  2ZF8 A;  1W5A A;  2YXZ A;  3CPW F;  2RB9 A;  1Q9B A;  3S02 A;  3ZOP A;  1PXW A;  4XCQ A;  1R1M A;  2AIZ P;  3R5D A;  2BUS A;  1YI2 F;  1H48 A;  3TOB A;  3UGD A;  4O4L A;  1VQ9 F;  5JQG A;  5HY1 A;  1PJU A;  4F6R A;  2RHL A;  5E3R A;  2RHO A;  3KJK A;  1UVG A;  4IHJ A;  5FNV B;  1IY6 A;  3RA5 A;  3I55 F;  3BYQ A;  4BY9 D;  2SGP I;  5CA1 B;  2DKV A;  5FUY A;  2R75 1;  5CA0 B;  2N17 A;  2I6R A;  1VK3 A;  4TV9 A;  2ALE A;  1M1K H;  2ZOV A;  3M84 A;  1YJW F;  1WKX A;  1VH8 A;  2VGN A;  4RHA A;  1W3E X;  2ELI A;  1LR7 A;  1R0R I;  1Y1C A;  2UVO A;  4I55 A;  1VQ8 F;  1V1I A;  2QQ0 A;  1TBR R;  2B33 A;  3BJI A;  5IYZ A;  4JCV E;  2BO1 A;  3TJQ A;  3UFF A;  1UUC A;  3UOE A;  2HP0 B;  2Z1T A;  5EAZ A;  2AMT A;  1VQV A;  3LYB A;  1YJ9 F;  3JAL A;  4C8I A;  5LP6 A;  3VE5 A;  1X74 A;  4DNC A;  1VQP F;  2WGC A;  1CT2 I;  1GZ0 A;  4DRX B;  4E1R A;  1T0K B;  2V9Y A;  5J2T A;  2UYN B;  1W3S A;  3F0F A;  1RFH A;  2E5R A;  2GKV A;  4ZHQ A;  1MT1 A;  1W5E A;  2IG8 A;  5BMV B;  1NQ3 A;  3CB2 A;  3CYQ A;  2Y0M A;  9WGA A;  5C8Y B;  1SGD I;  1TUS A;  3F0G A;  3MCA B;  5LXT B;  2OTJ F;  1LR9 A;  3MCQ A;  2X3T A;  2UYN A;  3VOB A;  2FGY A;  1H7M A;  1TUB B;  1XHO A;  3RE3 A;  1ULN A;  2VGM A;  2WCY A;  4OVO A;  2N52 A;  1FSZ A;  2B8T A;  3P10 A;  1NJI H;  3V3T A;  2V1C A;  2WAL A;  1KBE A;  1YTP A;  2WVJ A;  1SA0 B;  4ZOL B;  5EIB C;  5J2U B;  4TUY B;  4G4V A;  5EO3 A;  3I56 F;  2CWF A;  4KWE A;  3I3F A;  5LOV B;  1JN1 A;  5HXU A;  4TZZ A;  3R5B A;  2HVY D;  4BVR A;  1VQO F;  1T0A A;  3N4Z A;  1PCE A;  1GO0 A;  3NVK E;  1X7P A;  4EI9 A;  1K73 H;  4SGB I;  3WXM B;  5LXT A;  1AN1 I;  1Q81 H;  1W5F A;  3ERN A;  1W58 1;  1QAH A;  1RQ2 A;  3SGQ I;  1H0Z A;  2KMO A;  2I6D A;  2YQP A;  3LWQ C;  3LFO A;  3G4S F;  1SDS A;  4I50 A;  4I4T B;  5EX3 A;  2RIJ A;  5DAE A;  3LDT A;  5ITZ B;  1IY5 A;  2J87 A;  2LBT A;  1CT0 I;  3HKB B;  2QQD A;  1ZWZ A;  5EZY B;  3SGB I;  2SGD I;  3CXL A;  3JAR B;  5LA6 B;  3RYH B;  1YHQ F;  3CXC F;  4O2B B;  4C8E A;  5KX5 A;  3NMU C;  3QAH A;  1UFY A;  2EWC A;  3MBM A;  1SGR I;  2SGE I;  1SGY I;  2CHT A;  2Q1Y A;  3K2X A;  3JAM M;  2IQQ A;  1FAQ A;  3KE1 A;  4I55 B;  4WP4 A;  1PTR A;  3RYC A;  1W41 A;  2DB6 A;  3K14 A;  2QQC A;  4WBN B;  4X20 B;  3CCU F;  1E7K A;  3HKE B;  3HKB A;  4O4J A;  1K9M H;  3HAX D;  3KJJ A;  5CA1 A;  3I7T A;  4BT4 A;  5AVM A;  3CD6 F;  2L7X A;  3J80 M;  2OTM A;  2JW6 A;  2BTO A;  3WGM A;  2A20 A;  3V7E A;  2Q1X A;  5EWR A;  2ARP F;  1HJA I;  5E3Q A;  3VI6 A;  2VRW B;  3CC4 F;  3HTN A;  1WTJ A;  3LWP C;  4C4W C;  1YU6 C;  2JYY A;  1YIT F;  2KTU A;  3ON1 A;  3ZP4 A;  4I4T A;  4U3J A;  4O4I A;  3JCM M;  3O85 A;  4ZHQ B;  3TD5 A;  2FC3 A;  1CGI I;  2HS0 A;  3LME A;  2NU2 I;  5EYP A;  3DDN A;  4O4H A;  1R79 A;  4BW0 B;  4NWO B;  3LWR C;  1KC8 H;  1SGQ I;  1XX6 A;  2NU3 I;  4BT5 A;  4FFB B;  5HI7 A;  5EZY A;  1CHO I;  3TD4 A;  4DRX A;  5IJ9 B;  1J7H A;  2KTV A;  4BT7 A;  1VQ5 F;  2PMP A;  3JAW B;  1K7T A;  4B6D A;  5J8F A;  3QWP A;  4B45 A;  7WGA A;  1HPT A;  3KIZ A;  3K0T A;  3K12 A;  3C9U A;  3WPW A;  2DT4 A;  1NXU A;  1OMU A;  5EIB D;  2CWG A;  1COM A;  1W5B A;  5GIN C;  2Z01 A;  1M90 H;  1ODE A;  3IKF A;  3JAW A;  3ELC A;  5IJ0 A;  1KMA A;  3JAK A;  3Q8H A;  4DXD A;  2ZAU A;  5DCV A;  3R5C A;  3V4D A;  4E6E A;  2YYE A;  2GKR I;  3C9T A;  2W8B C;  5E3P A;  1X52 A;  3AGK A;  2Z1U A;  3FPI A;  4O4H B;  3RA6 A;  3NK6 A;  2OVO A;  3WGK A;  3PLA C;  5EB1 B;  2X52 A;  4ZHW A;  1K7V A;  4O4I B;  2UYP A;  2JA1 A;  1CK2 A;  3CPQ A;  3LWV C;  3HKD B;  1S72 F;  1VQ7 F;  1UI9 A;  1YJN F;  2OD1 A;  1DT9 A;  2V1C C;  2LBX A;  4UXH A;  2ODD A;  2GLZ A;  2QA4 F;  4TV9 B;  1SGE I;  2L8E A;  1FYB A;  3HH2 C;  2CW4 A;  4LNU B;  3HKC A;  5EX0 A;  4G4W A;  4ZHY B;  2OZB A;  3VCZ A;  3E59 A;  5BMV A;  5MN6 A;  3CCQ F;  2ORW A;  1IW4 A;  2BTQ B;  4O2B A;  3OW2 F;  3CC2 F;  3MQW A;  3OBW A;  4UXI A;  1IV1 A;  3U0O A;  3D54 A;  3JAR A;  5LA6 A;  5GIP C;  2QTP A;  1IV3 A;  1M8B A;  2FNF X;  3JAL B;  1TGS I;  2P6A C;  3OXL A;  3E2I A;  4HNA B;  1W57 A;  1BMO A;  3C9R A;  4M8I A;  3R5A A;  5JCO C;  3RYC B;  4X3L A;  5HP8 A;  3N2G B;  2N1A B;  4X3M A;  3CG6 A;  1RLG A;  2JXD A;  1NUB A;  5JQG B;  5LYJ B;  4LNU A;  1NMU B;  1YQN A;  3N2G A;  2E73 A;  1K7U A;  5GIO C;  3G6E F;  2NMU A;  1SGP I;  4X20 A;  2P6Y A;  1SGN I;  4C82 A;  2KCX A;  1MJ9 A;  5KMG B;  3RYF A;  4X1Y B;  3V7Q A;  1RQ7 A;  4IHJ B;  5FNV A;  3FBA A;  1Q8R A;  1OYV I;  1W2B F;  3B6N A;  5KX5 B;  3B4V C;  3JAT B;  5FUV A;  4G88 A;  5FLX M;  5FUW A;  2R6R 1;  1TBO A;  1XV2 A;  3TD3 A;  3NK7 A;  2GZL A;  3VYS C;  5GAN K;  2GIV A;  1KD1 H;  3SIU A;  2UZH A;  2QEX F;  3S06 A;  3IMP A;  5JVD A;  1KQS F;  1GX1 A;  1Z5V A;  5FUX A;  3FSX A;  4E1P A;  3MEK A;  2VAP A;  3VDU A;  4BT2 A;  1WGC A;  3WGJ A;  3OXG A;  5CCM A;  3ESJ A;  1N13 A;  4ZK7 A;  1KNJ A;  5HXZ A;  3OVO A;  3GHZ A;  2F9Z C;  2HS3 A;  5EB0 A;  1GO1 A;  1YGY A;  3MDO A;  2GKT I;  1U43 A;  4PWT A;  4B62 A;  3WJQ A;  1DS2 I;  4EB6 B;  3CCJ F;  3WGN A;  4ZOL A;  1MJB A;  2HRU A;  4UXJ A;  4U3J B;  2CHS A;  5JH7 A;  2CSL A;  3JAT A;  4YJ2 B;  3TO7 A;  3QTL D;  1U40 A;  1Y1B A;  3D01 A;  1Y8F A;  1TOT A;  1VDD A;  5HQ8 A;  3HWU A;  4EI8 A;  3VDP A;  1TUB A;  3J81 M;  5HWE A;  1Q86 H;  2RHJ A;  5IJ0 B;  2KMQ A;  3E20 B;  3FC3 A;  3CCM F;  2AIF A;  1CSO I;  1UHA A;  4F6R B;  1TUR A;  2HP3 A;  3CYP B;  3OL0 A;  3RU0 A;  4A24 A;  3KHN A;  5J2T B;  1OMT A;  3L7Q A;  3N4Y A;  4TV8 A;  1ULK A;  5CCL A;  3UGL A;  3UT5 A;  4C8G A;  3EOR A;  1FY7 A;  1XA6 A;  5CA0 A;  1FFX B;  4BVQ A;  3M1X A;  1HDL A;  1TBN A;  5CB4 A;  3E22 A;  3R0P A;  5C8Y A;  1XBI A;  2F3C I;  2CJS C;  4NQ3 A;  3CME F;  2V53 A;  4C81 A;  4YJ2 A;  2DYY A;  1QD9 A;  2B0U C;  2VAM A;  4BT3 A;  3QHD A;  3S0H A;  3CCR F;  3E22 B;  4WBN A;  2GVI A;  3FD5 A;  1OVO A;  4FKD A;  2CZW A;  3ZO8 A;  4G4X A;  3VTI C;  3SIV A;  1Q82 H;  1LR8 A;  1X4S A;  3N2K B;  1SZQ A;  2HP0 A;  3F6M A;  3DC2 A;  4TV8 B;  4LCK A;  1TIH A;  4BVS A;  5HY2 A;  2NU4 I;  3FD6 A;  2VAW A;  3VO8 A;  4L9M A;  5MN4 A;  2KMP A;  3SEK C;  3C9S A;  3RYH A;  3QTY A;  1ONI A;  4B46 A;  5B8F A;  3VMF B;  4R40 B;  3S0W A;  1M8C A;  5HY0 A;  1IV2 A;  2HS4 A;  3JAS B; 
#chains in the Genus database with same CATH homology
 2ENN A;  3D00 A;  1QVG F;  3OBY A;  2W0T A;  3CC7 F;  1YIJ F;  1K8A H;  1TBQ R;  2SGF I;  2ERW A;  2YUU A;  3CCV F;  2ROW A;  5G4V C;  2OTL F;  1XBT A;  1CE3 A;  2UZ3 A;  1KBF A;  4NUT A;  3PAF A;  3NVI B;  3HJW C;  2KG4 A;  5A2Q M;  2ENZ A;  5GAP K;  3UGI A;  1IPA A;  3J7A R;  1DS3 I;  1W42 A;  2XRC A;  2LUY A;  1PTQ A;  3GYQ A;  1VQ4 F;  2LBW A;  1VQ6 F;  2N71 A;  1V1H A;  2JZM A;  1W40 A;  2LEO A;  2DIP A;  4GI3 C;  5FJ4 C;  3CCE F;  2QI2 A;  3UEY A;  1U5K A;  1RA4 A;  4EI7 A;  1FAR A;  3PDN A;  3LWO C;  1W4R A;  2QQE A;  2NU0 I;  5JHW C;  2M5X A;  2JNB A;  1VQK F;  1N8R H;  3CCL F;  2SGQ I;  1CT4 I;  5G4U C;  3E1Y A;  1JJ2 F;  2QPO A;  2KMR A;  1UVF A;  1VQL F;  3GOX A;  3KY9 A;  3FFM A;  5HY4 A;  1QVF F;  3UEJ A;  4BVT A;  1Q7Y H;  4HGU A;  2NU1 I;  3CCS F;  5IT9 M;  2OHW A;  2K9H A;  1BUS A;  1Z7K B;  3OXF A;  3G71 F;  1VQN F;  1PPF I;  3IR9 A;  3CMA F;  1CN7 A;  1CGJ I;  2ORV A;  1X7O A;  2J9R A;  1VQM F;  3CPW F;  1PXW A;  4XCQ A;  2BUS A;  1YI2 F;  3UGD A;  1VQ9 F;  5HY1 A;  1PJU A;  1UVG A;  1IY6 A;  3RA5 A;  3I55 F;  4BY9 D;  2SGP I;  5FUY A;  2N17 A;  2ALE A;  1M1K H;  1YJW F;  2VGN A;  1W3E X;  2ELI A;  1LR7 A;  1R0R I;  1Y1C A;  1VQ8 F;  1V1I A;  2QQ0 A;  1TBR R;  3BJI A;  4JCV E;  2BO1 A;  3TJQ A;  3UFF A;  1UUC A;  1YJ9 F;  3VE5 A;  1X74 A;  1VQP F;  1CT2 I;  1GZ0 A;  4E1R A;  1T0K B;  1W3S A;  1RFH A;  2E5R A;  2GKV A;  1MT1 A;  1SGD I;  1TUS A;  3MCA B;  2OTJ F;  1LR9 A;  2FGY A;  1H7M A;  2VGM A;  2WCY A;  4OVO A;  2N52 A;  2B8T A;  1NJI H;  3V3T A;  2V1C A;  2WAL A;  1KBE A;  1YTP A;  2WVJ A;  5EO3 A;  3I56 F;  5HXU A;  4TZZ A;  2HVY D;  4BVR A;  1VQO F;  3N4Z A;  1PCE A;  1GO0 A;  3NVK E;  1X7P A;  4EI9 A;  1K73 H;  4SGB I;  3WXM B;  1AN1 I;  1Q81 H;  3SGQ I;  1H0Z A;  2KMO A;  2I6D A;  2YQP A;  3G4S F;  3LFO A;  3LWQ C;  1SDS A;  5EX3 A;  5DAE A;  1IY5 A;  2J87 A;  1CT0 I;  2QQD A;  1ZWZ A;  3SGB I;  2SGD I;  3CXL A;  1YHQ F;  3CXC F;  3NMU C;  1SGR I;  2SGE I;  1SGY I;  1FAQ A;  1PTR A;  1W41 A;  2DB6 A;  2QQC A;  1E7K A;  3CCU F;  1K9M H;  3HAX D;  3CD6 F;  2L7X A;  3J80 M;  3V7E A;  2JW6 A;  2A20 A;  5EWR A;  2ARP F;  1HJA I;  3VI6 A;  2VRW B;  3CC4 F;  3LWP C;  4C4W C;  1YU6 C;  2JYY A;  1YIT F;  2KTU A;  3ON1 A;  3JCM M;  3O85 A;  2FC3 A;  1CGI I;  4BW0 B;  2NU2 I;  1KC8 H;  1R79 A;  3LWR C;  1SGQ I;  1XX6 A;  2NU3 I;  5HI7 A;  1CHO I;  2KTV A;  1VQ5 F;  4B6D A;  3QWP A;  1HPT A;  1OMU A;  5GIN C;  1M90 H;  1KMA A;  5DCV A;  2GKR I;  3RA6 A;  1X52 A;  3AGK A;  3NK6 A;  2OVO A;  3PLA C;  2JA1 A;  1CK2 A;  3CPQ A;  3LWV C;  1S72 F;  1VQ7 F;  1YJN F;  2OD1 A;  1DT9 A;  2V1C C;  2LBX A;  4UXH A;  2ODD A;  2GLZ A;  2QA4 F;  1SGE I;  2L8E A;  1FYB A;  3HH2 C;  5EX0 A;  2OZB A;  3E59 A;  3CCQ F;  2ORW A;  1IW4 A;  3OW2 F;  3CC2 F;  3OBW A;  4UXI A;  5GIP C;  1M8B A;  2FNF X;  1TGS I;  2P6A C;  3OXL A;  3E2I A;  1BMO A;  4X3L A;  2N1A B;  4X3M A;  3CG6 A;  1RLG A;  2JXD A;  1NUB A;  1NMU B;  2E73 A;  5GIO C;  3G6E F;  1SGP I;  1SGN I;  2KCX A;  3V7Q A;  1OYV I;  1W2B F;  3B4V C;  5FUV A;  5FLX M;  5FUW A;  1TBO A;  3NK7 A;  5GAN K;  1KD1 H;  3SIU A;  2QEX F;  1KQS F;  5FUX A;  4E1P A;  3MEK A;  3VDU A;  3OXG A;  5CCM A;  1N13 A;  5HXZ A;  3OVO A;  2F9Z C;  1GO1 A;  2GKT I;  1DS2 I;  3CCJ F;  4UXJ A;  3QTL D;  4EI8 A;  1Y1B A;  3JAM M;  1Y8F A;  1TOT A;  1VDD A;  5HQ8 A;  3VDP A;  3J81 M;  5HWE A;  1Q86 H;  2KMQ A;  3E20 B;  3FC3 A;  3CCM F;  2AIF A;  1CSO I;  1TUR A;  3OL0 A;  3RU0 A;  4A24 A;  1OMT A;  3N4Y A;  5CCL A;  3UGL A;  1XA6 A;  4BVQ A;  1HDL A;  1TBN A;  1XBI A;  2F3C I;  2CJS C;  3CME F;  4NQ3 A;  2V53 A;  2B0U C;  3CCR F;  2GVI A;  1OVO A;  4FKD A;  2CZW A;  3SIV A;  1Q82 H;  1LR8 A;  1X4S A;  4LCK A;  1TIH A;  4BVS A;  5HY2 A;  2NU4 I;  4L9M A;  2KMP A;  3SEK C;  3VMF B;  5HY0 A;  1M8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...