3D00A

Crystal structure of a tungsten formylmethanofuran dehydrogenase subunit e (fmde)-like protein (syn_00638) from syntrophus aciditrophicus at 1.90 a resolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
190
structure length
184
Chain Sequence
MTARNILSYSYEEYVEKITAFHGYPAPGVLIGGFMVDLAVKNLPEGILYDAICETRTCLPDAVQLLTPCTFGNGWLTVLPMGLFAVSLYDKFTGEGVRVFLDVEKMGPWQEIRNWFLKLKSERLFKEIREAGPDILELRNVKLKPGFLEKKHKGKIVLCPQCREAYPAQDGELCLSCQGGSPYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tungsten formylmethanofuran dehydrogenase subunit E
publication title Structures of three members of Pfam PF02663 (FmdE) implicated in microbial methanogenesis reveal a conserved alpha+beta core domain and an auxiliary C-terminal treble-clef zinc finger.
pubmed doi rcsb
source organism Syntrophus aciditrophicus
molecule tags Metal binding protein
total genus 46
structure length 184
sequence length 190
ec nomenclature
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02663 FmdE FmdE, Molybdenum formylmethanofuran dehydrogenase operon
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.80 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3d00A02
3.30.1330.130 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3d00A01
3VE5A 2V1CA 2GLZA 3VDUA 3VDPA 3D00A 1VDDA
chains in the Genus database with same CATH superfamily
2DB6A 3UEYA 3F0GA 5EB0A 4WP4A 3SEKC 4ZHQA 1U3PA 1FNJA 3SIVA 3HKBA 3VCZA 2ZAUA 5LA6A 4HNAA 1IV3A 1VQLF 5EYPA 3TD3A 1ULMA 2BO1A 4KWEA 2DKVA 4B46A 4ZI7B 4ZHVA 5LA6B 3JAKA 4O2AA 5HY0A 1VQKF 4B45A 1W55A 5GONB 5CA0B 4LCKA 4O4IB 1JD1A 5LYJA 2RHJA 3FD5A 1JY8A 1M8CA 2W0TA 9WGAA 4O4HB 3WGLA 2K9HA 3N2KB 2OVOA 1FFXB 5CB4A 2G9IA 2NMUA 2HP0B 2JA1A 2HS3A 3FD6A 3IKEA 1VQVA 3L7QA 4ZHYB 4G4YA 1R1MA 4EI7A 4TZZA 1Q81H 1DT9A 1X52A 2VGMA 5LOVA 5DAEA 2CWHA 1FSZA 1KNJA 1X74A 5JHWC 1XBTA 2I6DA 3KHNA 3PLAC 3N4YA 1PTRA 3AGKA 1LR8A 4UXHA 1TURA 1KMAA 1KNKA 2FC3A 1TBRR 2WALA 5HY2A 1FNKA 4BVRA 3P10A 1Q7YH 5EB1B 4I4TB 3HH2C 1WKXA 5FUVA 1WGCA 2N48A 2VAWA 2LBWA 1PJUA 7WGAA 2E5RA 2HS4A 4G4XA 5J2UB 3VMFB 2RHHA 3K2XA 2RHLA 3E59A 4OVOA 1M90H 4TUYA 2GKTI 2KTUA 3J80M 1MJ9A 2WGCA 1JFFB 2DT4A 4TV8B 3VIUA 3VDUA 4G4WA 3WGKA 1X4SA 3WGJA 4YJ3B 1OMTA 5FUWA 4MPIA 1YIJF 2AMTA 1CK2A 2MQEA 2ORVA 3J81M 3I55F 5DCVA 3FSXA 3N4ZA 3PAFA 3IEWA 5IYZA 2Z1TA 4BVTA 3MCQA 2CVLA 5LP6C 3WPXA 2RIJA 4BT7A 5GIOC 3CCRF 5E3PA 4F6RB 2EWCA 3C9TA 3TJQA 1IV4A 4IIJA 4B62A 2ARPF 3LWRC 3O85A 1YJNF 2V9YA 1NQ3A 2HP3A 2R751 4X20A 5JVDB 3GOXA 2KCXA 3OXGA 5EIBC 4TV9A 4C8EA 3VYSC 1IV2A 5LP6A 3VO8A 1T0KB 3ESJA 3JALB 1SDSA 3CMAF 3J7AR 5FUYA 3JATA 3M1XA 2NU2I 4EI8A 1J7HA 2UYNA 4B6DA 4R40B 2SGPI 3MCAB 1TBOA 2ZODA 3N2GA 3OL0A 5HWEA 4A24A 3S0WA 2ORWA 1K7UA 4X1IA 1TGSI 3WPWA 5E3QA 2WVJA 3RA6A 3CCMF 1OAPA 3N2GB 1K7VA 5JH7A 2B0UC 1ONIA 5LXTB 3JARB 3UOEA 3BYQA 3JAWA 3MDOA 4YJ2A 1R0RI 1Z2IA 4ZK7A 2Z1UA 3ZOPA 3IEQA 1VQ5F 1TBQR 1W5FA 2CW4A 1GO0A 3FC3A 3S06A 1NJIH 1XBIA 3G71F 2DYYA 2E73A 4I55A 1N13A 2AIFA 3IR9A 1IW4A 4L9MA 2L7XA 3Q8HA 1XA6A 1COMA 2BTQB 3RE3A 1UHAA 2LB7A 3FSYA 2BTUA 5EAZA 1W41A 4DRXA 5FUXA 5J8CA 3TD4A 1VQNF 3EORA 4LNUA 5HQ8A 2OZUA 2ZF8A 1SGYI 1ODEA 4X1KB 3QTLD 1UFYA 3M84A 3QTYA 1YJWF 1M8BA 5G4UC 1KBEA 3ZO8A 4FFBA 3HKCA 3HAXD 3V7EA 1U40A 1SGEI 2KMPA 3P0ZA 2J87A 4JCVE 5CA1A 3HJWC 4BT5A 3E20B 1JN1A 4ZHQB 2OTJF 3K14A 3RA5A 2FNFX 5IJ9A 1CN7A 3HKBB 1VQ4F 5FNVA 2ODDA 1W5BA 1YI2F 3SGQI 4HNAB 2ELIA 1GX1A 1XV2A 1VQ6F 5EYPB 1S72F 1RQ7A 2OTLF 3JAKB 4O2AB 5EZYA 2ENNA 1X7PA 1V1IA 3U0OA 1YQNA 3NMUC 3VOBA 2X52A 5LYJB 4SGBI 2LBXA 3HKDA 3HWUA 3JAMM 1K7TA 5EZYB 4UXJA 1QU9A 2QQDA 4C8IA 2CZWA 3OXLA 1SGPI 3WJRA 5CB4B 1W59A 2IQQA 3LWVC 5IJ0A 2ALEA 2X3TA 3C9SA 5LOVB 1UVFA 3LWQC 2QQCA 5ITZA 1YTPA 2KMQA 5IJ0B 3LMEA 2DIPA 2H8EA 3OONA 1GZ0A 3M4SA 1TUSA 1E7KA 3RYHA 4HGUA 1Y1BA 5JCOC 3CYQA 4NQ3A 2JZMA 3GTZA 1CSOI 2OD1A 1ULKA 2LUYA 2CHTA 1YHQF 1VK3A 1RFHA 1Z5VA 1CGII 5J8FA 5E3RA 3KJJA 2KTVA 2SGQI 1QAHA 3ZP7A 5C8YA 3FFMA 2Y0MA 1W40A 3TD5A 5B8FA 5HXUA 3CG6A 4TUYB 1WTJA 3K12A 4I50A 4BT3A 1IV1A 1W3EX 5JCOA 1AN1I 3TO9A 1W42A 3HKEA 2HX0A 4O4JA 5AVMA 3CCQF 4U3JA 3RYIA 5FJ4C 2N52A 1T0AA 2BUSA 1MJBA 2ENZA 4I50B 1W5EA 1U3LA 4O4JB 3V3TA 3F0DA 5IYZB 4U3JB 3D00A 2VXYA 2P6YA 4ZOLA 3C9RA 3CC2F 1HDLA 2CHSA 1DS2I 1U43A 2PMPA 4RHAA 3UT5A 4IIJB 3B4VC 2P6AC 1LR9A 2ZOVA 2UYKA 2V1CC 5MN4A 2H6LA 5CCLA 1FAQA 3JVHA 3E22A 4X20B 2OU2A 4UXIA 3LFOA 4GI3C 3C8LA 3LWOC 5EO3A 5FLXM 4TV9B 1OMUA 1P9GA 2HRYA 4EB6A 2L8EA 2SGFI 1H7MA 5LP6B 1YU6C 1HEVA 1PXWA 4NUTA 2M5XA 3VYUC 1W3SA 3F0FA 3V4DA 2A20A 1NMUB 3JASA 1DS3I 3JATB 2UYPA 2V1CA 3OW2F 1TVKA 2UYNB 3VI6A 2SGEI 5KMGA 1Q86H 2HRUA 3WGMA 1SGRI 4BT6A 4X1IB 2JW6A 1NXUA 2R6R1 1FYBA 1SZQA 4C82A 4WBNA 3RYCA 2QTPA 3CYPB 3OXFA 1XRGA 1S20A 2N71A 3VDPA 5JH7B 3CCLF 1M1KH 3KE1A 2OZBA 3CD6F 2Z1EA 1KC8H 2QPOA 2IAFA 5EIBD 3C9UA 4YJ2B 5G4VC 3JAWB 1XX6A 2CJSC 3VYTC 3QUWA 1PCEA 2ROWA 3QHDA 1SA0A 3E1YA 1YGYA 2F3CI 4I55B 4ZHWA 4BY9D 2F9ZC 1X25A 2VRWB 2BTOA 1SA0B 3RU0A 1CT2I 2L26A 4AMLA 1BUSA 1IY6A 5GANK 4PWTA 4DRXB 2QEXF 3E2IA 1CT4I 3CC4F 4X1YA 4LNUB 2GKVA 3OVOA 1W57A 1V1HA 2SGDI 2RB9A 1N8RH 2VGNA 2QI2A 3R5CA 3CMEF 1YITF 2Z1FA 3I3FA 1BMOA 4FFBB 3HKCB 3I7TA 1PPFI 3MQWA 4G88A 4FKDA 1Z7KB 5HP8A 4E6EA 3S03A 1CLIA 1CT0I 1R79A 1VH8A 3RYFA 5CA1B 3ZP4A 1K73H 3G4SF 2ERWA 2ZVZA 2JNBA 3JCMM 2IG8A 3WGNA 2UZ3A 4C8GA 3KJKA 2UZHA 5IJ9B 5FNVB 3CCVF 5MN6A 5GIPC 3CB2A 2OTMA 2I6RA 2Q1YA 2NU1I 1TIHA 3CXLA 1PF5A 2GIVA 4ZI7A 5CCMA 4C4WC 4B5CA 2W8BC 1Q82H 1P9ZA 5GONA 5CA0A 1XHOA 4O4IA 1PTQA 3TOAA 3HKDB 2V53A 1FY7A 3UGLA 4E1PA 1ZWZA 3UGDA 2KG4A 3D54A 2LCAA 3MBMA 4E1RA 3P4EA 5EWRA 4O4HA 3N2KA 1FFXA 2QA4F 2HP0A 2YQPA 3SGBI 1HPTA 2HQSC 1TBNA 3IMPA 3F0EA 1H48A 3CCJF 2NU0I 5ITZB 2K1SA 4DXDA 5BMVA 1CGJI 1QVGF 1H0ZA 5HI7A 2ZVYA 3KIZA 2GVIA 1VQ8F 4IHJA 2WCYA 1Q8RA 2YXZA 3NK6A 3I56F 3CCSF 5EX3A 3UGIA 3RYHB 2LBTA 5BMVB 3F6MA 4I4TA 4DNCA 1Q9BA 1VQPF 1WGTA 4IHJB 1CE3A 1LR7A 3FBAA 1KD1H 2B8TA 2YYEA 5GAPK 3K0TA 3OBWA 1NUBA 5J2UA 2N17A 3VOAA 1IY5A 4XCQA 2J9RA 5C8YB 3PDNA 3R5DA 1GO1A 2JYYA 3CCEF 3R0PA 1JFFA 4TV8A 2B33A 2VAMA 4U39A 2CWGA 5EX0A 2PQ8A 1TUBA 3HKEB 1QD9A 4YJ3A 4NWOB 5HY1A 3RYIB 1RLUA 2AIZP 3SIUA 3CPWF 1TUBB 1FARA 2UVOA 3ELCA 4BW0B 4ERHA 3LWPC 1UVGA 3WJPA 3D01A 2HS0A 5HY4A 3VE5A 3T80A 2GKRI 2UYJA 4ZOLB 3IKFA 4F6RA 1DBFA 1UI9A 3ERNA 1RA4A 1W581 3UT5B 2H8CA 4X3MA 1SGQI 3E22B 2JXDA 5JVDA 3GHZA 2LEOA 3UEJA 3G6EF 4RQOA 3KY9A 3ON1A 3WXMB 4O4LA 4EB6B 2YUUA 3OBYA 3S0HA 3R5AA 1Y1CA 3S0YA 1W2BF 3JALA 4X3LA 3HTNA 3JASB 4EI9A 4O4LB 3GYQA 5HXZA 1TVKB 2RHOA 2PHNA 2Z01A 5JQGA 5KMGB 1MJAA 1ULNA 3MEKA 4O2BB 5MN5A 4M8IA 2CWFA 2VAPA 4G4VA 1UUCA 1VQ7F 2KMRA 3DDNA 3DC2A 3LYBA 4WBNB 3RYCB 1X7OA 5JQGB 1OYVI 4BT2A 3V7QA 4BVSA 3TO7A 2NU3I 3CCUF 1KQSF 5LXTA 5J2TA 3JARA 1JJ2F 3QAHA 2GZLA 5A2QM 1QVFF 1RQ2A 1K8AH 1U5KA 5GINC 5KX5A 1H47A 1OFUA 5J2TB 1VQ9F 3VTIC 3CC7F 1TOTA 1Z5WA 2KGWA 3TO6A 1W5AA 3NVIB 1W4RA 3NK7A 2NU4I 2QQ0A 3CXCF 1YJ9F 2HVYD 3NVKE 2OHWA 1OVOA 2GLZA 5KX5B 2Q1XA 2RC4A 3TOBA 1IPAA 4BVQA 1CHOI 3BJIA 3WJQA 3LDTA 3S02A 1Y8FA 4X1YB 1SGDI 2XRCA 4G4ZA 1VHAA 1RLGA 1VDDA 2QQEA 2CWJA 1K9MH 4X1KA 1HJAI 2CSLA 3FPIA 3B6NA 1SGNI 4O2BA 4C81A 1VQMF 3QWPA 1KBFA 3CPQA 3UFFA 2N1AB 1MT1A 2KMOA 3RYFB 3R5BA 1VQOF 4BT4A 5HP7A 2FGYA 5IT9M
chains in the Genus database with same CATH topology
2DB6A 3UEYA 3SEKC 3SIVA 1VQLF 2BO1A 5HY0A 1VQKF 4LCKA 1M8CA 2W0TA 2K9HA 2OVOA 2JA1A 4TZZA 4EI7A 1Q81H 1DT9A 1X52A 2VGMA 5DAEA 1X74A 5JHWC 1XBTA 2I6DA 3PLAC 3N4YA 1PTRA 3AGKA 1LR8A 4UXHA 1TURA 1KMAA 2FC3A 2WALA 1TBRR 5HY2A 4BVRA 1Q7YH 3HH2C 5FUVA 2LBWA 1PJUA 2E5RA 3VMFB 3E59A 4OVOA 1M90H 2GKTI 2KTUA 3J80M 3VDUA 1X4SA 1OMTA 5FUWA 1YIJF 1CK2A 2ORVA 3J81M 3I55F 5DCVA 3N4ZA 3PAFA 4BVTA 5GIOC 3TJQA 3LWRC 1YJNF 2ARPF 3O85A 3GOXA 2KCXA 3OXGA 1T0KB 1SDSA 3CMAF 3J7AR 5FUYA 4EI8A 2NU2I 4B6DA 2SGPI 3MCAB 1TBOA 5HWEA 3OL0A 4A24A 2ORWA 1TGSI 2WVJA 3RA6A 3CCMF 2B0UC 1R0RI 1VQ5F 1TBQR 1GO0A 3FC3A 1NJIH 1XBIA 3G71F 2E73A 1N13A 2AIFA 3IR9A 1IW4A 4L9MA 2L7XA 1XA6A 1W41A 5FUXA 1VQNF 5HQ8A 1SGYI 3QTLD 1YJWF 1M8BA 5G4UC 1KBEA 3HAXD 3V7EA 1SGEI 2KMPA 3HJWC 2J87A 4JCVE 3E20B 2OTJF 3RA5A 2FNFX 1CN7A 1VQ4F 2ODDA 1YI2F 3SGQI 2ELIA 1VQ6F 1S72F 2OTLF 2ENNA 1X7PA 1V1IA 3NMUC 4SGBI 2LBXA 3JAMM 4UXJA 2QQDA 2CZWA 3OXLA 1SGPI 3LWVC 2ALEA 1UVFA 3LWQC 2QQCA 1YTPA 2KMQA 2DIPA 1GZ0A 1TUSA 1E7KA 4HGUA 1Y1BA 4NQ3A 2JZMA 1CSOI 2OD1A 2LUYA 1YHQF 1RFHA 1CGII 2KTVA 2SGQI 3FFMA 1W40A 5HXUA 3CG6A 1W3EX 1AN1I 1W42A 3CCQF 5FJ4C 2N52A 2BUSA 2ENZA 3V3TA 3D00A 3CC2F 1HDLA 1DS2I 3B4VC 2P6AC 1LR9A 2V1CC 5CCLA 1FAQA 4UXIA 3LFOA 4GI3C 3LWOC 5EO3A 5FLXM 1OMUA 2L8EA 2SGFI 1H7MA 1YU6C 1PXWA 4NUTA 2M5XA 1W3SA 2A20A 1NMUB 1DS3I 2V1CA 3OW2F 3VI6A 2SGEI 1Q86H 1SGRI 2JW6A 1FYBA 3OXFA 2N71A 3VDPA 3CCLF 1M1KH 2OZBA 3CD6F 1KC8H 2QPOA 5G4VC 1XX6A 2CJSC 1PCEA 2ROWA 3E1YA 2F3CI 4BY9D 2F9ZC 2VRWB 3RU0A 1CT2I 1BUSA 1IY6A 5GANK 2QEXF 3E2IA 1CT4I 3CC4F 2GKVA 3OVOA 1V1HA 2SGDI 1N8RH 2VGNA 2QI2A 3CMEF 1YITF 1BMOA 1PPFI 4FKDA 1Z7KB 1CT0I 1R79A 1K73H 3G4SF 2ERWA 2JNBA 3JCMM 2UZ3A 3CCVF 5GIPC 2NU1I 1TIHA 3CXLA 5CCMA 4C4WC 1Q82H 1PTQA 2V53A 2KG4A 3UGLA 1ZWZA 3UGDA 4E1PA 4E1RA 5EWRA 2QA4F 2YQPA 3SGBI 1HPTA 1TBNA 3CCJF 2NU0I 1CGJI 1QVGF 1H0ZA 5HI7A 2GVIA 1VQ8F 2WCYA 3NK6A 3I56F 3CCSF 5EX3A 3UGIA 1VQPF 1CE3A 1LR7A 1KD1H 2B8TA 5GAPK 3OBWA 1NUBA 2N17A 1IY5A 4XCQA 2J9RA 3PDNA 1GO1A 2JYYA 3CCEF 5EX0A 5HY1A 3SIUA 3CPWF 1FARA 4BW0B 3LWPC 1UVGA 5HY4A 3VE5A 2GKRI 1RA4A 4X3MA 1SGQI 2JXDA 2LEOA 3UEJA 3G6EF 3WXMB 3KY9A 3ON1A 2YUUA 3OBYA 1Y1CA 1W2BF 4X3LA 4EI9A 3GYQA 5HXZA 3MEKA 1UUCA 1VQ7F 2KMRA 1X7OA 1OYVI 4BVSA 3V7QA 2NU3I 3CCUF 1KQSF 1JJ2F 5A2QM 1QVFF 1K8AH 1U5KA 5GINC 1VQ9F 3CC7F 1TOTA 3NVIB 3NK7A 1W4RA 2NU4I 2QQ0A 3CXCF 1YJ9F 2HVYD 3NVKE 2OHWA 1OVOA 2GLZA 1IPAA 4BVQA 1CHOI 3BJIA 1Y8FA 1SGDI 2XRCA 1RLGA 1VDDA 2QQEA 1K9MH 1HJAI 1SGNI 1VQMF 3QWPA 1KBFA 3CPQA 3UFFA 2N1AB 1MT1A 2KMOA 1VQOF 3CCRF 2FGYA 5IT9M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VE5 A;  2V1C A;  2GLZ A;  3VDU A;  3VDP A;  3D00 A;  1VDD A; 
#chains in the Genus database with same CATH topology
 2DB6 A;  3UEY A;  3F0G A;  5EB0 A;  4WP4 A;  3SEK C;  4ZHQ A;  1U3P A;  1FNJ A;  3SIV A;  3HKB A;  3VCZ A;  2ZAU A;  5LA6 A;  4HNA A;  1IV3 A;  1VQL F;  5EYP A;  3TD3 A;  1ULM A;  2BO1 A;  4KWE A;  2DKV A;  4B46 A;  4ZI7 B;  4ZHV A;  5LA6 B;  3JAK A;  4O2A A;  5HY0 A;  1VQK F;  4B45 A;  1W55 A;  5GON B;  5CA0 B;  4LCK A;  4O4I B;  1JD1 A;  5LYJ A;  2RHJ A;  3FD5 A;  1JY8 A;  1M8C A;  2W0T A;  9WGA A;  4O4H B;  3WGL A;  2K9H A;  3N2K B;  2OVO A;  1FFX B;  5CB4 A;  2G9I A;  2NMU A;  2HP0 B;  2JA1 A;  2HS3 A;  3FD6 A;  3IKE A;  1VQV A;  3L7Q A;  4ZHY B;  4G4Y A;  1R1M A;  4EI7 A;  4TZZ A;  1Q81 H;  1DT9 A;  1X52 A;  2VGM A;  5LOV A;  5DAE A;  2CWH A;  1FSZ A;  1KNJ A;  1X74 A;  5JHW C;  1XBT A;  2I6D A;  3KHN A;  3PLA C;  3N4Y A;  1PTR A;  3AGK A;  1LR8 A;  4UXH A;  1TUR A;  1KMA A;  1KNK A;  2FC3 A;  1TBR R;  2WAL A;  5HY2 A;  1FNK A;  4BVR A;  3P10 A;  1Q7Y H;  5EB1 B;  4I4T B;  3HH2 C;  1WKX A;  5FUV A;  1WGC A;  2N48 A;  2VAW A;  2LBW A;  1PJU A;  7WGA A;  2E5R A;  2HS4 A;  4G4X A;  5J2U B;  3VMF B;  2RHH A;  3K2X A;  2RHL A;  3E59 A;  4OVO A;  1M90 H;  4TUY A;  2GKT I;  2KTU A;  3J80 M;  1MJ9 A;  2WGC A;  1JFF B;  2DT4 A;  4TV8 B;  3VIU A;  3VDU A;  4G4W A;  3WGK A;  1X4S A;  3WGJ A;  4YJ3 B;  1OMT A;  5FUW A;  4MPI A;  1YIJ F;  2AMT A;  1CK2 A;  2MQE A;  2ORV A;  3J81 M;  3I55 F;  5DCV A;  3FSX A;  3N4Z A;  3PAF A;  3IEW A;  5IYZ A;  2Z1T A;  4BVT A;  3MCQ A;  2CVL A;  5LP6 C;  3WPX A;  2RIJ A;  4BT7 A;  5GIO C;  3CCR F;  5E3P A;  4F6R B;  2EWC A;  3C9T A;  3TJQ A;  1IV4 A;  4IIJ A;  4B62 A;  2ARP F;  3LWR C;  3O85 A;  1YJN F;  2V9Y A;  1NQ3 A;  2HP3 A;  2R75 1;  4X20 A;  5JVD B;  3GOX A;  2KCX A;  3OXG A;  5EIB C;  4TV9 A;  4C8E A;  3VYS C;  1IV2 A;  5LP6 A;  3VO8 A;  1T0K B;  3ESJ A;  3JAL B;  1SDS A;  3CMA F;  3J7A R;  5FUY A;  3JAT A;  3M1X A;  2NU2 I;  4EI8 A;  1J7H A;  2UYN A;  4B6D A;  4R40 B;  2SGP I;  3MCA B;  1TBO A;  2ZOD A;  3N2G A;  3OL0 A;  5HWE A;  4A24 A;  3S0W A;  2ORW A;  1K7U A;  4X1I A;  1TGS I;  3WPW A;  5E3Q A;  2WVJ A;  3RA6 A;  3CCM F;  1OAP A;  3N2G B;  1K7V A;  5JH7 A;  2B0U C;  1ONI A;  5LXT B;  3JAR B;  3UOE A;  3BYQ A;  3JAW A;  3MDO A;  4YJ2 A;  1R0R I;  1Z2I A;  4ZK7 A;  2Z1U A;  3ZOP A;  3IEQ A;  1VQ5 F;  1TBQ R;  1W5F A;  2CW4 A;  1GO0 A;  3FC3 A;  3S06 A;  1NJI H;  1XBI A;  3G71 F;  2DYY A;  2E73 A;  4I55 A;  1N13 A;  2AIF A;  3IR9 A;  1IW4 A;  4L9M A;  2L7X A;  3Q8H A;  1XA6 A;  1COM A;  2BTQ B;  3RE3 A;  1UHA A;  2LB7 A;  3FSY A;  2BTU A;  5EAZ A;  1W41 A;  4DRX A;  5FUX A;  5J8C A;  3TD4 A;  1VQN F;  3EOR A;  4LNU A;  5HQ8 A;  2OZU A;  2ZF8 A;  1SGY I;  1ODE A;  4X1K B;  3QTL D;  1UFY A;  3M84 A;  3QTY A;  1YJW F;  1M8B A;  5G4U C;  1KBE A;  3ZO8 A;  4FFB A;  3HKC A;  3HAX D;  3V7E A;  1U40 A;  1SGE I;  2KMP A;  3P0Z A;  2J87 A;  4JCV E;  5CA1 A;  3HJW C;  4BT5 A;  3E20 B;  1JN1 A;  4ZHQ B;  2OTJ F;  3K14 A;  3RA5 A;  2FNF X;  5IJ9 A;  1CN7 A;  3HKB B;  1VQ4 F;  5FNV A;  2ODD A;  1W5B A;  1YI2 F;  3SGQ I;  4HNA B;  2ELI A;  1GX1 A;  1XV2 A;  1VQ6 F;  5EYP B;  1S72 F;  1RQ7 A;  2OTL F;  3JAK B;  4O2A B;  5EZY A;  2ENN A;  1X7P A;  1V1I A;  3U0O A;  1YQN A;  3NMU C;  3VOB A;  2X52 A;  5LYJ B;  4SGB I;  2LBX A;  3HKD A;  3HWU A;  3JAM M;  1K7T A;  5EZY B;  4UXJ A;  1QU9 A;  2QQD A;  4C8I A;  2CZW A;  3OXL A;  1SGP I;  3WJR A;  5CB4 B;  1W59 A;  2IQQ A;  3LWV C;  5IJ0 A;  2ALE A;  2X3T A;  3C9S A;  5LOV B;  1UVF A;  3LWQ C;  2QQC A;  5ITZ A;  1YTP A;  2KMQ A;  5IJ0 B;  3LME A;  2DIP A;  2H8E A;  3OON A;  1GZ0 A;  3M4S A;  1TUS A;  1E7K A;  3RYH A;  4HGU A;  1Y1B A;  5JCO C;  3CYQ A;  4NQ3 A;  2JZM A;  3GTZ A;  1CSO I;  2OD1 A;  1ULK A;  2LUY A;  2CHT A;  1YHQ F;  1VK3 A;  1RFH A;  1Z5V A;  1CGI I;  5J8F A;  5E3R A;  3KJJ A;  2KTV A;  2SGQ I;  1QAH A;  3ZP7 A;  5C8Y A;  3FFM A;  2Y0M A;  1W40 A;  3TD5 A;  5B8F A;  5HXU A;  3CG6 A;  4TUY B;  1WTJ A;  3K12 A;  4I50 A;  4BT3 A;  1IV1 A;  1W3E X;  5JCO A;  1AN1 I;  3TO9 A;  1W42 A;  3HKE A;  2HX0 A;  4O4J A;  5AVM A;  3CCQ F;  4U3J A;  3RYI A;  5FJ4 C;  2N52 A;  1T0A A;  2BUS A;  1MJB A;  2ENZ A;  4I50 B;  1W5E A;  1U3L A;  4O4J B;  3V3T A;  3F0D A;  5IYZ B;  4U3J B;  3D00 A;  2VXY A;  2P6Y A;  4ZOL A;  3C9R A;  3CC2 F;  1HDL A;  2CHS A;  1DS2 I;  1U43 A;  2PMP A;  4RHA A;  3UT5 A;  4IIJ B;  3B4V C;  2P6A C;  1LR9 A;  2ZOV A;  2UYK A;  2V1C C;  5MN4 A;  2H6L A;  5CCL A;  1FAQ A;  3JVH A;  3E22 A;  4X20 B;  2OU2 A;  4UXI A;  3LFO A;  4GI3 C;  3C8L A;  3LWO C;  5EO3 A;  5FLX M;  4TV9 B;  1OMU A;  1P9G A;  2HRY A;  4EB6 A;  2L8E A;  2SGF I;  1H7M A;  5LP6 B;  1YU6 C;  1HEV A;  1PXW A;  4NUT A;  2M5X A;  3VYU C;  1W3S A;  3F0F A;  3V4D A;  2A20 A;  1NMU B;  3JAS A;  1DS3 I;  3JAT B;  2UYP A;  2V1C A;  3OW2 F;  1TVK A;  2UYN B;  3VI6 A;  2SGE I;  5KMG A;  1Q86 H;  2HRU A;  3WGM A;  1SGR I;  4BT6 A;  4X1I B;  2JW6 A;  1NXU A;  2R6R 1;  1FYB A;  1SZQ A;  4C82 A;  4WBN A;  3RYC A;  2QTP A;  3CYP B;  3OXF A;  1XRG A;  1S20 A;  2N71 A;  3VDP A;  5JH7 B;  3CCL F;  1M1K H;  3KE1 A;  2OZB A;  3CD6 F;  2Z1E A;  1KC8 H;  2QPO A;  2IAF A;  5EIB D;  3C9U A;  4YJ2 B;  5G4V C;  3JAW B;  1XX6 A;  2CJS C;  3VYT C;  3QUW A;  1PCE A;  2ROW A;  3QHD A;  1SA0 A;  3E1Y A;  1YGY A;  2F3C I;  4I55 B;  4ZHW A;  4BY9 D;  2F9Z C;  1X25 A;  2VRW B;  2BTO A;  1SA0 B;  3RU0 A;  1CT2 I;  2L26 A;  4AML A;  1BUS A;  1IY6 A;  5GAN K;  4PWT A;  4DRX B;  2QEX F;  3E2I A;  1CT4 I;  3CC4 F;  4X1Y A;  4LNU B;  2GKV A;  3OVO A;  1W57 A;  1V1H A;  2SGD I;  2RB9 A;  1N8R H;  2VGN A;  2QI2 A;  3R5C A;  3CME F;  1YIT F;  2Z1F A;  3I3F A;  1BMO A;  4FFB B;  3HKC B;  3I7T A;  1PPF I;  3MQW A;  4G88 A;  4FKD A;  1Z7K B;  5HP8 A;  4E6E A;  3S03 A;  1CLI A;  1CT0 I;  1R79 A;  1VH8 A;  3RYF A;  5CA1 B;  3ZP4 A;  1K73 H;  3G4S F;  2ERW A;  2ZVZ A;  2JNB A;  3JCM M;  2IG8 A;  3WGN A;  2UZ3 A;  4C8G A;  3KJK A;  2UZH A;  5IJ9 B;  5FNV B;  3CCV F;  5MN6 A;  5GIP C;  3CB2 A;  2OTM A;  2I6R A;  2Q1Y A;  2NU1 I;  1TIH A;  3CXL A;  1PF5 A;  2GIV A;  4ZI7 A;  5CCM A;  4C4W C;  4B5C A;  2W8B C;  1Q82 H;  1P9Z A;  5GON A;  5CA0 A;  1XHO A;  4O4I A;  1PTQ A;  3TOA A;  3HKD B;  2V53 A;  1FY7 A;  3UGL A;  4E1P A;  1ZWZ A;  3UGD A;  2KG4 A;  3D54 A;  2LCA A;  3MBM A;  4E1R A;  3P4E A;  5EWR A;  4O4H A;  3N2K A;  1FFX A;  2QA4 F;  2HP0 A;  2YQP A;  3SGB I;  1HPT A;  2HQS C;  1TBN A;  3IMP A;  3F0E A;  1H48 A;  3CCJ F;  2NU0 I;  5ITZ B;  2K1S A;  4DXD A;  5BMV A;  1CGJ I;  1QVG F;  1H0Z A;  5HI7 A;  2ZVY A;  3KIZ A;  2GVI A;  1VQ8 F;  4IHJ A;  2WCY A;  1Q8R A;  2YXZ A;  3NK6 A;  3I56 F;  3CCS F;  5EX3 A;  3UGI A;  3RYH B;  2LBT A;  5BMV B;  3F6M A;  4I4T A;  4DNC A;  1Q9B A;  1VQP F;  1WGT A;  4IHJ B;  1CE3 A;  1LR7 A;  3FBA A;  1KD1 H;  2B8T A;  2YYE A;  5GAP K;  3K0T A;  3OBW A;  1NUB A;  5J2U A;  2N17 A;  3VOA A;  1IY5 A;  4XCQ A;  2J9R A;  5C8Y B;  3PDN A;  3R5D A;  1GO1 A;  2JYY A;  3CCE F;  3R0P A;  1JFF A;  4TV8 A;  2B33 A;  2VAM A;  4U39 A;  2CWG A;  5EX0 A;  2PQ8 A;  1TUB A;  3HKE B;  1QD9 A;  4YJ3 A;  4NWO B;  5HY1 A;  3RYI B;  1RLU A;  2AIZ P;  3SIU A;  3CPW F;  1TUB B;  1FAR A;  2UVO A;  3ELC A;  4BW0 B;  4ERH A;  3LWP C;  1UVG A;  3WJP A;  3D01 A;  2HS0 A;  5HY4 A;  3VE5 A;  3T80 A;  2GKR I;  2UYJ A;  4ZOL B;  3IKF A;  4F6R A;  1DBF A;  1UI9 A;  3ERN A;  1RA4 A;  1W58 1;  3UT5 B;  2H8C A;  4X3M A;  1SGQ I;  3E22 B;  2JXD A;  5JVD A;  3GHZ A;  2LEO A;  3UEJ A;  3G6E F;  4RQO A;  3KY9 A;  3ON1 A;  3WXM B;  4O4L A;  4EB6 B;  2YUU A;  3OBY A;  3S0H A;  3R5A A;  1Y1C A;  3S0Y A;  1W2B F;  3JAL A;  4X3L A;  3HTN A;  3JAS B;  4EI9 A;  4O4L B;  3GYQ A;  5HXZ A;  1TVK B;  2RHO A;  2PHN A;  2Z01 A;  5JQG A;  5KMG B;  1MJA A;  1ULN A;  3MEK A;  4O2B B;  5MN5 A;  4M8I A;  2CWF A;  2VAP A;  4G4V A;  1UUC A;  1VQ7 F;  2KMR A;  3DDN A;  3DC2 A;  3LYB A;  4WBN B;  3RYC B;  1X7O A;  5JQG B;  1OYV I;  4BT2 A;  3V7Q A;  4BVS A;  3TO7 A;  2NU3 I;  3CCU F;  1KQS F;  5LXT A;  5J2T A;  3JAR A;  1JJ2 F;  3QAH A;  2GZL A;  5A2Q M;  1QVF F;  1RQ2 A;  1K8A H;  1U5K A;  5GIN C;  5KX5 A;  1H47 A;  1OFU A;  5J2T B;  1VQ9 F;  3VTI C;  3CC7 F;  1TOT A;  1Z5W A;  2KGW A;  3TO6 A;  1W5A A;  3NVI B;  1W4R A;  3NK7 A;  2NU4 I;  2QQ0 A;  3CXC F;  1YJ9 F;  2HVY D;  3NVK E;  2OHW A;  1OVO A;  2GLZ A;  5KX5 B;  2Q1X A;  2RC4 A;  3TOB A;  1IPA A;  4BVQ A;  1CHO I;  3BJI A;  3WJQ A;  3LDT A;  3S02 A;  1Y8F A;  4X1Y B;  1SGD I;  2XRC A;  4G4Z A;  1VHA A;  1RLG A;  1VDD A;  2QQE A;  2CWJ A;  1K9M H;  4X1K A;  1HJA I;  2CSL A;  3FPI A;  3B6N A;  1SGN I;  4O2B A;  4C81 A;  1VQM F;  3QWP A;  1KBF A;  3CPQ A;  3UFF A;  2N1A B;  1MT1 A;  2KMO A;  3RYF B;  3R5B A;  1VQO F;  4BT4 A;  5HP7 A;  2FGY A;  5IT9 M; 
#chains in the Genus database with same CATH homology
 2DB6 A;  3UEY A;  3SEK C;  3SIV A;  1VQL F;  2BO1 A;  5HY0 A;  1VQK F;  4LCK A;  1M8C A;  2W0T A;  2K9H A;  2OVO A;  2JA1 A;  4TZZ A;  4EI7 A;  1Q81 H;  1DT9 A;  1X52 A;  2VGM A;  5DAE A;  1X74 A;  5JHW C;  1XBT A;  2I6D A;  3PLA C;  3N4Y A;  1PTR A;  3AGK A;  1LR8 A;  4UXH A;  1TUR A;  1KMA A;  2FC3 A;  2WAL A;  1TBR R;  5HY2 A;  4BVR A;  1Q7Y H;  3HH2 C;  5FUV A;  2LBW A;  1PJU A;  2E5R A;  3VMF B;  3E59 A;  4OVO A;  1M90 H;  2GKT I;  2KTU A;  3J80 M;  3VDU A;  1X4S A;  1OMT A;  5FUW A;  1YIJ F;  1CK2 A;  2ORV A;  3J81 M;  3I55 F;  5DCV A;  3N4Z A;  3PAF A;  4BVT A;  5GIO C;  3TJQ A;  3LWR C;  1YJN F;  2ARP F;  3O85 A;  3GOX A;  2KCX A;  3OXG A;  1T0K B;  1SDS A;  3CMA F;  3J7A R;  5FUY A;  4EI8 A;  2NU2 I;  4B6D A;  2SGP I;  3MCA B;  1TBO A;  5HWE A;  3OL0 A;  4A24 A;  2ORW A;  1TGS I;  2WVJ A;  3RA6 A;  3CCM F;  2B0U C;  1R0R I;  1VQ5 F;  1TBQ R;  1GO0 A;  3FC3 A;  1NJI H;  1XBI A;  3G71 F;  2E73 A;  1N13 A;  2AIF A;  3IR9 A;  1IW4 A;  4L9M A;  2L7X A;  1XA6 A;  1W41 A;  5FUX A;  1VQN F;  5HQ8 A;  1SGY I;  3QTL D;  1YJW F;  1M8B A;  5G4U C;  1KBE A;  3HAX D;  3V7E A;  1SGE I;  2KMP A;  3HJW C;  2J87 A;  4JCV E;  3E20 B;  2OTJ F;  3RA5 A;  2FNF X;  1CN7 A;  1VQ4 F;  2ODD A;  1YI2 F;  3SGQ I;  2ELI A;  1VQ6 F;  1S72 F;  2OTL F;  2ENN A;  1X7P A;  1V1I A;  3NMU C;  4SGB I;  2LBX A;  3JAM M;  4UXJ A;  2QQD A;  2CZW A;  3OXL A;  1SGP I;  3LWV C;  2ALE A;  1UVF A;  3LWQ C;  2QQC A;  1YTP A;  2KMQ A;  2DIP A;  1GZ0 A;  1TUS A;  1E7K A;  4HGU A;  1Y1B A;  4NQ3 A;  2JZM A;  1CSO I;  2OD1 A;  2LUY A;  1YHQ F;  1RFH A;  1CGI I;  2KTV A;  2SGQ I;  3FFM A;  1W40 A;  5HXU A;  3CG6 A;  1W3E X;  1AN1 I;  1W42 A;  3CCQ F;  5FJ4 C;  2N52 A;  2BUS A;  2ENZ A;  3V3T A;  3D00 A;  3CC2 F;  1HDL A;  1DS2 I;  3B4V C;  2P6A C;  1LR9 A;  2V1C C;  5CCL A;  1FAQ A;  4UXI A;  3LFO A;  4GI3 C;  3LWO C;  5EO3 A;  5FLX M;  1OMU A;  2L8E A;  2SGF I;  1H7M A;  1YU6 C;  1PXW A;  4NUT A;  2M5X A;  1W3S A;  2A20 A;  1NMU B;  1DS3 I;  2V1C A;  3OW2 F;  3VI6 A;  2SGE I;  1Q86 H;  1SGR I;  2JW6 A;  1FYB A;  3OXF A;  2N71 A;  3VDP A;  3CCL F;  1M1K H;  2OZB A;  3CD6 F;  1KC8 H;  2QPO A;  5G4V C;  1XX6 A;  2CJS C;  1PCE A;  2ROW A;  3E1Y A;  2F3C I;  4BY9 D;  2F9Z C;  2VRW B;  3RU0 A;  1CT2 I;  1BUS A;  1IY6 A;  5GAN K;  2QEX F;  3E2I A;  1CT4 I;  3CC4 F;  2GKV A;  3OVO A;  1V1H A;  2SGD I;  1N8R H;  2VGN A;  2QI2 A;  3CME F;  1YIT F;  1BMO A;  1PPF I;  4FKD A;  1Z7K B;  1CT0 I;  1R79 A;  1K73 H;  3G4S F;  2ERW A;  2JNB A;  3JCM M;  2UZ3 A;  3CCV F;  5GIP C;  2NU1 I;  1TIH A;  3CXL A;  5CCM A;  4C4W C;  1Q82 H;  1PTQ A;  2V53 A;  2KG4 A;  3UGL A;  1ZWZ A;  3UGD A;  4E1P A;  4E1R A;  5EWR A;  2QA4 F;  2YQP A;  3SGB I;  1HPT A;  1TBN A;  3CCJ F;  2NU0 I;  1CGJ I;  1QVG F;  1H0Z A;  5HI7 A;  2GVI A;  1VQ8 F;  2WCY A;  3NK6 A;  3I56 F;  3CCS F;  5EX3 A;  3UGI A;  1VQP F;  1CE3 A;  1LR7 A;  1KD1 H;  2B8T A;  5GAP K;  3OBW A;  1NUB A;  2N17 A;  1IY5 A;  4XCQ A;  2J9R A;  3PDN A;  1GO1 A;  2JYY A;  3CCE F;  5EX0 A;  5HY1 A;  3SIU A;  3CPW F;  1FAR A;  4BW0 B;  3LWP C;  1UVG A;  5HY4 A;  3VE5 A;  2GKR I;  1RA4 A;  4X3M A;  1SGQ I;  2JXD A;  2LEO A;  3UEJ A;  3G6E F;  3WXM B;  3KY9 A;  3ON1 A;  2YUU A;  3OBY A;  1Y1C A;  1W2B F;  4X3L A;  4EI9 A;  3GYQ A;  5HXZ A;  3MEK A;  1UUC A;  1VQ7 F;  2KMR A;  1X7O A;  1OYV I;  4BVS A;  3V7Q A;  2NU3 I;  3CCU F;  1KQS F;  1JJ2 F;  5A2Q M;  1QVF F;  1K8A H;  1U5K A;  5GIN C;  1VQ9 F;  3CC7 F;  1TOT A;  3NVI B;  3NK7 A;  1W4R A;  2NU4 I;  2QQ0 A;  3CXC F;  1YJ9 F;  2HVY D;  3NVK E;  2OHW A;  1OVO A;  2GLZ A;  1IPA A;  4BVQ A;  1CHO I;  3BJI A;  1Y8F A;  1SGD I;  2XRC A;  1RLG A;  1VDD A;  2QQE A;  1K9M H;  1HJA I;  1SGN I;  1VQM F;  3QWP A;  1KBF A;  3CPQ A;  3UFF A;  2N1A B;  1MT1 A;  2KMO A;  1VQO F;  3CCR F;  2FGY A;  5IT9 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...