2B0UC

The structure of the follistatin:activin complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
288
structure length
287
Chain Sequence
GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inhibin beta A chain
publication title The Structure of the Follistatin:Activin Complex Reveals Antagonism of Both Type I and Type II Receptor Binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 49
structure length 287
sequence length 288
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
C PF09289 FOLN Follistatin/Osteonectin-like EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2b0uC04
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2b0uC03
3.30.60.250 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2b0uC02
3.90.290.10 Alpha Beta Alpha-Beta Complex Extracellular Matrix Fibrillin TGF-beta binding (TB) domain 2b0uC01
1CHOI 2W86A 1H0ZA 1UZQA 1CSOI 1DS2I 3SGBI 1HDLA 1OMUA 2KMRA 1TUSA 2P6AC 1CGJI 2N52A 1UVFA 1SGNI 1Y1BA 1YU6C 1N13A 4HGUA 1UZPA 1KSQA 4SGBI 1LR7A 2KMQA 5DAEA 1OVOA 1PCEA 1Y1CA 2GKTI 1YTPA 2SGDI 2ARPF 1CT0I 1OYVI 2KCXA 2QQCA 2GKRI 3SGQI 1LR8A 2N17A 2NU2I 2NU0I 1BUSA 1CE3A 1IW4A 1HPTA 3QTLD 1CT4I 1SGDI 3TJQA 2GKVA 2XRCA 1OMTA 1PPFI 3HH2C 1SGEI 2ERWA 2JYYA 1M8BA 1SGYI 1LR9A 1APJA 1R0RI 2N71A 2NU1I 1TBRR 1UZKA 1DS3I 2KMOA 2KMPA 2JZMA 2SGFI 2WCYA 4OVOA 3OVOA 2LEOA 2OVOA 1NUBA 1Z7KB 1TGSI 1IY5A 1TURA 2SGEI 1CGII 2SGPI 1SGRI 2M5XA 1M8CA 1IY6A 1AN1I 1SGPI 1UUCA 5JHWC 1TBQR 1UZJA 1KMAA 3B4VC 1MT1A 2B0UC 1FYBA 1TIHA 2BUSA 1SGQI 1HJAI 2NU3I 2JXDA 1BMOA 4GI3C 2V53A 3SEKC 1CT2I 2QQDA 2F3CI 1UVGA 2NU4I 1PJUA 2SGQI
chains in the Genus database with same CATH superfamily
1ULKA 2DB6A 1CHOI 4UXJA 1MJAA 2A20A 3VDUA 1H0ZA 3R5CA 1UZQA 2W86A 2JA1A 1CSOI 1XBTA 1P9ZA 1DS2I 2K9HA 2E5RA 3TOBA 3MEKA 1P9GA 3SGBI 3BJIA 1HDLA 1OMUA 1R79A 1RFHA 2KMRA 1S20A 1TUSA 1PTRA 2P6AC 1CGJI 2N52A 1UHAA 1UVFA 2V1CC 3R5BA 3VE5A 1SGNI 1PTQA 1X74A 1Y1BA 2V1CA 2WGCA 5FUXA 1YU6C 2E73A 3QAHA 3OXLA 3FSXA 1N13A 2ENZA 4HGUA 1V1HA 1UZPA 1FARA 2L7XA 1KSQA 4SGBI 1LR7A 4B6DA 3UGDA 2YUUA 1MJ9A 2KMQA 1U5KA 5DAEA 2OZUA 1OVOA 1PCEA 2GIVA 1WGCA 4FKDA 1Y1CA 2GKTI 1YTPA 2SGDI 5J8FA 2ARPF 2CJSC 1CT0I 1OYVI 2KCXA 5FUVA 1Y8FA 2QQCA 2WVJA 2B8TA 1HEVA 2L8EA 3UFFA 3VDPA 2GKRI 1FY7A 3SGQI 2LB7A 2W0TA 1LR8A 1MJBA 2N17A 3TO9A 2NU2I 2NU0I 1KBFA 3TO6A 2OD1A 3R5AA 2ORWA 3RU0A 3CXLA 1X4SA 3UEJA 5E3PA 3E2IA 5CCLA 1BUSA 5E3QA 1CE3A 2VRWB 2X3TA 1HPTA 3PDNA 1IW4A 3QTLD 1XX6A 1CT4I 1SGDI 3TJQA 4A24A 2GKVA 5FUYA 3OL0A 1WGTA 2XRCA 5FUWA 1OMTA 1XA6A 3KY9A 1PPFI 3HH2C 1SGEI 2ERWA 1VDDA 2JYYA 2DKVA 4UXHA 1W3SA 4E1PA 3UOEA 1M8BA 1Z2IA 1SGYI 1LR9A 1K7UA 9WGAA 1K7VA 4MPIA 1R0RI 2J87A 1APJA 4AMLA 2N1AB 2N71A 2ODDA 2NU1I 2QPOA 1TBRR 3UGLA 1UZKA 5HI7A 2CWFA 1DS3I 3TO7A 2DIPA 2KMOA 2PQ8A 1Q9BA 1K7TA 2KMPA 2FNFX 2CWGA 2JZMA 1ULMA 2SGFI 2WCYA 3OVOA 4OVOA 5EX0A 3TOAA 2UZ3A 2OU2A 2LEOA 2OVOA 5CCMA 2UVOA 4UXIA 2ENNA 1ULNA 1NUBA 1Z7KB 1TGSI 3R5DA 1IY5A 2ELIA 2RC4A 2YQPA 5HQ8A 2RIJA 2X52A 2CWHA 4L9MA 1TURA 1TOTA 1CGII 2J9RA 2SGPI 2SGEI 5EX3A 3GOXA 3E59A 3UEYA 5J8CA 1V1IA 1SGRI 1TBOA 2LUYA 3QWPA 1WTJA 2M5XA 1KBEA 1M8CA 1IY6A 1AN1I 1SGPI 1TBNA 1UUCA 1TBQR 3FSYA 3OXGA 4WP4A 5JHWC 1KMAA 3B4VC 1UZJA 1MT1A 2GVIA 4E1RA 2B0UC 3UGIA 1FYBA 1TIHA 2BUSA 7WGAA 1SGQI 1HJAI 2NU3I 2Y0MA 1W4RA 1WKXA 2JXDA 1BMOA 2QQ0A 4GI3C 2JW6A 2QQEA 2V53A 1NXUA 4JCVE 3SEKC 1CT2I 4DNCA 2QQDA 5E3RA 1FAQA 2F3CI 1UVGA 2ROWA 3OXFA 2NU4I 3D00A 3FC3A 2ORVA 1PJUA 2SGQI
chains in the Genus database with same CATH topology
2DB6A 1CHOI 4UXJA 3VDUA 2A20A 1H0ZA 2W86A 1UZQA 2JA1A 1CSOI 1XBTA 1DS2I 2K9HA 2E5RA 3MEKA 3SGBI 3BJIA 1HDLA 1OMUA 1R79A 1RFHA 2KMRA 1TUSA 2P6AC 1PTRA 1CGJI 2N52A 2V1CC 1UVFA 3VE5A 1SGNI 1PTQA 1X74A 1Y1BA 2V1CA 5FUXA 1YU6C 2E73A 3OXLA 1N13A 2ENZA 4HGUA 1V1HA 1UZPA 1FARA 2L7XA 1KSQA 4SGBI 1LR7A 3UGDA 2YUUA 2KMQA 5DAEA 1U5KA 1OVOA 1PCEA 4FKDA 1Y1CA 2GKTI 1YTPA 2SGDI 2ARPF 2CJSC 1CT0I 1OYVI 2KCXA 5FUVA 1Y8FA 2QQCA 2WVJA 2B8TA 2L8EA 3UFFA 3VDPA 2GKRI 3SGQI 2W0TA 1LR8A 2N17A 2NU2I 2NU0I 1KBFA 2OD1A 2ORWA 3RU0A 3CXLA 1X4SA 3UEJA 3E2IA 5CCLA 1BUSA 1CE3A 2VRWB 1IW4A 1HPTA 3PDNA 3QTLD 1XX6A 1CT4I 1SGDI 3TJQA 4A24A 2GKVA 5FUYA 3OL0A 2XRCA 1OMTA 1XA6A 3KY9A 1PPFI 3HH2C 1SGEI 2ERWA 1VDDA 2JYYA 4UXHA 1W3SA 4E1PA 1M8BA 1SGYI 1LR9A 1APJA 1R0RI 2J87A 2N1AB 2N71A 2ODDA 2NU1I 2QPOA 1TBRR 3UGLA 1UZKA 5HI7A 1DS3I 2DIPA 2KMOA 5FUWA 2KMPA 2FNFX 2JZMA 2SGFI 2WCYA 4B6DA 4OVOA 3OVOA 5EX0A 2UZ3A 2LEOA 2OVOA 5CCMA 4UXIA 2ENNA 1NUBA 1Z7KB 1TGSI 1IY5A 2ELIA 2YQPA 5HQ8A 4L9MA 1TURA 1TOTA 1CGII 2J9RA 2SGPI 2SGEI 5EX3A 3GOXA 3E59A 3UEYA 1V1IA 1SGRI 1TBOA 2LUYA 3QWPA 2M5XA 1KBEA 1M8CA 1IY6A 1AN1I 1SGPI 1TBNA 1UUCA 1TBQR 3OXGA 5JHWC 1UZJA 1KMAA 3B4VC 1MT1A 2GVIA 4E1RA 2B0UC 3UGIA 1FYBA 1TIHA 2BUSA 1SGQI 1HJAI 2NU3I 1W4RA 2JXDA 2QQ0A 1BMOA 4GI3C 2JW6A 2QQEA 2V53A 4JCVE 3SEKC 1CT2I 2QQDA 1FAQA 2F3CI 1UVGA 2ROWA 3OXFA 2NU4I 3D00A 3FC3A 2ORVA 1PJUA 2SGQI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CHO I;  2W86 A;  1H0Z A;  1UZQ A;  1CSO I;  1DS2 I;  3SGB I;  1HDL A;  1OMU A;  2KMR A;  1TUS A;  2P6A C;  1CGJ I;  2N52 A;  1UVF A;  1SGN I;  1Y1B A;  1YU6 C;  1N13 A;  4HGU A;  1UZP A;  1KSQ A;  4SGB I;  1LR7 A;  2KMQ A;  5DAE A;  1OVO A;  1PCE A;  1Y1C A;  2GKT I;  1YTP A;  2SGD I;  2ARP F;  1CT0 I;  1OYV I;  2KCX A;  2QQC A;  2GKR I;  3SGQ I;  1LR8 A;  2N17 A;  2NU2 I;  2NU0 I;  1BUS A;  1CE3 A;  1IW4 A;  1HPT A;  3QTL D;  1CT4 I;  1SGD I;  3TJQ A;  2GKV A;  2XRC A;  1OMT A;  1PPF I;  3HH2 C;  1SGE I;  2ERW A;  2JYY A;  1M8B A;  1SGY I;  1LR9 A;  1APJ A;  1R0R I;  2N71 A;  2NU1 I;  1TBR R;  1UZK A;  1DS3 I;  2KMO A;  2KMP A;  2JZM A;  2SGF I;  2WCY A;  4OVO A;  3OVO A;  2LEO A;  2OVO A;  1NUB A;  1Z7K B;  1TGS I;  1IY5 A;  1TUR A;  2SGE I;  1CGI I;  2SGP I;  1SGR I;  2M5X A;  1M8C A;  1IY6 A;  1AN1 I;  1SGP I;  1UUC A;  5JHW C;  1TBQ R;  1UZJ A;  1KMA A;  3B4V C;  1MT1 A;  2B0U C;  1FYB A;  1TIH A;  2BUS A;  1SGQ I;  1HJA I;  2NU3 I;  2JXD A;  1BMO A;  4GI3 C;  2V53 A;  3SEK C;  1CT2 I;  2QQD A;  2F3C I;  1UVG A;  2NU4 I;  1PJU A;  2SGQ I; 
#chains in the Genus database with same CATH topology
 1ULK A;  2DB6 A;  1CHO I;  4UXJ A;  1MJA A;  2A20 A;  3VDU A;  1H0Z A;  3R5C A;  1UZQ A;  2W86 A;  2JA1 A;  1CSO I;  1XBT A;  1P9Z A;  1DS2 I;  2K9H A;  2E5R A;  3TOB A;  3MEK A;  1P9G A;  3SGB I;  3BJI A;  1HDL A;  1OMU A;  1R79 A;  1RFH A;  2KMR A;  1S20 A;  1TUS A;  1PTR A;  2P6A C;  1CGJ I;  2N52 A;  1UHA A;  1UVF A;  2V1C C;  3R5B A;  3VE5 A;  1SGN I;  1PTQ A;  1X74 A;  1Y1B A;  2V1C A;  2WGC A;  5FUX A;  1YU6 C;  2E73 A;  3QAH A;  3OXL A;  3FSX A;  1N13 A;  2ENZ A;  4HGU A;  1V1H A;  1UZP A;  1FAR A;  2L7X A;  1KSQ A;  4SGB I;  1LR7 A;  4B6D A;  3UGD A;  2YUU A;  1MJ9 A;  2KMQ A;  1U5K A;  5DAE A;  2OZU A;  1OVO A;  1PCE A;  2GIV A;  1WGC A;  4FKD A;  1Y1C A;  2GKT I;  1YTP A;  2SGD I;  5J8F A;  2ARP F;  2CJS C;  1CT0 I;  1OYV I;  2KCX A;  5FUV A;  1Y8F A;  2QQC A;  2WVJ A;  2B8T A;  1HEV A;  2L8E A;  3UFF A;  3VDP A;  2GKR I;  1FY7 A;  3SGQ I;  2LB7 A;  2W0T A;  1LR8 A;  1MJB A;  2N17 A;  3TO9 A;  2NU2 I;  2NU0 I;  1KBF A;  3TO6 A;  2OD1 A;  3R5A A;  2ORW A;  3RU0 A;  3CXL A;  1X4S A;  3UEJ A;  5E3P A;  3E2I A;  5CCL A;  1BUS A;  5E3Q A;  1CE3 A;  2VRW B;  2X3T A;  1HPT A;  3PDN A;  1IW4 A;  3QTL D;  1XX6 A;  1CT4 I;  1SGD I;  3TJQ A;  4A24 A;  2GKV A;  5FUY A;  3OL0 A;  1WGT A;  2XRC A;  5FUW A;  1OMT A;  1XA6 A;  3KY9 A;  1PPF I;  3HH2 C;  1SGE I;  2ERW A;  1VDD A;  2JYY A;  2DKV A;  4UXH A;  1W3S A;  4E1P A;  3UOE A;  1M8B A;  1Z2I A;  1SGY I;  1LR9 A;  1K7U A;  9WGA A;  1K7V A;  4MPI A;  1R0R I;  2J87 A;  1APJ A;  4AML A;  2N1A B;  2N71 A;  2ODD A;  2NU1 I;  2QPO A;  1TBR R;  3UGL A;  1UZK A;  5HI7 A;  2CWF A;  1DS3 I;  3TO7 A;  2DIP A;  2KMO A;  2PQ8 A;  1Q9B A;  1K7T A;  2KMP A;  2FNF X;  2CWG A;  2JZM A;  1ULM A;  2SGF I;  2WCY A;  3OVO A;  4OVO A;  5EX0 A;  3TOA A;  2UZ3 A;  2OU2 A;  2LEO A;  2OVO A;  5CCM A;  2UVO A;  4UXI A;  2ENN A;  1ULN A;  1NUB A;  1Z7K B;  1TGS I;  3R5D A;  1IY5 A;  2ELI A;  2RC4 A;  2YQP A;  5HQ8 A;  2RIJ A;  2X52 A;  2CWH A;  4L9M A;  1TUR A;  1TOT A;  1CGI I;  2J9R A;  2SGP I;  2SGE I;  5EX3 A;  3GOX A;  3E59 A;  3UEY A;  5J8C A;  1V1I A;  1SGR I;  1TBO A;  2LUY A;  3QWP A;  1WTJ A;  2M5X A;  1KBE A;  1M8C A;  1IY6 A;  1AN1 I;  1SGP I;  1TBN A;  1UUC A;  1TBQ R;  3FSY A;  3OXG A;  4WP4 A;  5JHW C;  1KMA A;  3B4V C;  1UZJ A;  1MT1 A;  2GVI A;  4E1R A;  2B0U C;  3UGI A;  1FYB A;  1TIH A;  2BUS A;  7WGA A;  1SGQ I;  1HJA I;  2NU3 I;  2Y0M A;  1W4R A;  1WKX A;  2JXD A;  1BMO A;  2QQ0 A;  4GI3 C;  2JW6 A;  2QQE A;  2V53 A;  1NXU A;  4JCV E;  3SEK C;  1CT2 I;  4DNC A;  2QQD A;  5E3R A;  1FAQ A;  2F3C I;  1UVG A;  2ROW A;  3OXF A;  2NU4 I;  3D00 A;  3FC3 A;  2ORV A;  1PJU A;  2SGQ I; 
#chains in the Genus database with same CATH homology
 2DB6 A;  1CHO I;  4UXJ A;  3VDU A;  2A20 A;  1H0Z A;  2W86 A;  1UZQ A;  2JA1 A;  1CSO I;  1XBT A;  1DS2 I;  2K9H A;  2E5R A;  3MEK A;  3SGB I;  3BJI A;  1HDL A;  1OMU A;  1R79 A;  1RFH A;  2KMR A;  1TUS A;  2P6A C;  1PTR A;  1CGJ I;  2N52 A;  2V1C C;  1UVF A;  3VE5 A;  1SGN I;  1PTQ A;  1X74 A;  1Y1B A;  2V1C A;  5FUX A;  1YU6 C;  2E73 A;  3OXL A;  1N13 A;  2ENZ A;  4HGU A;  1V1H A;  1UZP A;  1FAR A;  2L7X A;  1KSQ A;  4SGB I;  1LR7 A;  3UGD A;  2YUU A;  2KMQ A;  5DAE A;  1U5K A;  1OVO A;  1PCE A;  4FKD A;  1Y1C A;  2GKT I;  1YTP A;  2SGD I;  2ARP F;  2CJS C;  1CT0 I;  1OYV I;  2KCX A;  5FUV A;  1Y8F A;  2QQC A;  2WVJ A;  2B8T A;  2L8E A;  3UFF A;  3VDP A;  2GKR I;  3SGQ I;  2W0T A;  1LR8 A;  2N17 A;  2NU2 I;  2NU0 I;  1KBF A;  2OD1 A;  2ORW A;  3RU0 A;  3CXL A;  1X4S A;  3UEJ A;  3E2I A;  5CCL A;  1BUS A;  1CE3 A;  2VRW B;  1IW4 A;  1HPT A;  3PDN A;  3QTL D;  1XX6 A;  1CT4 I;  1SGD I;  3TJQ A;  4A24 A;  2GKV A;  5FUY A;  3OL0 A;  2XRC A;  1OMT A;  1XA6 A;  3KY9 A;  1PPF I;  3HH2 C;  1SGE I;  2ERW A;  1VDD A;  2JYY A;  4UXH A;  1W3S A;  4E1P A;  1M8B A;  1SGY I;  1LR9 A;  1APJ A;  1R0R I;  2J87 A;  2N1A B;  2N71 A;  2ODD A;  2NU1 I;  2QPO A;  1TBR R;  3UGL A;  1UZK A;  5HI7 A;  1DS3 I;  2DIP A;  2KMO A;  5FUW A;  2KMP A;  2FNF X;  2JZM A;  2SGF I;  2WCY A;  4B6D A;  4OVO A;  3OVO A;  5EX0 A;  2UZ3 A;  2LEO A;  2OVO A;  5CCM A;  4UXI A;  2ENN A;  1NUB A;  1Z7K B;  1TGS I;  1IY5 A;  2ELI A;  2YQP A;  5HQ8 A;  4L9M A;  1TUR A;  1TOT A;  1CGI I;  2J9R A;  2SGP I;  2SGE I;  5EX3 A;  3GOX A;  3E59 A;  3UEY A;  1V1I A;  1SGR I;  1TBO A;  2LUY A;  3QWP A;  2M5X A;  1KBE A;  1M8C A;  1IY6 A;  1AN1 I;  1SGP I;  1TBN A;  1UUC A;  1TBQ R;  3OXG A;  5JHW C;  1UZJ A;  1KMA A;  3B4V C;  1MT1 A;  2GVI A;  4E1R A;  2B0U C;  3UGI A;  1FYB A;  1TIH A;  2BUS A;  1SGQ I;  1HJA I;  2NU3 I;  1W4R A;  2JXD A;  2QQ0 A;  1BMO A;  4GI3 C;  2JW6 A;  2QQE A;  2V53 A;  4JCV E;  3SEK C;  1CT2 I;  2QQD A;  1FAQ A;  2F3C I;  1UVG A;  2ROW A;  3OXF A;  2NU4 I;  3D00 A;  3FC3 A;  2ORV A;  1PJU A;  2SGQ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...