2B0UC

The structure of the follistatin:activin complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
288
structure length
287
Chain Sequence
GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Inhibin beta A chain
publication title The Structure of the Follistatin:Activin Complex Reveals Antagonism of Both Type I and Type II Receptor Binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 287
sequence length 288
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
C PF09289 FOLN Follistatin/Osteonectin-like EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2b0uC04
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2b0uC03
3.30.60.250 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2b0uC02
3.90.290.10 Alpha Beta Alpha-Beta Complex Extracellular Matrix Fibrillin TGF-beta binding (TB) domain 2b0uC01
1CGII 2QQDA 1UZQA 2B0UC 1Z7KB 1OYVI 3TJQA 1TUSA 1KSQA 1OMTA 1DS2I 4OVOA 1YTPA 1SGYI 1CGJI 1CSOI 1LR8A 1PJUA 2NU3I 1AN1I 1H0ZA 2OVOA 4GI3C 2KMPA 1TURA 2M5XA 2ARPF 2QQCA 1TIHA 2NU4I 2N52A 1SGPI 2LEOA 2KMRA 1FYBA 1CHOI 2JZMA 4HGUA 2W86A 2V53A 2KMQA 2ERWA 1PPFI 2N71A 1KMAA 1YU6C 1M8CA 2KCXA 1Y1BA 2SGFI 1M8BA 1UZJA 1UVFA 2GKVA 3QTLD 1IY5A 2P6AC 2WCYA 2JYYA 1TGSI 2JXDA 1APJA 1BMOA 2F3CI 1TBQR 1SGRI 2GKRI 1BUSA 2SGEI 1CT2I 1NUBA 3HH2C 5DAEA 3B4VC 2SGPI 1UVGA 1HPTA 1CE3A 1HDLA 2N17A 1LR9A 1SGNI 3SGQI 1CT4I 1SGQI 1SGDI 5JHWC 1IY6A 2BUSA 1OMUA 1UUCA 1LR7A 2NU1I 2NU0I 1Y1CA 1DS3I 1TBRR 4SGBI 1IW4A 2GKTI 2KMOA 2SGQI 1SGEI 1N13A 1PCEA 1HJAI 1R0RI 1UZKA 3SGBI 1UZPA 1OVOA 2NU2I 3OVOA 1CT0I 2XRCA 2SGDI 1MT1A 3SEKC
chains in the Genus database with same CATH superfamily
3E2IA 1CGII 2QQDA 1UZQA 2B0UC 1Z7KB 1OYVI 1S20A 1WGTA 1Y8FA 1TUSA 3TJQA 1MJAA 1XX6A 1KSQA 1V1HA 1OMTA 1DS2I 4OVOA 3TOAA 3TO7A 1YTPA 4E1PA 1SGYI 2YUUA 2ODDA 3MEKA 1CGJI 4B6DA 1TBOA 1CSOI 4UXHA 1LR8A 1PJUA 4JCVE 3RU0A 5HI7A 2NU3I 1AN1I 3FSXA 5J8FA 2OVOA 4GI3C 1H0ZA 2KMPA 1TBNA 1TURA 2GVIA 2M5XA 2ARPF 2PQ8A 2V1CA 2QQCA 1TIHA 2NU4I 2WGCA 3SEKC 2N52A 1SGPI 5J8CA 2DB6A 3VE5A 3QWPA 1W4RA 2A20A 2KMRA 2LEOA 2Y0MA 5CCLA 1FYBA 2RIJA 4E1RA 1CHOI 2JZMA 1R79A 1PTQA 2V53A 4HGUA 1FAQA 2W86A 4A24A 2K9HA 1FY7A 2ENNA 3UGDA 1VDDA 2FNFX 2KMQA 2ERWA 2OU2A 1P9ZA 1PPFI 3UGIA 2UZ3A 1ULNA 2DKVA 2ROWA 2N71A 1KMAA 1YU6C 1M8CA 1Z2IA 2KCXA 3TO9A 4MPIA 1Y1BA 2SGFI 1M8BA 1UZJA 3OL0A 1WGCA 3UEYA 3E59A 1UVFA 1XBTA 3KY9A 3UFFA 2CWGA 2GKVA 1KBEA 2J9RA 2CWFA 1MJBA 3QTLD 2E5RA 3VDUA 1P9GA 2ORVA 2L8EA 4WP4A 5CCMA 1W3SA 3GOXA 1X4SA 2JA1A 4FKDA 1IY5A 2P6AC 2J87A 2X3TA 1FARA 2WCYA 2JYYA 3UEJA 1TGSI 1WTJA 2X52A 2JXDA 2L7XA 5FUYA 2OZUA 2LUYA 1APJA 1ULMA 3FSYA 2QQEA 3R5AA 1KBFA 1BMOA 2CJSC 5HQ8A 1Q9BA 1MJ9A 3CXLA 3UOEA 1U5KA 2QPOA 5E3RA 2F3CI 1TBQR 2ELIA 2CWHA 2LB7A 1SGRI 2GKRI 1BUSA 3OXLA 2SGEI 1CT2I 1NUBA 3HH2C 5DAEA 2N1AB 3TOBA 3B4VC 2SGPI 1UVGA 1HPTA 4DNCA 4AMLA 3QAHA 1CE3A 1HDLA 1HEVA 2W0TA 2N17A 1LR9A 1SGNI 2ORWA 5EX3A 5FUVA 3SGQI 1PTRA 1CT4I 1SGQI 1SGDI 2DIPA 1V1IA 2E73A 3OXFA 2VRWB 5JHWC 2GIVA 1IY6A 1WKXA 5E3QA 2BUSA 4UXIA 3TO6A 4UXJA 1OMUA 1UUCA 3R5BA 2JW6A 1LR7A 2NU1I 2NU0I 2V1CC 1ULKA 1X74A 1Y1CA 3BJIA 1RFHA 1DS3I 3R5DA 5FUWA 1TBRR 2B8TA 2QQ0A 4SGBI 5FUXA 1IW4A 2GKTI 1K7UA 2KMOA 2SGQI 1SGEI 1N13A 1PCEA 1HJAI 1R0RI 1UZKA 1XA6A 5E3PA 2OD1A 3OXGA 3SGBI 1K7VA 2WVJA 3PDNA 1UZPA 7WGAA 1OVOA 2NU2I 5EX0A 1K7TA 3OVOA 4L9MA 9WGAA 1CT0I 2RC4A 3VDPA 2UVOA 2YQPA 1UHAA 2XRCA 2ENZA 3D00A 3UGLA 3FC3A 3R5CA 2SGDI 1TOTA 1MT1A 1NXUA
chains in the Genus database with same CATH topology
3E2IA 1CGII 2QQDA 1UZQA 2B0UC 1Z7KB 1OYVI 3TJQA 1Y8FA 1TUSA 1XX6A 1KSQA 1V1HA 1OMTA 1DS2I 4OVOA 4E1PA 1YTPA 1SGYI 2YUUA 2ODDA 3MEKA 1CGJI 4B6DA 1TBOA 1CSOI 4UXHA 1LR8A 1PJUA 4JCVE 3RU0A 5HI7A 2NU3I 1AN1I 1H0ZA 2OVOA 4GI3C 2KMPA 1TBNA 1TURA 2GVIA 2M5XA 2ARPF 2V1CA 2QQCA 1TIHA 2NU4I 2N52A 1SGPI 2DB6A 3VE5A 3QWPA 2A20A 1W4RA 2KMRA 2LEOA 5CCLA 1FYBA 4E1RA 1CHOI 2JZMA 1R79A 1PTQA 2V53A 4HGUA 1FAQA 2W86A 4A24A 2K9HA 3UGDA 2ENNA 1VDDA 2FNFX 2KMQA 2ERWA 3UGIA 1PPFI 2UZ3A 2ROWA 2N71A 1KMAA 1YU6C 1M8CA 2KCXA 1Y1BA 2SGFI 1M8BA 1UZJA 3OL0A 3UEYA 3E59A 1UVFA 1XBTA 3KY9A 3UFFA 2GKVA 1KBEA 2J9RA 3QTLD 2E5RA 3VDUA 2ORVA 2L8EA 5CCMA 1W3SA 3GOXA 1X4SA 2JA1A 4FKDA 1IY5A 2P6AC 2J87A 1FARA 2WCYA 2JYYA 3UEJA 1TGSI 2JXDA 2L7XA 5FUYA 2LUYA 1APJA 2QQEA 1KBFA 1BMOA 2CJSC 5HQ8A 3CXLA 1U5KA 2QPOA 2F3CI 1TBQR 2ELIA 1SGRI 2GKRI 1BUSA 3OXLA 2SGEI 1CT2I 1NUBA 3HH2C 5DAEA 2N1AB 3B4VC 2SGPI 1UVGA 1HPTA 1CE3A 1HDLA 2W0TA 2N17A 1LR9A 1SGNI 2ORWA 5EX3A 5FUVA 3SGQI 1PTRA 1CT4I 1SGQI 1SGDI 2DIPA 1V1IA 2E73A 3OXFA 2VRWB 5JHWC 1IY6A 2BUSA 4UXIA 4UXJA 1OMUA 1UUCA 2JW6A 1LR7A 2NU1I 2NU0I 2V1CC 1X74A 1Y1CA 3BJIA 1RFHA 1DS3I 5FUWA 1TBRR 2B8TA 2QQ0A 4SGBI 5FUXA 1IW4A 2GKTI 2KMOA 2SGQI 1SGEI 1N13A 1PCEA 1HJAI 1R0RI 1UZKA 1XA6A 2OD1A 3OXGA 3SGBI 2WVJA 3PDNA 1UZPA 1OVOA 2NU2I 5EX0A 3OVOA 4L9MA 1CT0I 3VDPA 2YQPA 2XRCA 2ENZA 3D00A 3UGLA 3FC3A 2SGDI 1TOTA 1MT1A 3SEKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CGI I;  2QQD A;  1UZQ A;  2B0U C;  1Z7K B;  1OYV I;  3TJQ A;  1TUS A;  1KSQ A;  1OMT A;  1DS2 I;  4OVO A;  1YTP A;  1SGY I;  1CGJ I;  1CSO I;  1LR8 A;  1PJU A;  2NU3 I;  1AN1 I;  1H0Z A;  2OVO A;  4GI3 C;  2KMP A;  1TUR A;  2M5X A;  2ARP F;  2QQC A;  1TIH A;  2NU4 I;  2N52 A;  1SGP I;  2LEO A;  2KMR A;  1FYB A;  1CHO I;  2JZM A;  4HGU A;  2W86 A;  2V53 A;  2KMQ A;  2ERW A;  1PPF I;  2N71 A;  1KMA A;  1YU6 C;  1M8C A;  2KCX A;  1Y1B A;  2SGF I;  1M8B A;  1UZJ A;  1UVF A;  2GKV A;  3QTL D;  1IY5 A;  2P6A C;  2WCY A;  2JYY A;  1TGS I;  2JXD A;  1APJ A;  1BMO A;  2F3C I;  1TBQ R;  1SGR I;  2GKR I;  1BUS A;  2SGE I;  1CT2 I;  1NUB A;  3HH2 C;  5DAE A;  3B4V C;  2SGP I;  1UVG A;  1HPT A;  1CE3 A;  1HDL A;  2N17 A;  1LR9 A;  1SGN I;  3SGQ I;  1CT4 I;  1SGQ I;  1SGD I;  5JHW C;  1IY6 A;  2BUS A;  1OMU A;  1UUC A;  1LR7 A;  2NU1 I;  2NU0 I;  1Y1C A;  1DS3 I;  1TBR R;  4SGB I;  1IW4 A;  2GKT I;  2KMO A;  2SGQ I;  1SGE I;  1N13 A;  1PCE A;  1HJA I;  1R0R I;  1UZK A;  3SGB I;  1UZP A;  1OVO A;  2NU2 I;  3OVO A;  1CT0 I;  2XRC A;  2SGD I;  1MT1 A;  3SEK C; 
#chains in the Genus database with same CATH topology
 3E2I A;  1CGI I;  2QQD A;  1UZQ A;  2B0U C;  1Z7K B;  1OYV I;  1S20 A;  1WGT A;  1Y8F A;  1TUS A;  3TJQ A;  1MJA A;  1XX6 A;  1KSQ A;  1V1H A;  1OMT A;  1DS2 I;  4OVO A;  3TOA A;  3TO7 A;  1YTP A;  4E1P A;  1SGY I;  2YUU A;  2ODD A;  3MEK A;  1CGJ I;  4B6D A;  1TBO A;  1CSO I;  4UXH A;  1LR8 A;  1PJU A;  4JCV E;  3RU0 A;  5HI7 A;  2NU3 I;  1AN1 I;  3FSX A;  5J8F A;  2OVO A;  4GI3 C;  1H0Z A;  2KMP A;  1TBN A;  1TUR A;  2GVI A;  2M5X A;  2ARP F;  2PQ8 A;  2V1C A;  2QQC A;  1TIH A;  2NU4 I;  2WGC A;  3SEK C;  2N52 A;  1SGP I;  5J8C A;  2DB6 A;  3VE5 A;  3QWP A;  1W4R A;  2A20 A;  2KMR A;  2LEO A;  2Y0M A;  5CCL A;  1FYB A;  2RIJ A;  4E1R A;  1CHO I;  2JZM A;  1R79 A;  1PTQ A;  2V53 A;  4HGU A;  1FAQ A;  2W86 A;  4A24 A;  2K9H A;  1FY7 A;  2ENN A;  3UGD A;  1VDD A;  2FNF X;  2KMQ A;  2ERW A;  2OU2 A;  1P9Z A;  1PPF I;  3UGI A;  2UZ3 A;  1ULN A;  2DKV A;  2ROW A;  2N71 A;  1KMA A;  1YU6 C;  1M8C A;  1Z2I A;  2KCX A;  3TO9 A;  4MPI A;  1Y1B A;  2SGF I;  1M8B A;  1UZJ A;  3OL0 A;  1WGC A;  3UEY A;  3E59 A;  1UVF A;  1XBT A;  3KY9 A;  3UFF A;  2CWG A;  2GKV A;  1KBE A;  2J9R A;  2CWF A;  1MJB A;  3QTL D;  2E5R A;  3VDU A;  1P9G A;  2ORV A;  2L8E A;  4WP4 A;  5CCM A;  1W3S A;  3GOX A;  1X4S A;  2JA1 A;  4FKD A;  1IY5 A;  2P6A C;  2J87 A;  2X3T A;  1FAR A;  2WCY A;  2JYY A;  3UEJ A;  1TGS I;  1WTJ A;  2X52 A;  2JXD A;  2L7X A;  5FUY A;  2OZU A;  2LUY A;  1APJ A;  1ULM A;  3FSY A;  2QQE A;  3R5A A;  1KBF A;  1BMO A;  2CJS C;  5HQ8 A;  1Q9B A;  1MJ9 A;  3CXL A;  3UOE A;  1U5K A;  2QPO A;  5E3R A;  2F3C I;  1TBQ R;  2ELI A;  2CWH A;  2LB7 A;  1SGR I;  2GKR I;  1BUS A;  3OXL A;  2SGE I;  1CT2 I;  1NUB A;  3HH2 C;  5DAE A;  2N1A B;  3TOB A;  3B4V C;  2SGP I;  1UVG A;  1HPT A;  4DNC A;  4AML A;  3QAH A;  1CE3 A;  1HDL A;  1HEV A;  2W0T A;  2N17 A;  1LR9 A;  1SGN I;  2ORW A;  5EX3 A;  5FUV A;  3SGQ I;  1PTR A;  1CT4 I;  1SGQ I;  1SGD I;  2DIP A;  1V1I A;  2E73 A;  3OXF A;  2VRW B;  5JHW C;  2GIV A;  1IY6 A;  1WKX A;  5E3Q A;  2BUS A;  4UXI A;  3TO6 A;  4UXJ A;  1OMU A;  1UUC A;  3R5B A;  2JW6 A;  1LR7 A;  2NU1 I;  2NU0 I;  2V1C C;  1ULK A;  1X74 A;  1Y1C A;  3BJI A;  1RFH A;  1DS3 I;  3R5D A;  5FUW A;  1TBR R;  2B8T A;  2QQ0 A;  4SGB I;  5FUX A;  1IW4 A;  2GKT I;  1K7U A;  2KMO A;  2SGQ I;  1SGE I;  1N13 A;  1PCE A;  1HJA I;  1R0R I;  1UZK A;  1XA6 A;  5E3P A;  2OD1 A;  3OXG A;  3SGB I;  1K7V A;  2WVJ A;  3PDN A;  1UZP A;  7WGA A;  1OVO A;  2NU2 I;  5EX0 A;  1K7T A;  3OVO A;  4L9M A;  9WGA A;  1CT0 I;  2RC4 A;  3VDP A;  2UVO A;  2YQP A;  1UHA A;  2XRC A;  2ENZ A;  3D00 A;  3UGL A;  3FC3 A;  3R5C A;  2SGD I;  1TOT A;  1MT1 A;  1NXU A; 
#chains in the Genus database with same CATH homology
 3E2I A;  1CGI I;  2QQD A;  1UZQ A;  2B0U C;  1Z7K B;  1OYV I;  3TJQ A;  1Y8F A;  1TUS A;  1XX6 A;  1KSQ A;  1V1H A;  1OMT A;  1DS2 I;  4OVO A;  4E1P A;  1YTP A;  1SGY I;  2YUU A;  2ODD A;  3MEK A;  1CGJ I;  4B6D A;  1TBO A;  1CSO I;  4UXH A;  1LR8 A;  1PJU A;  4JCV E;  3RU0 A;  5HI7 A;  2NU3 I;  1AN1 I;  1H0Z A;  2OVO A;  4GI3 C;  2KMP A;  1TBN A;  1TUR A;  2GVI A;  2M5X A;  2ARP F;  2V1C A;  2QQC A;  1TIH A;  2NU4 I;  2N52 A;  1SGP I;  2DB6 A;  3VE5 A;  3QWP A;  2A20 A;  1W4R A;  2KMR A;  2LEO A;  5CCL A;  1FYB A;  4E1R A;  1CHO I;  2JZM A;  1R79 A;  1PTQ A;  2V53 A;  4HGU A;  1FAQ A;  2W86 A;  4A24 A;  2K9H A;  3UGD A;  2ENN A;  1VDD A;  2FNF X;  2KMQ A;  2ERW A;  3UGI A;  1PPF I;  2UZ3 A;  2ROW A;  2N71 A;  1KMA A;  1YU6 C;  1M8C A;  2KCX A;  1Y1B A;  2SGF I;  1M8B A;  1UZJ A;  3OL0 A;  3UEY A;  3E59 A;  1UVF A;  1XBT A;  3KY9 A;  3UFF A;  2GKV A;  1KBE A;  2J9R A;  3QTL D;  2E5R A;  3VDU A;  2ORV A;  2L8E A;  5CCM A;  1W3S A;  3GOX A;  1X4S A;  2JA1 A;  4FKD A;  1IY5 A;  2P6A C;  2J87 A;  1FAR A;  2WCY A;  2JYY A;  3UEJ A;  1TGS I;  2JXD A;  2L7X A;  5FUY A;  2LUY A;  1APJ A;  2QQE A;  1KBF A;  1BMO A;  2CJS C;  5HQ8 A;  3CXL A;  1U5K A;  2QPO A;  2F3C I;  1TBQ R;  2ELI A;  1SGR I;  2GKR I;  1BUS A;  3OXL A;  2SGE I;  1CT2 I;  1NUB A;  3HH2 C;  5DAE A;  2N1A B;  3B4V C;  2SGP I;  1UVG A;  1HPT A;  1CE3 A;  1HDL A;  2W0T A;  2N17 A;  1LR9 A;  1SGN I;  2ORW A;  5EX3 A;  5FUV A;  3SGQ I;  1PTR A;  1CT4 I;  1SGQ I;  1SGD I;  2DIP A;  1V1I A;  2E73 A;  3OXF A;  2VRW B;  5JHW C;  1IY6 A;  2BUS A;  4UXI A;  4UXJ A;  1OMU A;  1UUC A;  2JW6 A;  1LR7 A;  2NU1 I;  2NU0 I;  2V1C C;  1X74 A;  1Y1C A;  3BJI A;  1RFH A;  1DS3 I;  5FUW A;  1TBR R;  2B8T A;  2QQ0 A;  4SGB I;  5FUX A;  1IW4 A;  2GKT I;  2KMO A;  2SGQ I;  1SGE I;  1N13 A;  1PCE A;  1HJA I;  1R0R I;  1UZK A;  1XA6 A;  2OD1 A;  3OXG A;  3SGB I;  2WVJ A;  3PDN A;  1UZP A;  1OVO A;  2NU2 I;  5EX0 A;  3OVO A;  4L9M A;  1CT0 I;  3VDP A;  2YQP A;  2XRC A;  2ENZ A;  3D00 A;  3UGL A;  3FC3 A;  2SGD I;  1TOT A;  1MT1 A;  3SEK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...