2N52A

The solution structure of the kallikrein inhibitor spink6
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
57
structure length
57
Chain Sequence
b'QGGQVDCGEFQDTKVYCTRESNPHCGSDGQTYGNKCAFCKAIVKSGGKISLKHPGKC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease inhibitor Kazal-type 6
publication title The solution structure of the kallikrein-related peptidases inhibitor SPINK6.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor
total genus 14
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2015-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2n52A00
1PCEA 1MT1A 1TGSI 2XRCA 1OYVI 1TIHA 1CGJI 1YTPA 2KMQA 3QTLD 1TUSA 1CHOI 1PPFI 1KMAA 2SGFI 1OMUA 2QQCA 4OVOA 1Y1CA 1UVFA 2LEOA 2WCYA 2N71A 1SGNI 1Y1BA 1H0ZA 2NU4I 2GKTI 1M8BA 2KMRA 2P6AC 1LR9A 1N13A 2NU1I 1CGII 1SGQI 1HDLA 2JYYA 3HH2C 1CSOI 2KCXA 1YU6C 2JZMA 3OVOA 1UUCA 2NU2I 2M5XA 1BUSA 2ERWA 1DS3I 3TJQA 1SGDI 1Z7KB 1IY6A 2SGPI 1LR7A 5JHWC 2GKVA 1OMTA 1HJAI 1HPTA 4GI3C 1CT0I 2NU3I 1PJUA 2NU0I 2SGDI 2B0UC 2ARPF 1CE3A 1FYBA 1DS2I 2KMOA 1UVGA 4SGBI 1AN1I 1SGRI 1TBQR 3SGQI 2V53A 3B4VC 1TURA 1CT2I 1CT4I 1OVOA 1SGEI 2N17A 1M8CA 1R0RI 1TBRR 2KMPA 1IY5A 2OVOA 1SGYI 2SGQI 2GKRI 5DAEA 4HGUA 2JXDA 1SGPI 2N52A 1BMOA 3SGBI 1IW4A 1NUBA 1LR8A 2QQDA 2F3CI 2BUSA 3SEKC 2SGEI
chains in the Genus database with same CATH superfamily
1PCEA 1XA6A 1MT1A 1TGSI 1MJ9A 2XRCA 1OYVI 1TIHA 1CGJI 3R5BA 1KBFA 3TO6A 2ORVA 3E2IA 5J8CA 1YTPA 2Y0MA 3VDUA 2KMQA 3QTLD 1TUSA 5HQ8A 1W4RA 5E3RA 3UGDA 2YUUA 1CHOI 1PPFI 2CJSC 2X3TA 2SGFI 1OMUA 1V1HA 2QQCA 3D00A 3QWPA 3R5DA 2FNFX 3E59A 4MPIA 1WTJA 2A20A 2ELIA 1TBNA 3OXLA 1ULKA 2J9RA 4OVOA 1Y1CA 1UVFA 2LEOA 1ULMA 1XBTA 2WCYA 3R5AA 1V1IA 2X52A 2V1CC 3OL0A 2N71A 4WP4A 1NXUA 1SGNI 4UXHA 1FARA 2RIJA 1X4SA 1Y1BA 3QAHA 1H0ZA 1ULNA 2NU4I 2GKTI 1M8BA 2KMRA 2LB7A 2P6AC 1LR9A 2W0TA 1N13A 3UEYA 3FSYA 3BJIA 2OD1A 2NU1I 1Z2IA 2L7XA 4A24A 7WGAA 3OXGA 4AMLA 1CGII 1U5KA 1SGQI 2QPOA 4E1RA 1HDLA 1KMAA 2CWFA 2ROWA 2CWHA 2JYYA 2B8TA 1WGTA 2UVOA 3HH2C 1CSOI 5FUWA 1X74A 2KCXA 1YU6C 2E5RA 2JZMA 3UGLA 3OVOA 4UXIA 1UUCA 2NU2I 1Y8FA 1XX6A 2M5XA 1BUSA 2CWGA 2ERWA 1DS3I 2YQPA 3TJQA 1SGDI 1S20A 3UEJA 1Z7KB 4B6DA 1IY6A 2SGPI 1HEVA 1LR7A 3R5CA 3CXLA 5JHWC 2GKVA 3MEKA 1OMTA 5J8FA 1HJAI 3TO7A 1HPTA 4GI3C 1CT0I 2VRWB 2NU3I 1PJUA 2NU0I 2J87A 2SGDI 1FAQA 2B0UC 2ARPF 2GIVA 5EX0A 1CE3A 1FYBA 1DS2I 2KMOA 2V1CA 3TOAA 4DNCA 1UVGA 3GOXA 1MJBA 4UXJA 4SGBI 2UZ3A 2ODDA 1AN1I 2JW6A 3FSXA 3PDNA 1R79A 4JCVE 1FY7A 2ENZA 1SGRI 1TBQR 3SGQI 2V53A 3VE5A 5CCMA 5CCLA 5FUYA 3UOEA 2RC4A 3B4VC 2PQ8A 1TOTA 4L9MA 1K7UA 2DIPA 1VDDA 1TURA 1CT2I 2QQ0A 5EX3A 1K7TA 1WKXA 3TO9A 1CT4I 1OVOA 1SGEI 2E73A 2N17A 3TOBA 1M8CA 1KBEA 1PTQA 2DB6A 3OXFA 2K9HA 2WVJA 1R0RI 2WGCA 3FC3A 1TBRR 2KMPA 5FUVA 5FUXA 2QQEA 1RFHA 1IY5A 1K7VA 2LUYA 2OVOA 2ORWA 4FKDA 2JA1A 3UGIA 3KY9A 3VDPA 1SGYI 2DKVA 9WGAA 1MJAA 2N1AB 2SGQI 5E3PA 2GKRI 4E1PA 1PTRA 1P9ZA 5DAEA 4HGUA 5E3QA 5HI7A 2JXDA 1SGPI 2N52A 2OU2A 3UFFA 1Q9BA 1TBOA 1W3SA 1BMOA 2OZUA 3SGBI 1WGCA 1IW4A 1NUBA 1LR8A 2QQDA 3RU0A 2F3CI 2BUSA 2ENNA 2L8EA 1P9GA 3SEKC 2GVIA 1UHAA 2SGEI
chains in the Genus database with same CATH topology
1PCEA 1XA6A 1MT1A 1TGSI 2XRCA 1OYVI 1TIHA 1CGJI 1KBFA 2ORVA 3E2IA 1YTPA 3VDUA 2KMQA 3QTLD 1TUSA 5HQ8A 1W4RA 3UGDA 2YUUA 1CHOI 1PPFI 2CJSC 1KMAA 2SGFI 1OMUA 1V1HA 2QQCA 3D00A 3QWPA 2FNFX 3E59A 4OVOA 2A20A 3OXLA 2ELIA 1TBNA 2J9RA 1Y1CA 1UVFA 2LEOA 2WCYA 1XBTA 1V1IA 2V1CC 3OL0A 2N71A 1SGNI 4UXHA 1FARA 1X4SA 1Y1BA 1H0ZA 2NU4I 2GKTI 1M8BA 2KMRA 2P6AC 2W0TA 1LR9A 3UEYA 1N13A 3BJIA 2OD1A 2NU1I 2L7XA 4A24A 3OXGA 1CGII 1U5KA 1SGQI 2QPOA 4E1RA 1HDLA 2ROWA 2JYYA 2B8TA 3HH2C 5FUWA 1CSOI 1X74A 2KCXA 1YU6C 2E5RA 2JZMA 3UGLA 3OVOA 4UXIA 1UUCA 2NU2I 1Y8FA 1XX6A 2M5XA 1BUSA 2ERWA 1DS3I 2YQPA 3TJQA 1SGDI 4B6DA 3UEJA 1Z7KB 1IY6A 2SGPI 1LR7A 3CXLA 5JHWC 2GKVA 3MEKA 1OMTA 1HJAI 1HPTA 4GI3C 1CT0I 2VRWB 2NU3I 1PJUA 2NU0I 2J87A 2SGDI 1FAQA 2B0UC 2ARPF 5EX0A 1CE3A 1FYBA 1DS2I 2KMOA 2V1CA 1UVGA 3GOXA 4UXJA 4SGBI 2UZ3A 2ODDA 1AN1I 2JW6A 3PDNA 4JCVE 1R79A 3VE5A 2ENZA 1SGRI 1TBQR 3SGQI 2V53A 5CCMA 5CCLA 5FUYA 3B4VC 1TOTA 4L9MA 2DIPA 1VDDA 1TURA 1CT2I 2QQ0A 5EX3A 1CT4I 1OVOA 1SGEI 2E73A 2N17A 1M8CA 1KBEA 1PTQA 2DB6A 3OXFA 2K9HA 2WVJA 1R0RI 3FC3A 1TBRR 2KMPA 5FUVA 5FUXA 2QQEA 1RFHA 1IY5A 2LUYA 2OVOA 2ORWA 4FKDA 2JA1A 3UGIA 3KY9A 3VDPA 1SGYI 2N1AB 2SGQI 2GKRI 4E1PA 1PTRA 5DAEA 4HGUA 3UFFA 5HI7A 2JXDA 1SGPI 2N52A 1TBOA 1W3SA 1BMOA 3SGBI 1IW4A 1NUBA 1LR8A 2QQDA 3RU0A 2F3CI 2BUSA 2ENNA 2L8EA 3SEKC 2GVIA 2SGEI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PCE A;  1MT1 A;  1TGS I;  2XRC A;  1OYV I;  1TIH A;  1CGJ I;  1YTP A;  2KMQ A;  3QTL D;  1TUS A;  1CHO I;  1PPF I;  1KMA A;  2SGF I;  1OMU A;  2QQC A;  4OVO A;  1Y1C A;  1UVF A;  2LEO A;  2WCY A;  2N71 A;  1SGN I;  1Y1B A;  1H0Z A;  2NU4 I;  2GKT I;  1M8B A;  2KMR A;  2P6A C;  1LR9 A;  1N13 A;  2NU1 I;  1CGI I;  1SGQ I;  1HDL A;  2JYY A;  3HH2 C;  1CSO I;  2KCX A;  1YU6 C;  2JZM A;  3OVO A;  1UUC A;  2NU2 I;  2M5X A;  1BUS A;  2ERW A;  1DS3 I;  3TJQ A;  1SGD I;  1Z7K B;  1IY6 A;  2SGP I;  1LR7 A;  5JHW C;  2GKV A;  1OMT A;  1HJA I;  1HPT A;  4GI3 C;  1CT0 I;  2NU3 I;  1PJU A;  2NU0 I;  2SGD I;  2B0U C;  2ARP F;  1CE3 A;  1FYB A;  1DS2 I;  2KMO A;  1UVG A;  4SGB I;  1AN1 I;  1SGR I;  1TBQ R;  3SGQ I;  2V53 A;  3B4V C;  1TUR A;  1CT2 I;  1CT4 I;  1OVO A;  1SGE I;  2N17 A;  1M8C A;  1R0R I;  1TBR R;  2KMP A;  1IY5 A;  2OVO A;  1SGY I;  2SGQ I;  2GKR I;  5DAE A;  4HGU A;  2JXD A;  1SGP I;  2N52 A;  1BMO A;  3SGB I;  1IW4 A;  1NUB A;  1LR8 A;  2QQD A;  2F3C I;  2BUS A;  3SEK C;  2SGE I; 
#chains in the Genus database with same CATH topology
 1PCE A;  1XA6 A;  1MT1 A;  1TGS I;  1MJ9 A;  2XRC A;  1OYV I;  1TIH A;  1CGJ I;  3R5B A;  1KBF A;  3TO6 A;  2ORV A;  3E2I A;  5J8C A;  1YTP A;  2Y0M A;  3VDU A;  2KMQ A;  3QTL D;  1TUS A;  5HQ8 A;  1W4R A;  5E3R A;  3UGD A;  2YUU A;  1CHO I;  1PPF I;  2CJS C;  2X3T A;  2SGF I;  1OMU A;  1V1H A;  2QQC A;  3D00 A;  3QWP A;  3R5D A;  2FNF X;  3E59 A;  4MPI A;  1WTJ A;  2A20 A;  2ELI A;  1TBN A;  3OXL A;  1ULK A;  2J9R A;  4OVO A;  1Y1C A;  1UVF A;  2LEO A;  1ULM A;  1XBT A;  2WCY A;  3R5A A;  1V1I A;  2X52 A;  2V1C C;  3OL0 A;  2N71 A;  4WP4 A;  1NXU A;  1SGN I;  4UXH A;  1FAR A;  2RIJ A;  1X4S A;  1Y1B A;  3QAH A;  1H0Z A;  1ULN A;  2NU4 I;  2GKT I;  1M8B A;  2KMR A;  2LB7 A;  2P6A C;  1LR9 A;  2W0T A;  1N13 A;  3UEY A;  3FSY A;  3BJI A;  2OD1 A;  2NU1 I;  1Z2I A;  2L7X A;  4A24 A;  7WGA A;  3OXG A;  4AML A;  1CGI I;  1U5K A;  1SGQ I;  2QPO A;  4E1R A;  1HDL A;  1KMA A;  2CWF A;  2ROW A;  2CWH A;  2JYY A;  2B8T A;  1WGT A;  2UVO A;  3HH2 C;  1CSO I;  5FUW A;  1X74 A;  2KCX A;  1YU6 C;  2E5R A;  2JZM A;  3UGL A;  3OVO A;  4UXI A;  1UUC A;  2NU2 I;  1Y8F A;  1XX6 A;  2M5X A;  1BUS A;  2CWG A;  2ERW A;  1DS3 I;  2YQP A;  3TJQ A;  1SGD I;  1S20 A;  3UEJ A;  1Z7K B;  4B6D A;  1IY6 A;  2SGP I;  1HEV A;  1LR7 A;  3R5C A;  3CXL A;  5JHW C;  2GKV A;  3MEK A;  1OMT A;  5J8F A;  1HJA I;  3TO7 A;  1HPT A;  4GI3 C;  1CT0 I;  2VRW B;  2NU3 I;  1PJU A;  2NU0 I;  2J87 A;  2SGD I;  1FAQ A;  2B0U C;  2ARP F;  2GIV A;  5EX0 A;  1CE3 A;  1FYB A;  1DS2 I;  2KMO A;  2V1C A;  3TOA A;  4DNC A;  1UVG A;  3GOX A;  1MJB A;  4UXJ A;  4SGB I;  2UZ3 A;  2ODD A;  1AN1 I;  2JW6 A;  3FSX A;  3PDN A;  1R79 A;  4JCV E;  1FY7 A;  2ENZ A;  1SGR I;  1TBQ R;  3SGQ I;  2V53 A;  3VE5 A;  5CCM A;  5CCL A;  5FUY A;  3UOE A;  2RC4 A;  3B4V C;  2PQ8 A;  1TOT A;  4L9M A;  1K7U A;  2DIP A;  1VDD A;  1TUR A;  1CT2 I;  2QQ0 A;  5EX3 A;  1K7T A;  1WKX A;  3TO9 A;  1CT4 I;  1OVO A;  1SGE I;  2E73 A;  2N17 A;  3TOB A;  1M8C A;  1KBE A;  1PTQ A;  2DB6 A;  3OXF A;  2K9H A;  2WVJ A;  1R0R I;  2WGC A;  3FC3 A;  1TBR R;  2KMP A;  5FUV A;  5FUX A;  2QQE A;  1RFH A;  1IY5 A;  1K7V A;  2LUY A;  2OVO A;  2ORW A;  4FKD A;  2JA1 A;  3UGI A;  3KY9 A;  3VDP A;  1SGY I;  2DKV A;  9WGA A;  1MJA A;  2N1A B;  2SGQ I;  5E3P A;  2GKR I;  4E1P A;  1PTR A;  1P9Z A;  5DAE A;  4HGU A;  5E3Q A;  5HI7 A;  2JXD A;  1SGP I;  2N52 A;  2OU2 A;  3UFF A;  1Q9B A;  1TBO A;  1W3S A;  1BMO A;  2OZU A;  3SGB I;  1WGC A;  1IW4 A;  1NUB A;  1LR8 A;  2QQD A;  3RU0 A;  2F3C I;  2BUS A;  2ENN A;  2L8E A;  1P9G A;  3SEK C;  2GVI A;  1UHA A;  2SGE I; 
#chains in the Genus database with same CATH homology
 1PCE A;  1XA6 A;  1MT1 A;  1TGS I;  2XRC A;  1OYV I;  1TIH A;  1CGJ I;  1KBF A;  2ORV A;  3E2I A;  1YTP A;  3VDU A;  2KMQ A;  3QTL D;  1TUS A;  5HQ8 A;  1W4R A;  3UGD A;  2YUU A;  1CHO I;  1PPF I;  2CJS C;  1KMA A;  2SGF I;  1OMU A;  1V1H A;  2QQC A;  3D00 A;  3QWP A;  2FNF X;  3E59 A;  4OVO A;  2A20 A;  3OXL A;  2ELI A;  1TBN A;  2J9R A;  1Y1C A;  1UVF A;  2LEO A;  2WCY A;  1XBT A;  1V1I A;  2V1C C;  3OL0 A;  2N71 A;  1SGN I;  4UXH A;  1FAR A;  1X4S A;  1Y1B A;  1H0Z A;  2NU4 I;  2GKT I;  1M8B A;  2KMR A;  2P6A C;  2W0T A;  1LR9 A;  3UEY A;  1N13 A;  3BJI A;  2OD1 A;  2NU1 I;  2L7X A;  4A24 A;  3OXG A;  1CGI I;  1U5K A;  1SGQ I;  2QPO A;  4E1R A;  1HDL A;  2ROW A;  2JYY A;  2B8T A;  3HH2 C;  5FUW A;  1CSO I;  1X74 A;  2KCX A;  1YU6 C;  2E5R A;  2JZM A;  3UGL A;  3OVO A;  4UXI A;  1UUC A;  2NU2 I;  1Y8F A;  1XX6 A;  2M5X A;  1BUS A;  2ERW A;  1DS3 I;  2YQP A;  3TJQ A;  1SGD I;  4B6D A;  3UEJ A;  1Z7K B;  1IY6 A;  2SGP I;  1LR7 A;  3CXL A;  5JHW C;  2GKV A;  3MEK A;  1OMT A;  1HJA I;  1HPT A;  4GI3 C;  1CT0 I;  2VRW B;  2NU3 I;  1PJU A;  2NU0 I;  2J87 A;  2SGD I;  1FAQ A;  2B0U C;  2ARP F;  5EX0 A;  1CE3 A;  1FYB A;  1DS2 I;  2KMO A;  2V1C A;  1UVG A;  3GOX A;  4UXJ A;  4SGB I;  2UZ3 A;  2ODD A;  1AN1 I;  2JW6 A;  3PDN A;  4JCV E;  1R79 A;  3VE5 A;  2ENZ A;  1SGR I;  1TBQ R;  3SGQ I;  2V53 A;  5CCM A;  5CCL A;  5FUY A;  3B4V C;  1TOT A;  4L9M A;  2DIP A;  1VDD A;  1TUR A;  1CT2 I;  2QQ0 A;  5EX3 A;  1CT4 I;  1OVO A;  1SGE I;  2E73 A;  2N17 A;  1M8C A;  1KBE A;  1PTQ A;  2DB6 A;  3OXF A;  2K9H A;  2WVJ A;  1R0R I;  3FC3 A;  1TBR R;  2KMP A;  5FUV A;  5FUX A;  2QQE A;  1RFH A;  1IY5 A;  2LUY A;  2OVO A;  2ORW A;  4FKD A;  2JA1 A;  3UGI A;  3KY9 A;  3VDP A;  1SGY I;  2N1A B;  2SGQ I;  2GKR I;  4E1P A;  1PTR A;  5DAE A;  4HGU A;  3UFF A;  5HI7 A;  2JXD A;  1SGP I;  2N52 A;  1TBO A;  1W3S A;  1BMO A;  3SGB I;  1IW4 A;  1NUB A;  1LR8 A;  2QQD A;  3RU0 A;  2F3C I;  2BUS A;  2ENN A;  2L8E A;  3SEK C;  2GVI A;  2SGE I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...