2N52A

The solution structure of the kallikrein inhibitor spink6
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
57
structure length
57
Chain Sequence
QGGQVDCGEFQDTKVYCTRESNPHCGSDGQTYGNKCAFCKAIVKSGGKISLKHPGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease inhibitor Kazal-type 6
publication title The solution structure of the kallikrein-related peptidases inhibitor SPINK6.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor
total genus 14
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2015-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2n52A00
1FYBA 1PJUA 3B4VC 2NU4I 1H0ZA 1IY5A 1TUSA 1PCEA 1Y1BA 1HDLA 1TGSI 1UUCA 2WCYA 1SGRI 2BUSA 2P6AC 1BUSA 2QQDA 1SGPI 2GKTI 1CT4I 2SGPI 1LR7A 1R0RI 2KMOA 1HJAI 1N13A 1NUBA 1SGYI 1SGQI 2NU0I 4GI3C 1CGII 4HGUA 1MT1A 2XRCA 5DAEA 3HH2C 1OYVI 2GKRI 1LR9A 2B0UC 4OVOA 3SEKC 2N52A 1UVGA 1CGJI 2KCXA 2NU1I 1IY6A 2JXDA 2SGQI 2V53A 1SGNI 1UVFA 1YU6C 1Z7KB 2NU2I 2SGFI 1PPFI 1OMUA 2N71A 2GKVA 4SGBI 1IW4A 2F3CI 1CHOI 3SGQI 3TJQA 2JYYA 1TBRR 1TURA 2KMQA 1M8BA 1DS3I 1BMOA 1KMAA 3SGBI 1CSOI 2KMPA 5JHWC 1CT2I 2M5XA 1OMTA 1SGDI 2SGEI 2N17A 2LEOA 1HPTA 3QTLD 1LR8A 2ARPF 1SGEI 1OVOA 2KMRA 2ERWA 3OVOA 2NU3I 2SGDI 1Y1CA 1YTPA 1AN1I 1CT0I 2OVOA 1TBQR 1DS2I 1TIHA 1CE3A 2JZMA 2QQCA 1M8CA
chains in the Genus database with same CATH superfamily
2QQEA 2J9RA 2CJSC 1FYBA 1ULMA 2OZUA 3GOXA 1PJUA 3B4VC 5FUVA 2NU4I 5E3RA 1H0ZA 3TO9A 2L8EA 2ORVA 3UEJA 3PDNA 3R5DA 1TUSA 1PCEA 1Y1BA 3R5AA 4WP4A 1HDLA 3TOAA 2E73A 1PTQA 1TGSI 1UUCA 2DB6A 2W0TA 2WCYA 1SGRI 1X4SA 2BUSA 2CWGA 2P6AC 2QPOA 2UZ3A 2WGCA 3VDUA 1BUSA 2QQDA 5J8CA 1SGPI 2GKTI 1CT4I 4E1PA 1HEVA 2SGPI 1LR7A 1R0RI 2KMOA 1HJAI 1N13A 1MJ9A 1NUBA 1UHAA 1SGYI 1ULKA 1SGQI 2NU0I 4GI3C 1CGII 2A20A 4HGUA 1MT1A 5HI7A 3D00A 3OL0A 1NXUA 1XX6A 2XRCA 3HH2C 5DAEA 1OYVI 5E3PA 2GKRI 1LR9A 1VDDA 2LB7A 2B0UC 4OVOA 3SEKC 1X74A 2Y0MA 3VE5A 4B6DA 7WGAA 1FAQA 3CXLA 4L9MA 2N52A 1MJAA 1UVGA 1CGJI 2KCXA 1V1HA 3R5CA 2NU1I 1IY6A 1IY5A 2CWHA 4UXJA 4E1RA 3TO6A 3VDPA 1K7VA 2YUUA 2J87A 1Z2IA 1V1IA 2JXDA 1TOTA 2SGQI 3OXLA 2V53A 4DNCA 2RC4A 1SGNI 2GVIA 1K7UA 1UVFA 1YU6C 1Z7KB 2NU2I 1R79A 2SGFI 3E2IA 5FUWA 1W3SA 5EX3A 1PPFI 1OMUA 1WKXA 1S20A 2N71A 2V1CC 2GKVA 5J8FA 4SGBI 5EX0A 1WGTA 1IW4A 3OXGA 2F3CI 1RFHA 4FKDA 1TBOA 1P9ZA 3OXFA 9WGAA 1CHOI 3SGQI 1PTRA 3E59A 2OD1A 3TJQA 3R5BA 2JYYA 1ULNA 1TBRR 1TURA 2FNFX 2ENZA 2VRWB 2X3TA 2KMQA 3MEKA 4A24A 4UXIA 3UGLA 1M8BA 1DS3I 1BMOA 3TO7A 5HQ8A 1P9GA 1KBEA 1Q9BA 3FSXA 3UFFA 1FY7A 1XBTA 3FSYA 2B8TA 2JA1A 3TOBA 1WGCA 1KMAA 5FUYA 1Y8FA 3SGBI 1MJBA 1CSOI 3FC3A 1KBFA 1K7TA 5CCLA 3BJIA 4JCVE 2PQ8A 2KMPA 4MPIA 5JHWC 2L7XA 1CT2I 2M5XA 2DIPA 2RIJA 2K9HA 2X52A 1OMTA 1SGDI 2SGEI 2YQPA 3QWPA 2N17A 2UVOA 3KY9A 2LEOA 3UGDA 5CCMA 2ROWA 1HPTA 3QTLD 3RU0A 2ORWA 1LR8A 4UXHA 2ARPF 3UOEA 2E5RA 1SGEI 1OVOA 5E3QA 2KMRA 2N1AB 1WTJA 3QAHA 2ERWA 1FARA 2ODDA 2ENNA 2V1CA 2WVJA 3OVOA 5FUXA 1W4RA 2NU3I 1U5KA 2CWFA 2QQ0A 2SGDI 1Y1CA 2OU2A 1YTPA 1AN1I 1CT0I 2DKVA 2OVOA 1TBNA 3UGIA 1TBQR 2LUYA 1DS2I 1XA6A 1TIHA 4AMLA 2GIVA 2ELIA 2JW6A 1CE3A 3UEYA 2JZMA 2QQCA 1M8CA
chains in the Genus database with same CATH topology
2QQEA 2J9RA 2CJSC 1FYBA 3GOXA 1PJUA 3B4VC 5FUVA 2NU4I 1H0ZA 2L8EA 2ORVA 3UEJA 3PDNA 1IY5A 1TUSA 1PCEA 1Y1BA 1HDLA 2E73A 1PTQA 1TGSI 1UUCA 2DB6A 2W0TA 2WCYA 1SGRI 1X4SA 2BUSA 2QPOA 2P6AC 2UZ3A 3VDUA 1BUSA 2QQDA 1SGPI 2GKTI 1CT4I 4E1PA 2SGPI 1LR7A 1R0RI 2KMOA 1HJAI 1N13A 1NUBA 1SGYI 1SGQI 2NU0I 4GI3C 1CGII 2A20A 4HGUA 1MT1A 5HI7A 3D00A 3OL0A 2XRCA 1XX6A 5DAEA 3HH2C 1OYVI 2GKRI 1LR9A 1VDDA 2B0UC 4OVOA 3SEKC 1X74A 4B6DA 3VE5A 1FAQA 3CXLA 4L9MA 2N52A 1UVGA 1CGJI 2KCXA 1V1HA 2NU1I 1IY6A 4UXJA 4E1RA 3VDPA 2YUUA 2J87A 1V1IA 2JXDA 1TOTA 2SGQI 3OXLA 2V53A 1SGNI 2GVIA 1UVFA 1Z7KB 1YU6C 2NU2I 1R79A 2SGFI 3E2IA 5FUWA 1W3SA 5EX3A 1PPFI 1OMUA 2N71A 2V1CC 2GKVA 4SGBI 5EX0A 1IW4A 3OXGA 2F3CI 1RFHA 4FKDA 1TBOA 3OXFA 1CHOI 3SGQI 1PTRA 3E59A 2OD1A 3TJQA 2JYYA 3MEKA 1TBRR 1TURA 2FNFX 2ENZA 2VRWB 4A24A 2KMQA 4UXIA 3UGLA 1M8BA 1DS3I 1BMOA 5HQ8A 1KBEA 3UFFA 1XBTA 2B8TA 2JA1A 1KMAA 5FUYA 1Y8FA 3SGBI 1CSOI 1KBFA 5CCLA 3BJIA 4JCVE 2KMPA 5JHWC 2L7XA 1CT2I 2M5XA 2DIPA 2K9HA 1OMTA 1SGDI 2SGEI 2YQPA 3QWPA 2N17A 3KY9A 2LEOA 3UGDA 5CCMA 2ROWA 1HPTA 3QTLD 3RU0A 2ORWA 1LR8A 4UXHA 2ARPF 2E5RA 1SGEI 1OVOA 2KMRA 2N1AB 2ERWA 1FARA 2ODDA 2ENNA 2V1CA 2WVJA 3OVOA 5FUXA 1W4RA 2NU3I 1U5KA 2QQ0A 2SGDI 3FC3A 1Y1CA 3UGIA 1YTPA 1AN1I 1CT0I 2OVOA 1TBNA 1TBQR 2LUYA 1DS2I 1XA6A 1TIHA 2ELIA 2JW6A 1CE3A 3UEYA 2JZMA 2QQCA 1M8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FYB A;  1PJU A;  3B4V C;  2NU4 I;  1H0Z A;  1IY5 A;  1TUS A;  1PCE A;  1Y1B A;  1HDL A;  1TGS I;  1UUC A;  2WCY A;  1SGR I;  2BUS A;  2P6A C;  1BUS A;  2QQD A;  1SGP I;  2GKT I;  1CT4 I;  2SGP I;  1LR7 A;  1R0R I;  2KMO A;  1HJA I;  1N13 A;  1NUB A;  1SGY I;  1SGQ I;  2NU0 I;  4GI3 C;  1CGI I;  4HGU A;  1MT1 A;  2XRC A;  5DAE A;  3HH2 C;  1OYV I;  2GKR I;  1LR9 A;  2B0U C;  4OVO A;  3SEK C;  2N52 A;  1UVG A;  1CGJ I;  2KCX A;  2NU1 I;  1IY6 A;  2JXD A;  2SGQ I;  2V53 A;  1SGN I;  1UVF A;  1YU6 C;  1Z7K B;  2NU2 I;  2SGF I;  1PPF I;  1OMU A;  2N71 A;  2GKV A;  4SGB I;  1IW4 A;  2F3C I;  1CHO I;  3SGQ I;  3TJQ A;  2JYY A;  1TBR R;  1TUR A;  2KMQ A;  1M8B A;  1DS3 I;  1BMO A;  1KMA A;  3SGB I;  1CSO I;  2KMP A;  5JHW C;  1CT2 I;  2M5X A;  1OMT A;  1SGD I;  2SGE I;  2N17 A;  2LEO A;  1HPT A;  3QTL D;  1LR8 A;  2ARP F;  1SGE I;  1OVO A;  2KMR A;  2ERW A;  3OVO A;  2NU3 I;  2SGD I;  1Y1C A;  1YTP A;  1AN1 I;  1CT0 I;  2OVO A;  1TBQ R;  1DS2 I;  1TIH A;  1CE3 A;  2JZM A;  2QQC A;  1M8C A; 
#chains in the Genus database with same CATH topology
 2QQE A;  2J9R A;  2CJS C;  1FYB A;  1ULM A;  2OZU A;  3GOX A;  1PJU A;  3B4V C;  5FUV A;  2NU4 I;  5E3R A;  1H0Z A;  3TO9 A;  2L8E A;  2ORV A;  3UEJ A;  3PDN A;  3R5D A;  1TUS A;  1PCE A;  1Y1B A;  3R5A A;  4WP4 A;  1HDL A;  3TOA A;  2E73 A;  1PTQ A;  1TGS I;  1UUC A;  2DB6 A;  2W0T A;  2WCY A;  1SGR I;  1X4S A;  2BUS A;  2CWG A;  2P6A C;  2QPO A;  2UZ3 A;  2WGC A;  3VDU A;  1BUS A;  2QQD A;  5J8C A;  1SGP I;  2GKT I;  1CT4 I;  4E1P A;  1HEV A;  2SGP I;  1LR7 A;  1R0R I;  2KMO A;  1HJA I;  1N13 A;  1MJ9 A;  1NUB A;  1UHA A;  1SGY I;  1ULK A;  1SGQ I;  2NU0 I;  4GI3 C;  1CGI I;  2A20 A;  4HGU A;  1MT1 A;  5HI7 A;  3D00 A;  3OL0 A;  1NXU A;  1XX6 A;  2XRC A;  3HH2 C;  5DAE A;  1OYV I;  5E3P A;  2GKR I;  1LR9 A;  1VDD A;  2LB7 A;  2B0U C;  4OVO A;  3SEK C;  1X74 A;  2Y0M A;  3VE5 A;  4B6D A;  7WGA A;  1FAQ A;  3CXL A;  4L9M A;  2N52 A;  1MJA A;  1UVG A;  1CGJ I;  2KCX A;  1V1H A;  3R5C A;  2NU1 I;  1IY6 A;  1IY5 A;  2CWH A;  4UXJ A;  4E1R A;  3TO6 A;  3VDP A;  1K7V A;  2YUU A;  2J87 A;  1Z2I A;  1V1I A;  2JXD A;  1TOT A;  2SGQ I;  3OXL A;  2V53 A;  4DNC A;  2RC4 A;  1SGN I;  2GVI A;  1K7U A;  1UVF A;  1YU6 C;  1Z7K B;  2NU2 I;  1R79 A;  2SGF I;  3E2I A;  5FUW A;  1W3S A;  5EX3 A;  1PPF I;  1OMU A;  1WKX A;  1S20 A;  2N71 A;  2V1C C;  2GKV A;  5J8F A;  4SGB I;  5EX0 A;  1WGT A;  1IW4 A;  3OXG A;  2F3C I;  1RFH A;  4FKD A;  1TBO A;  1P9Z A;  3OXF A;  9WGA A;  1CHO I;  3SGQ I;  1PTR A;  3E59 A;  2OD1 A;  3TJQ A;  3R5B A;  2JYY A;  1ULN A;  1TBR R;  1TUR A;  2FNF X;  2ENZ A;  2VRW B;  2X3T A;  2KMQ A;  3MEK A;  4A24 A;  4UXI A;  3UGL A;  1M8B A;  1DS3 I;  1BMO A;  3TO7 A;  5HQ8 A;  1P9G A;  1KBE A;  1Q9B A;  3FSX A;  3UFF A;  1FY7 A;  1XBT A;  3FSY A;  2B8T A;  2JA1 A;  3TOB A;  1WGC A;  1KMA A;  5FUY A;  1Y8F A;  3SGB I;  1MJB A;  1CSO I;  3FC3 A;  1KBF A;  1K7T A;  5CCL A;  3BJI A;  4JCV E;  2PQ8 A;  2KMP A;  4MPI A;  5JHW C;  2L7X A;  1CT2 I;  2M5X A;  2DIP A;  2RIJ A;  2K9H A;  2X52 A;  1OMT A;  1SGD I;  2SGE I;  2YQP A;  3QWP A;  2N17 A;  2UVO A;  3KY9 A;  2LEO A;  3UGD A;  5CCM A;  2ROW A;  1HPT A;  3QTL D;  3RU0 A;  2ORW A;  1LR8 A;  4UXH A;  2ARP F;  3UOE A;  2E5R A;  1SGE I;  1OVO A;  5E3Q A;  2KMR A;  2N1A B;  1WTJ A;  3QAH A;  2ERW A;  1FAR A;  2ODD A;  2ENN A;  2V1C A;  2WVJ A;  3OVO A;  5FUX A;  1W4R A;  2NU3 I;  1U5K A;  2CWF A;  2QQ0 A;  2SGD I;  1Y1C A;  2OU2 A;  1YTP A;  1AN1 I;  1CT0 I;  2DKV A;  2OVO A;  1TBN A;  3UGI A;  1TBQ R;  2LUY A;  1DS2 I;  1XA6 A;  1TIH A;  4AML A;  2GIV A;  2ELI A;  2JW6 A;  1CE3 A;  3UEY A;  2JZM A;  2QQC A;  1M8C A; 
#chains in the Genus database with same CATH homology
 2QQE A;  2J9R A;  2CJS C;  1FYB A;  3GOX A;  1PJU A;  3B4V C;  5FUV A;  2NU4 I;  1H0Z A;  2L8E A;  2ORV A;  3UEJ A;  3PDN A;  1IY5 A;  1TUS A;  1PCE A;  1Y1B A;  1HDL A;  2E73 A;  1PTQ A;  1TGS I;  1UUC A;  2DB6 A;  2W0T A;  2WCY A;  1SGR I;  1X4S A;  2BUS A;  2QPO A;  2P6A C;  2UZ3 A;  3VDU A;  1BUS A;  2QQD A;  1SGP I;  2GKT I;  1CT4 I;  4E1P A;  2SGP I;  1LR7 A;  1R0R I;  2KMO A;  1HJA I;  1N13 A;  1NUB A;  1SGY I;  1SGQ I;  2NU0 I;  4GI3 C;  1CGI I;  2A20 A;  4HGU A;  1MT1 A;  5HI7 A;  3D00 A;  3OL0 A;  2XRC A;  1XX6 A;  5DAE A;  3HH2 C;  1OYV I;  2GKR I;  1LR9 A;  1VDD A;  2B0U C;  4OVO A;  3SEK C;  1X74 A;  4B6D A;  3VE5 A;  1FAQ A;  3CXL A;  4L9M A;  2N52 A;  1UVG A;  1CGJ I;  2KCX A;  1V1H A;  2NU1 I;  1IY6 A;  4UXJ A;  4E1R A;  3VDP A;  2YUU A;  2J87 A;  1V1I A;  2JXD A;  1TOT A;  2SGQ I;  3OXL A;  2V53 A;  1SGN I;  2GVI A;  1UVF A;  1Z7K B;  1YU6 C;  2NU2 I;  1R79 A;  2SGF I;  3E2I A;  5FUW A;  1W3S A;  5EX3 A;  1PPF I;  1OMU A;  2N71 A;  2V1C C;  2GKV A;  4SGB I;  5EX0 A;  1IW4 A;  3OXG A;  2F3C I;  1RFH A;  4FKD A;  1TBO A;  3OXF A;  1CHO I;  3SGQ I;  1PTR A;  3E59 A;  2OD1 A;  3TJQ A;  2JYY A;  3MEK A;  1TBR R;  1TUR A;  2FNF X;  2ENZ A;  2VRW B;  4A24 A;  2KMQ A;  4UXI A;  3UGL A;  1M8B A;  1DS3 I;  1BMO A;  5HQ8 A;  1KBE A;  3UFF A;  1XBT A;  2B8T A;  2JA1 A;  1KMA A;  5FUY A;  1Y8F A;  3SGB I;  1CSO I;  1KBF A;  5CCL A;  3BJI A;  4JCV E;  2KMP A;  5JHW C;  2L7X A;  1CT2 I;  2M5X A;  2DIP A;  2K9H A;  1OMT A;  1SGD I;  2SGE I;  2YQP A;  3QWP A;  2N17 A;  3KY9 A;  2LEO A;  3UGD A;  5CCM A;  2ROW A;  1HPT A;  3QTL D;  3RU0 A;  2ORW A;  1LR8 A;  4UXH A;  2ARP F;  2E5R A;  1SGE I;  1OVO A;  2KMR A;  2N1A B;  2ERW A;  1FAR A;  2ODD A;  2ENN A;  2V1C A;  2WVJ A;  3OVO A;  5FUX A;  1W4R A;  2NU3 I;  1U5K A;  2QQ0 A;  2SGD I;  3FC3 A;  1Y1C A;  3UGI A;  1YTP A;  1AN1 I;  1CT0 I;  2OVO A;  1TBN A;  1TBQ R;  2LUY A;  1DS2 I;  1XA6 A;  1TIH A;  2ELI A;  2JW6 A;  1CE3 A;  3UEY A;  2JZM A;  2QQC A;  1M8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...