2N52A

The solution structure of the kallikrein inhibitor spink6
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
57
structure length
57
Chain Sequence
QGGQVDCGEFQDTKVYCTRESNPHCGSDGQTYGNKCAFCKAIVKSGGKISLKHPGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Serine protease inhibitor Kazal-type 6
publication title The solution structure of the kallikrein-related peptidases inhibitor SPINK6.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2015-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2n52A00
1NUBA 2XRCA 1CT0I 1SGEI 1TBRR 1N13A 3SEKC 2NU0I 1TGSI 3OVOA 1IY6A 1PCEA 1LR7A 1SGNI 2SGEI 1MT1A 1CGJI 1TIHA 3TJQA 2OVOA 1HJAI 2SGDI 1CHOI 2NU4I 1PPFI 1CGII 1Y1BA 2M5XA 1DS3I 3HH2C 1YU6C 2GKVA 1UUCA 1PJUA 2GKRI 1SGDI 2ERWA 1BMOA 2SGFI 1CSOI 5JHWC 2BUSA 1CT4I 2WCYA 1Z7KB 1OYVI 3QTLD 2P6AC 1M8CA 4OVOA 4GI3C 1IY5A 2V53A 1FYBA 1SGPI 2KMRA 1IW4A 1CT2I 2KCXA 1AN1I 1H0ZA 2ARPF 2NU1I 2QQCA 2NU3I 2N52A 1Y1CA 1SGQI 1TUSA 1TURA 1UVFA 3B4VC 3SGQI 3SGBI 1CE3A 1KMAA 1YTPA 2KMQA 4SGBI 1UVGA 1R0RI 1OVOA 2KMPA 1DS2I 1LR9A 1HPTA 2LEOA 2SGQI 2B0UC 2F3CI 2SGPI 2JZMA 1OMTA 5DAEA 2NU2I 2KMOA 1TBQR 1OMUA 2JYYA 1M8BA 2QQDA 2JXDA 1BUSA 1HDLA 1SGRI 1LR8A 2GKTI 2N71A 4HGUA 1SGYI 2N17A
chains in the Genus database with same CATH superfamily
5HI7A 2VRWB 4WP4A 1HEVA 1NUBA 1MJBA 2XRCA 1XBTA 2YUUA 1CT0I 1WTJA 1SGEI 1TBRR 2J9RA 3CXLA 1Z2IA 1N13A 2JW6A 2JA1A 5FUWA 1PTRA 3SEKC 4UXHA 2NU0I 7WGAA 1V1HA 2W0TA 3TO6A 3VE5A 1KBEA 1X74A 3TO9A 9WGAA 1TGSI 3OVOA 2GVIA 2L8EA 4UXJA 5CCMA 1IY6A 1P9GA 1PCEA 3E59A 2X52A 3VDUA 2DB6A 1LR7A 3R5AA 1MJAA 2ELIA 2UZ3A 1SGNI 4MPIA 3UFFA 2SGEI 3OXFA 1PTQA 3BJIA 1MT1A 1CGJI 2FNFX 3VDPA 1TIHA 2ORVA 3TJQA 2V1CC 1WKXA 3OXGA 2OVOA 1VDDA 1NXUA 2WVJA 1HJAI 4FKDA 2SGDI 4E1PA 2DKVA 2L7XA 2LUYA 1CHOI 1TBOA 5E3PA 2NU4I 1PPFI 1CGII 1K7VA 1TBNA 1Y1BA 2ORWA 2M5XA 2OU2A 3R5CA 1DS3I 3HH2C 1YU6C 2GKVA 1UUCA 2ENNA 2B8TA 3UGIA 2N1AB 1PJUA 2GKRI 1SGDI 1V1IA 1BMOA 2E73A 2ERWA 2DIPA 2SGFI 5E3QA 1CSOI 3UOEA 1TOTA 2RC4A 2OD1A 4JCVE 1WGTA 2J87A 2BUSA 5JHWC 1CT4I 2CWFA 2QPOA 2WCYA 5CCLA 1Z7KB 1OYVI 3QTLD 2P6AC 1KBFA 1ULNA 3PDNA 3QWPA 1M8CA 2ODDA 4OVOA 4GI3C 3FC3A 3UEJA 1IY5A 2K9HA 2V53A 3TO7A 1FYBA 1SGPI 2PQ8A 2KMRA 1IW4A 5EX3A 3KY9A 2CWHA 1P9ZA 1CT2I 4B6DA 1FY7A 2KCXA 3UGLA 2X3TA 1X4SA 1AN1I 5FUYA 2ARPF 2YQPA 3MEKA 1Q9BA 1UHAA 2NU1I 1H0ZA 1K7TA 3D00A 2QQCA 2NU3I 2N52A 2RIJA 1Y1CA 5E3RA 1SGQI 1TUSA 3E2IA 1TURA 1UVFA 3B4VC 3SGQI 3SGBI 4AMLA 5J8CA 1CE3A 1Y8FA 1KMAA 2ROWA 3FSXA 1YTPA 1XX6A 4L9MA 3TOAA 2KMQA 4SGBI 3TOBA 2GIVA 1ULMA 4A24A 3RU0A 2WGCA 1ULKA 2E5RA 1UVGA 2LB7A 1R0RI 1OVOA 4E1RA 1MJ9A 2KMPA 1DS2I 1LR9A 1HPTA 2LEOA 1XA6A 1U5KA 2QQEA 2B0UC 2F3CI 2SGQI 2SGPI 3UEYA 2JZMA 3QAHA 1OMTA 5EX0A 5DAEA 2NU2I 2CJSC 2KMOA 4DNCA 1FARA 3FSYA 2OZUA 3OXLA 1FAQA 1TBQR 5J8FA 1OMUA 1WGCA 1W3SA 2QQ0A 1W4RA 2JYYA 5FUVA 2Y0MA 2A20A 1RFHA 3R5DA 3GOXA 1M8BA 3R5BA 2QQDA 1S20A 2JXDA 5HQ8A 1BUSA 1HDLA 3OL0A 1SGRI 1LR8A 2V1CA 2UVOA 5FUXA 1K7UA 2GKTI 3UGDA 2ENZA 1R79A 2N71A 2CWGA 4HGUA 4UXIA 1SGYI 2N17A
chains in the Genus database with same CATH topology
5HI7A 2VRWB 1NUBA 2XRCA 2YUUA 1XBTA 1CT0I 1SGEI 1TBRR 2J9RA 3CXLA 1N13A 2JW6A 2JA1A 5FUWA 1PTRA 3SEKC 4UXHA 2NU0I 1V1HA 2W0TA 3VE5A 1KBEA 1X74A 1TGSI 3OVOA 2GVIA 2L8EA 4UXJA 5CCMA 1IY6A 1PCEA 3E59A 3VDUA 2DB6A 1LR7A 2ELIA 2UZ3A 1SGNI 3UFFA 2SGEI 3OXFA 1PTQA 3BJIA 1MT1A 1CGJI 2FNFX 3VDPA 1TIHA 2ORVA 3TJQA 2V1CC 3OXGA 2OVOA 1VDDA 2WVJA 1HJAI 4FKDA 2SGDI 4E1PA 2LUYA 2L7XA 1CHOI 1TBOA 2NU4I 1PPFI 1CGII 1TBNA 1Y1BA 2ORWA 2M5XA 1DS3I 3HH2C 1YU6C 2GKVA 1UUCA 2ENNA 2B8TA 3UGIA 2N1AB 1PJUA 2GKRI 1SGDI 1V1IA 1BMOA 2E73A 2ERWA 2DIPA 2SGFI 1CSOI 1TOTA 2OD1A 4JCVE 2J87A 2BUSA 5JHWC 1CT4I 2QPOA 2WCYA 5CCLA 1Z7KB 1OYVI 3QTLD 2P6AC 1KBFA 3PDNA 3QWPA 1M8CA 2ODDA 4OVOA 4GI3C 3UEJA 1IY5A 2K9HA 2V53A 1FYBA 1SGPI 2KMRA 1IW4A 5EX3A 3KY9A 4B6DA 1CT2I 2KCXA 3UGLA 3FC3A 1X4SA 1AN1I 5FUYA 2ARPF 2YQPA 3MEKA 2NU1I 1H0ZA 3D00A 2QQCA 2NU3I 2N52A 1Y1CA 1SGQI 1TUSA 3E2IA 1TURA 1UVFA 3B4VC 3SGQI 3SGBI 1CE3A 1KMAA 1Y8FA 2ROWA 4L9MA 1YTPA 1XX6A 2KMQA 4SGBI 4A24A 3RU0A 2E5RA 1UVGA 1R0RI 1OVOA 4E1RA 2KMPA 1DS2I 1LR9A 1HPTA 2LEOA 1XA6A 1U5KA 2QQEA 2B0UC 2F3CI 2SGQI 2SGPI 3UEYA 2JZMA 1OMTA 5EX0A 5DAEA 2NU2I 2CJSC 2KMOA 1FARA 3OXLA 1FAQA 1TBQR 1OMUA 1W3SA 2QQ0A 1W4RA 2JYYA 5FUVA 2A20A 1RFHA 3GOXA 1M8BA 2QQDA 2JXDA 5HQ8A 1BUSA 1HDLA 3OL0A 1SGRI 1LR8A 2V1CA 5FUXA 3UGDA 2GKTI 2ENZA 1R79A 2N71A 4HGUA 4UXIA 1SGYI 2N17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NUB A;  2XRC A;  1CT0 I;  1SGE I;  1TBR R;  1N13 A;  3SEK C;  2NU0 I;  1TGS I;  3OVO A;  1IY6 A;  1PCE A;  1LR7 A;  1SGN I;  2SGE I;  1MT1 A;  1CGJ I;  1TIH A;  3TJQ A;  2OVO A;  1HJA I;  2SGD I;  1CHO I;  2NU4 I;  1PPF I;  1CGI I;  1Y1B A;  2M5X A;  1DS3 I;  3HH2 C;  1YU6 C;  2GKV A;  1UUC A;  1PJU A;  2GKR I;  1SGD I;  2ERW A;  1BMO A;  2SGF I;  1CSO I;  5JHW C;  2BUS A;  1CT4 I;  2WCY A;  1Z7K B;  1OYV I;  3QTL D;  2P6A C;  1M8C A;  4OVO A;  4GI3 C;  1IY5 A;  2V53 A;  1FYB A;  1SGP I;  2KMR A;  1IW4 A;  1CT2 I;  2KCX A;  1AN1 I;  1H0Z A;  2ARP F;  2NU1 I;  2QQC A;  2NU3 I;  2N52 A;  1Y1C A;  1SGQ I;  1TUS A;  1TUR A;  1UVF A;  3B4V C;  3SGQ I;  3SGB I;  1CE3 A;  1KMA A;  1YTP A;  2KMQ A;  4SGB I;  1UVG A;  1R0R I;  1OVO A;  2KMP A;  1DS2 I;  1LR9 A;  1HPT A;  2LEO A;  2SGQ I;  2B0U C;  2F3C I;  2SGP I;  2JZM A;  1OMT A;  5DAE A;  2NU2 I;  2KMO A;  1TBQ R;  1OMU A;  2JYY A;  1M8B A;  2QQD A;  2JXD A;  1BUS A;  1HDL A;  1SGR I;  1LR8 A;  2GKT I;  2N71 A;  4HGU A;  1SGY I;  2N17 A; 
#chains in the Genus database with same CATH topology
 5HI7 A;  2VRW B;  4WP4 A;  1HEV A;  1NUB A;  1MJB A;  2XRC A;  1XBT A;  2YUU A;  1CT0 I;  1WTJ A;  1SGE I;  1TBR R;  2J9R A;  3CXL A;  1Z2I A;  1N13 A;  2JW6 A;  2JA1 A;  5FUW A;  1PTR A;  3SEK C;  4UXH A;  2NU0 I;  7WGA A;  1V1H A;  2W0T A;  3TO6 A;  3VE5 A;  1KBE A;  1X74 A;  3TO9 A;  9WGA A;  1TGS I;  3OVO A;  2GVI A;  2L8E A;  4UXJ A;  5CCM A;  1IY6 A;  1P9G A;  1PCE A;  3E59 A;  2X52 A;  3VDU A;  2DB6 A;  1LR7 A;  3R5A A;  1MJA A;  2ELI A;  2UZ3 A;  1SGN I;  4MPI A;  3UFF A;  2SGE I;  3OXF A;  1PTQ A;  3BJI A;  1MT1 A;  1CGJ I;  2FNF X;  3VDP A;  1TIH A;  2ORV A;  3TJQ A;  2V1C C;  1WKX A;  3OXG A;  2OVO A;  1VDD A;  1NXU A;  2WVJ A;  1HJA I;  4FKD A;  2SGD I;  4E1P A;  2DKV A;  2L7X A;  2LUY A;  1CHO I;  1TBO A;  5E3P A;  2NU4 I;  1PPF I;  1CGI I;  1K7V A;  1TBN A;  1Y1B A;  2ORW A;  2M5X A;  2OU2 A;  3R5C A;  1DS3 I;  3HH2 C;  1YU6 C;  2GKV A;  1UUC A;  2ENN A;  2B8T A;  3UGI A;  2N1A B;  1PJU A;  2GKR I;  1SGD I;  1V1I A;  1BMO A;  2E73 A;  2ERW A;  2DIP A;  2SGF I;  5E3Q A;  1CSO I;  3UOE A;  1TOT A;  2RC4 A;  2OD1 A;  4JCV E;  1WGT A;  2J87 A;  2BUS A;  5JHW C;  1CT4 I;  2CWF A;  2QPO A;  2WCY A;  5CCL A;  1Z7K B;  1OYV I;  3QTL D;  2P6A C;  1KBF A;  1ULN A;  3PDN A;  3QWP A;  1M8C A;  2ODD A;  4OVO A;  4GI3 C;  3FC3 A;  3UEJ A;  1IY5 A;  2K9H A;  2V53 A;  3TO7 A;  1FYB A;  1SGP I;  2PQ8 A;  2KMR A;  1IW4 A;  5EX3 A;  3KY9 A;  2CWH A;  1P9Z A;  1CT2 I;  4B6D A;  1FY7 A;  2KCX A;  3UGL A;  2X3T A;  1X4S A;  1AN1 I;  5FUY A;  2ARP F;  2YQP A;  3MEK A;  1Q9B A;  1UHA A;  2NU1 I;  1H0Z A;  1K7T A;  3D00 A;  2QQC A;  2NU3 I;  2N52 A;  2RIJ A;  1Y1C A;  5E3R A;  1SGQ I;  1TUS A;  3E2I A;  1TUR A;  1UVF A;  3B4V C;  3SGQ I;  3SGB I;  4AML A;  5J8C A;  1CE3 A;  1Y8F A;  1KMA A;  2ROW A;  3FSX A;  1YTP A;  1XX6 A;  4L9M A;  3TOA A;  2KMQ A;  4SGB I;  3TOB A;  2GIV A;  1ULM A;  4A24 A;  3RU0 A;  2WGC A;  1ULK A;  2E5R A;  1UVG A;  2LB7 A;  1R0R I;  1OVO A;  4E1R A;  1MJ9 A;  2KMP A;  1DS2 I;  1LR9 A;  1HPT A;  2LEO A;  1XA6 A;  1U5K A;  2QQE A;  2B0U C;  2F3C I;  2SGQ I;  2SGP I;  3UEY A;  2JZM A;  3QAH A;  1OMT A;  5EX0 A;  5DAE A;  2NU2 I;  2CJS C;  2KMO A;  4DNC A;  1FAR A;  3FSY A;  2OZU A;  3OXL A;  1FAQ A;  1TBQ R;  5J8F A;  1OMU A;  1WGC A;  1W3S A;  2QQ0 A;  1W4R A;  2JYY A;  5FUV A;  2Y0M A;  2A20 A;  1RFH A;  3R5D A;  3GOX A;  1M8B A;  3R5B A;  2QQD A;  1S20 A;  2JXD A;  5HQ8 A;  1BUS A;  1HDL A;  3OL0 A;  1SGR I;  1LR8 A;  2V1C A;  2UVO A;  5FUX A;  1K7U A;  2GKT I;  3UGD A;  2ENZ A;  1R79 A;  2N71 A;  2CWG A;  4HGU A;  4UXI A;  1SGY I;  2N17 A; 
#chains in the Genus database with same CATH homology
 5HI7 A;  2VRW B;  1NUB A;  2XRC A;  2YUU A;  1XBT A;  1CT0 I;  1SGE I;  1TBR R;  2J9R A;  3CXL A;  1N13 A;  2JW6 A;  2JA1 A;  5FUW A;  1PTR A;  3SEK C;  4UXH A;  2NU0 I;  1V1H A;  2W0T A;  3VE5 A;  1KBE A;  1X74 A;  1TGS I;  3OVO A;  2GVI A;  2L8E A;  4UXJ A;  5CCM A;  1IY6 A;  1PCE A;  3E59 A;  3VDU A;  2DB6 A;  1LR7 A;  2ELI A;  2UZ3 A;  1SGN I;  3UFF A;  2SGE I;  3OXF A;  1PTQ A;  3BJI A;  1MT1 A;  1CGJ I;  2FNF X;  3VDP A;  1TIH A;  2ORV A;  3TJQ A;  2V1C C;  3OXG A;  2OVO A;  1VDD A;  2WVJ A;  1HJA I;  4FKD A;  2SGD I;  4E1P A;  2LUY A;  2L7X A;  1CHO I;  1TBO A;  2NU4 I;  1PPF I;  1CGI I;  1TBN A;  1Y1B A;  2ORW A;  2M5X A;  1DS3 I;  3HH2 C;  1YU6 C;  2GKV A;  1UUC A;  2ENN A;  2B8T A;  3UGI A;  2N1A B;  1PJU A;  2GKR I;  1SGD I;  1V1I A;  1BMO A;  2E73 A;  2ERW A;  2DIP A;  2SGF I;  1CSO I;  1TOT A;  2OD1 A;  4JCV E;  2J87 A;  2BUS A;  5JHW C;  1CT4 I;  2QPO A;  2WCY A;  5CCL A;  1Z7K B;  1OYV I;  3QTL D;  2P6A C;  1KBF A;  3PDN A;  3QWP A;  1M8C A;  2ODD A;  4OVO A;  4GI3 C;  3UEJ A;  1IY5 A;  2K9H A;  2V53 A;  1FYB A;  1SGP I;  2KMR A;  1IW4 A;  5EX3 A;  3KY9 A;  4B6D A;  1CT2 I;  2KCX A;  3UGL A;  3FC3 A;  1X4S A;  1AN1 I;  5FUY A;  2ARP F;  2YQP A;  3MEK A;  2NU1 I;  1H0Z A;  3D00 A;  2QQC A;  2NU3 I;  2N52 A;  1Y1C A;  1SGQ I;  1TUS A;  3E2I A;  1TUR A;  1UVF A;  3B4V C;  3SGQ I;  3SGB I;  1CE3 A;  1KMA A;  1Y8F A;  2ROW A;  4L9M A;  1YTP A;  1XX6 A;  2KMQ A;  4SGB I;  4A24 A;  3RU0 A;  2E5R A;  1UVG A;  1R0R I;  1OVO A;  4E1R A;  2KMP A;  1DS2 I;  1LR9 A;  1HPT A;  2LEO A;  1XA6 A;  1U5K A;  2QQE A;  2B0U C;  2F3C I;  2SGQ I;  2SGP I;  3UEY A;  2JZM A;  1OMT A;  5EX0 A;  5DAE A;  2NU2 I;  2CJS C;  2KMO A;  1FAR A;  3OXL A;  1FAQ A;  1TBQ R;  1OMU A;  1W3S A;  2QQ0 A;  1W4R A;  2JYY A;  5FUV A;  2A20 A;  1RFH A;  3GOX A;  1M8B A;  2QQD A;  2JXD A;  5HQ8 A;  1BUS A;  1HDL A;  3OL0 A;  1SGR I;  1LR8 A;  2V1C A;  5FUX A;  3UGD A;  2GKT I;  2ENZ A;  1R79 A;  2N71 A;  4HGU A;  4UXI A;  1SGY I;  2N17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...