1HDLA

Lekti domain one
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
55
structure length
55
Chain Sequence
KNEDQEMCHEFQAFMKNGKLFCPQDKKFFQSLDGIMFINKCATCKMILEKEAKSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE PROTEINASE INHIBITOR LEKTI
publication title Homologous Proteins with Different Folds: The Three-Dimensional Structures of Domains 1 and 6 of the Multiple Kazal-Type Inhibitor Lekti
pubmed doi rcsb
source organism Homo sapiens
molecule tags Putative serine proteinase inhibitor
total genus 12
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2000-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1hdlA00
1CE3A 3SGQI 4HGUA 1CSOI 3B4VC 1CGII 1SGEI 5DAEA 1OMTA 2QQDA 1N13A 2M5XA 2LEOA 2JYYA 2KMRA 1MT1A 1M8CA 2JZMA 3QTLD 2XRCA 2BUSA 1PCEA 3SGBI 2KCXA 2B0UC 2SGEI 1OMUA 2QQCA 2SGPI 1SGYI 1LR9A 1LR7A 2ARPF 1UUCA 1PPFI 1SGNI 3SEKC 2KMQA 2NU3I 2KMOA 1TIHA 1SGDI 2SGQI 1CGJI 2N71A 1YU6C 1DS2I 3HH2C 1H0ZA 1R0RI 1SGPI 1LR8A 2NU0I 2V53A 4SGBI 2GKRI 2JXDA 1CT0I 1UVFA 1Y1BA 1KMAA 1CT2I 1TBRR 1OYVI 2N52A 1CT4I 2ERWA 1FYBA 1TBQR 2N17A 2GKTI 2NU4I 1IY5A 2WCYA 2OVOA 1UVGA 1BUSA 1YTPA 1NUBA 1TGSI 2NU2I 4GI3C 3TJQA 1AN1I 2P6AC 3OVOA 1HPTA 1TURA 2SGDI 2GKVA 1BMOA 1SGRI 2NU1I 5JHWC 1SGQI 1PJUA 1DS3I 1HJAI 1Z7KB 1TUSA 1OVOA 1M8BA 2KMPA 1Y1CA 1CHOI 1HDLA 4OVOA 1IW4A 2SGFI 2F3CI 1IY6A
chains in the Genus database with same CATH superfamily
2ODDA 2X52A 4UXHA 1CE3A 3OXLA 2J9RA 3QWPA 2CWFA 3SGQI 4E1PA 4HGUA 1UHAA 1CSOI 3B4VC 3TO9A 1XBTA 1CGII 1SGEI 3FSXA 1MJAA 5DAEA 5J8FA 1RFHA 2LB7A 1V1HA 4FKDA 1OMTA 2QQDA 1N13A 9WGAA 2ROWA 2M5XA 2LEOA 2UVOA 1NXUA 2VRWB 2Y0MA 1X4SA 2JYYA 2DIPA 1KBEA 5HI7A 2KMRA 1MT1A 1TBOA 1W4RA 1M8CA 2JZMA 5CCLA 3QTLD 2XRCA 3UEYA 2RIJA 2BUSA 1PCEA 2WVJA 3SGBI 2PQ8A 2KCXA 1ULKA 2B0UC 2SGEI 3KY9A 2OZUA 2QQ0A 1OMUA 2QQCA 2SGPI 1SGYI 1LR9A 1LR7A 1U5KA 2ARPF 1WTJA 1UUCA 4AMLA 1VDDA 1PPFI 1SGNI 1TOTA 2KMQA 2NU3I 1Q9BA 1V1IA 2ENZA 2RC4A 5EX0A 5FUYA 3VDPA 2L7XA 3TOAA 2KMOA 1KBFA 1TIHA 3UOEA 1SGDI 2SGQI 1WGCA 4MPIA 4B6DA 1CGJI 2L8EA 1YU6C 2N71A 2ORWA 2OU2A 1DS2I 1FAQA 2UZ3A 5FUWA 3OXGA 2W0TA 3D00A 3HH2C 1H0ZA 1R0RI 1SGPI 2CWHA 2X3TA 1LR8A 2NU0I 2B8TA 2V53A 3UFFA 2YUUA 1Z2IA 2J87A 4SGBI 4L9MA 5E3QA 1WGTA 3VDUA 1W3SA 2GKRI 1XA6A 2JXDA 1KMAA 5EX3A 2GVIA 1CT0I 1S20A 1UVFA 1MJ9A 1Y1BA 2ELIA 2A20A 2YQPA 1CT2I 1TBRR 5FUXA 1OYVI 2FNFX 2N52A 3UGDA 4WP4A 1CT4I 2ERWA 1P9GA 1MJBA 1K7TA 3PDNA 4DNCA 1FARA 3E59A 1FYBA 1TBQR 3BJIA 2JW6A 2N17A 1HEVA 3QAHA 1K7UA 3TOBA 2GKTI 3R5CA 2E73A 5CCMA 2NU4I 1ULNA 2V1CC 2ENNA 1IY5A 5HQ8A 2WCYA 2DB6A 2LUYA 1K7VA 4UXJA 2OVOA 1UVGA 3FSYA 3UEJA 1R79A 1BUSA 1WKXA 1PTQA 1YTPA 1NUBA 3MEKA 1TGSI 2NU2I 4GI3C 3TJQA 3R5BA 1AN1I 2P6AC 3CXLA 3OVOA 2JA1A 3FC3A 1HPTA 1TURA 2E5RA 3SEKC 3OXFA 2SGDI 2GKVA 1BMOA 1SGRI 1XX6A 2NU1I 2ORVA 5JHWC 1FY7A 1SGQI 1X74A 3OL0A 1PJUA 1DS3I 2WGCA 1Y8FA 4A24A 1HJAI 3UGLA 3GOXA 2QQEA 1P9ZA 1Z7KB 4UXIA 3R5DA 5J8CA 1TUSA 3UGIA 2N1AB 1ULMA 2QPOA 3R5AA 1OVOA 1M8BA 2KMPA 3TO6A 1Y1CA 2V1CA 4JCVE 1TBNA 2CJSC 5FUVA 1CHOI 1HDLA 3TO7A 5E3PA 2GIVA 4OVOA 2K9HA 1PTRA 3VE5A 2SGFI 2OD1A 4E1RA 1IW4A 2CWGA 5E3RA 2F3CI 2DKVA 7WGAA 1IY6A 3E2IA 3RU0A
chains in the Genus database with same CATH topology
2ODDA 4UXHA 1CE3A 3OXLA 2J9RA 3QWPA 4E1PA 3SGQI 4HGUA 1CSOI 3B4VC 1XBTA 1CGII 1SGEI 5DAEA 1RFHA 1V1HA 4FKDA 1OMTA 2QQDA 1N13A 2ROWA 2M5XA 2LEOA 2VRWB 1X4SA 2JYYA 2DIPA 1KBEA 5HI7A 2KMRA 1MT1A 1TBOA 1W4RA 1M8CA 2JZMA 5CCLA 3QTLD 2XRCA 3UEYA 2BUSA 1PCEA 2WVJA 3SGBI 2KCXA 2B0UC 2SGEI 3KY9A 2QQ0A 1OMUA 2QQCA 2SGPI 1SGYI 1LR9A 1LR7A 1U5KA 2ARPF 1UUCA 4E1RA 1VDDA 1PPFI 1SGNI 1TOTA 2KMQA 2NU3I 5FUYA 1V1IA 2ENZA 3SEKC 5EX0A 3VDPA 2L7XA 2KMOA 1KBFA 1TIHA 1SGDI 2SGQI 4B6DA 1CGJI 2L8EA 1YU6C 2N71A 2ORWA 1DS2I 1FAQA 2UZ3A 5FUWA 3OXGA 2W0TA 3D00A 3HH2C 1H0ZA 1R0RI 1SGPI 1LR8A 2NU0I 2B8TA 2V53A 3UFFA 2YUUA 2J87A 4SGBI 4L9MA 3VDUA 1W3SA 2GKRI 1XA6A 2JXDA 5EX3A 2GVIA 1CT0I 1UVFA 1Y1BA 2ELIA 5FUXA 2A20A 2YQPA 1CT2I 1TBRR 3UGDA 1OYVI 2FNFX 2N52A 1KMAA 1CT4I 2ERWA 3PDNA 1FARA 3E59A 1FYBA 1TBQR 3BJIA 2JW6A 2N17A 2GKTI 2E73A 5CCMA 2NU4I 2V1CC 2ENNA 1IY5A 5HQ8A 2WCYA 2DB6A 2LUYA 4UXJA 2OVOA 1UVGA 3UEJA 1R79A 1BUSA 1PTQA 1YTPA 1NUBA 3MEKA 1TGSI 2NU2I 4GI3C 3TJQA 1AN1I 2P6AC 3CXLA 3OVOA 2JA1A 3FC3A 1HPTA 1TURA 2E5RA 3OXFA 2SGDI 2GKVA 1BMOA 1SGRI 1XX6A 2NU1I 2ORVA 5JHWC 1SGQI 1X74A 3OL0A 1PJUA 1DS3I 4A24A 1Y8FA 3GOXA 1HJAI 3UGLA 2QQEA 1Z7KB 4UXIA 1TUSA 3UGIA 2N1AB 2QPOA 1OVOA 1M8BA 2KMPA 1Y1CA 2V1CA 4JCVE 1TBNA 2CJSC 5FUVA 1CHOI 1HDLA 4OVOA 2K9HA 1PTRA 3VE5A 2SGFI 2OD1A 1IW4A 2F3CI 1IY6A 3E2IA 3RU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CE3 A;  3SGQ I;  4HGU A;  1CSO I;  3B4V C;  1CGI I;  1SGE I;  5DAE A;  1OMT A;  2QQD A;  1N13 A;  2M5X A;  2LEO A;  2JYY A;  2KMR A;  1MT1 A;  1M8C A;  2JZM A;  3QTL D;  2XRC A;  2BUS A;  1PCE A;  3SGB I;  2KCX A;  2B0U C;  2SGE I;  1OMU A;  2QQC A;  2SGP I;  1SGY I;  1LR9 A;  1LR7 A;  2ARP F;  1UUC A;  1PPF I;  1SGN I;  3SEK C;  2KMQ A;  2NU3 I;  2KMO A;  1TIH A;  1SGD I;  2SGQ I;  1CGJ I;  2N71 A;  1YU6 C;  1DS2 I;  3HH2 C;  1H0Z A;  1R0R I;  1SGP I;  1LR8 A;  2NU0 I;  2V53 A;  4SGB I;  2GKR I;  2JXD A;  1CT0 I;  1UVF A;  1Y1B A;  1KMA A;  1CT2 I;  1TBR R;  1OYV I;  2N52 A;  1CT4 I;  2ERW A;  1FYB A;  1TBQ R;  2N17 A;  2GKT I;  2NU4 I;  1IY5 A;  2WCY A;  2OVO A;  1UVG A;  1BUS A;  1YTP A;  1NUB A;  1TGS I;  2NU2 I;  4GI3 C;  3TJQ A;  1AN1 I;  2P6A C;  3OVO A;  1HPT A;  1TUR A;  2SGD I;  2GKV A;  1BMO A;  1SGR I;  2NU1 I;  5JHW C;  1SGQ I;  1PJU A;  1DS3 I;  1HJA I;  1Z7K B;  1TUS A;  1OVO A;  1M8B A;  2KMP A;  1Y1C A;  1CHO I;  1HDL A;  4OVO A;  1IW4 A;  2SGF I;  2F3C I;  1IY6 A; 
#chains in the Genus database with same CATH topology
 2ODD A;  2X52 A;  4UXH A;  1CE3 A;  3OXL A;  2J9R A;  3QWP A;  2CWF A;  3SGQ I;  4E1P A;  4HGU A;  1UHA A;  1CSO I;  3B4V C;  3TO9 A;  1XBT A;  1CGI I;  1SGE I;  3FSX A;  1MJA A;  5DAE A;  5J8F A;  1RFH A;  2LB7 A;  1V1H A;  4FKD A;  1OMT A;  2QQD A;  1N13 A;  9WGA A;  2ROW A;  2M5X A;  2LEO A;  2UVO A;  1NXU A;  2VRW B;  2Y0M A;  1X4S A;  2JYY A;  2DIP A;  1KBE A;  5HI7 A;  2KMR A;  1MT1 A;  1TBO A;  1W4R A;  1M8C A;  2JZM A;  5CCL A;  3QTL D;  2XRC A;  3UEY A;  2RIJ A;  2BUS A;  1PCE A;  2WVJ A;  3SGB I;  2PQ8 A;  2KCX A;  1ULK A;  2B0U C;  2SGE I;  3KY9 A;  2OZU A;  2QQ0 A;  1OMU A;  2QQC A;  2SGP I;  1SGY I;  1LR9 A;  1LR7 A;  1U5K A;  2ARP F;  1WTJ A;  1UUC A;  4AML A;  1VDD A;  1PPF I;  1SGN I;  1TOT A;  2KMQ A;  2NU3 I;  1Q9B A;  1V1I A;  2ENZ A;  2RC4 A;  5EX0 A;  5FUY A;  3VDP A;  2L7X A;  3TOA A;  2KMO A;  1KBF A;  1TIH A;  3UOE A;  1SGD I;  2SGQ I;  1WGC A;  4MPI A;  4B6D A;  1CGJ I;  2L8E A;  1YU6 C;  2N71 A;  2ORW A;  2OU2 A;  1DS2 I;  1FAQ A;  2UZ3 A;  5FUW A;  3OXG A;  2W0T A;  3D00 A;  3HH2 C;  1H0Z A;  1R0R I;  1SGP I;  2CWH A;  2X3T A;  1LR8 A;  2NU0 I;  2B8T A;  2V53 A;  3UFF A;  2YUU A;  1Z2I A;  2J87 A;  4SGB I;  4L9M A;  5E3Q A;  1WGT A;  3VDU A;  1W3S A;  2GKR I;  1XA6 A;  2JXD A;  1KMA A;  5EX3 A;  2GVI A;  1CT0 I;  1S20 A;  1UVF A;  1MJ9 A;  1Y1B A;  2ELI A;  2A20 A;  2YQP A;  1CT2 I;  1TBR R;  5FUX A;  1OYV I;  2FNF X;  2N52 A;  3UGD A;  4WP4 A;  1CT4 I;  2ERW A;  1P9G A;  1MJB A;  1K7T A;  3PDN A;  4DNC A;  1FAR A;  3E59 A;  1FYB A;  1TBQ R;  3BJI A;  2JW6 A;  2N17 A;  1HEV A;  3QAH A;  1K7U A;  3TOB A;  2GKT I;  3R5C A;  2E73 A;  5CCM A;  2NU4 I;  1ULN A;  2V1C C;  2ENN A;  1IY5 A;  5HQ8 A;  2WCY A;  2DB6 A;  2LUY A;  1K7V A;  4UXJ A;  2OVO A;  1UVG A;  3FSY A;  3UEJ A;  1R79 A;  1BUS A;  1WKX A;  1PTQ A;  1YTP A;  1NUB A;  3MEK A;  1TGS I;  2NU2 I;  4GI3 C;  3TJQ A;  3R5B A;  1AN1 I;  2P6A C;  3CXL A;  3OVO A;  2JA1 A;  3FC3 A;  1HPT A;  1TUR A;  2E5R A;  3SEK C;  3OXF A;  2SGD I;  2GKV A;  1BMO A;  1SGR I;  1XX6 A;  2NU1 I;  2ORV A;  5JHW C;  1FY7 A;  1SGQ I;  1X74 A;  3OL0 A;  1PJU A;  1DS3 I;  2WGC A;  1Y8F A;  4A24 A;  1HJA I;  3UGL A;  3GOX A;  2QQE A;  1P9Z A;  1Z7K B;  4UXI A;  3R5D A;  5J8C A;  1TUS A;  3UGI A;  2N1A B;  1ULM A;  2QPO A;  3R5A A;  1OVO A;  1M8B A;  2KMP A;  3TO6 A;  1Y1C A;  2V1C A;  4JCV E;  1TBN A;  2CJS C;  5FUV A;  1CHO I;  1HDL A;  3TO7 A;  5E3P A;  2GIV A;  4OVO A;  2K9H A;  1PTR A;  3VE5 A;  2SGF I;  2OD1 A;  4E1R A;  1IW4 A;  2CWG A;  5E3R A;  2F3C I;  2DKV A;  7WGA A;  1IY6 A;  3E2I A;  3RU0 A; 
#chains in the Genus database with same CATH homology
 2ODD A;  4UXH A;  1CE3 A;  3OXL A;  2J9R A;  3QWP A;  4E1P A;  3SGQ I;  4HGU A;  1CSO I;  3B4V C;  1XBT A;  1CGI I;  1SGE I;  5DAE A;  1RFH A;  1V1H A;  4FKD A;  1OMT A;  2QQD A;  1N13 A;  2ROW A;  2M5X A;  2LEO A;  2VRW B;  1X4S A;  2JYY A;  2DIP A;  1KBE A;  5HI7 A;  2KMR A;  1MT1 A;  1TBO A;  1W4R A;  1M8C A;  2JZM A;  5CCL A;  3QTL D;  2XRC A;  3UEY A;  2BUS A;  1PCE A;  2WVJ A;  3SGB I;  2KCX A;  2B0U C;  2SGE I;  3KY9 A;  2QQ0 A;  1OMU A;  2QQC A;  2SGP I;  1SGY I;  1LR9 A;  1LR7 A;  1U5K A;  2ARP F;  1UUC A;  4E1R A;  1VDD A;  1PPF I;  1SGN I;  1TOT A;  2KMQ A;  2NU3 I;  5FUY A;  1V1I A;  2ENZ A;  3SEK C;  5EX0 A;  3VDP A;  2L7X A;  2KMO A;  1KBF A;  1TIH A;  1SGD I;  2SGQ I;  4B6D A;  1CGJ I;  2L8E A;  1YU6 C;  2N71 A;  2ORW A;  1DS2 I;  1FAQ A;  2UZ3 A;  5FUW A;  3OXG A;  2W0T A;  3D00 A;  3HH2 C;  1H0Z A;  1R0R I;  1SGP I;  1LR8 A;  2NU0 I;  2B8T A;  2V53 A;  3UFF A;  2YUU A;  2J87 A;  4SGB I;  4L9M A;  3VDU A;  1W3S A;  2GKR I;  1XA6 A;  2JXD A;  5EX3 A;  2GVI A;  1CT0 I;  1UVF A;  1Y1B A;  2ELI A;  5FUX A;  2A20 A;  2YQP A;  1CT2 I;  1TBR R;  3UGD A;  1OYV I;  2FNF X;  2N52 A;  1KMA A;  1CT4 I;  2ERW A;  3PDN A;  1FAR A;  3E59 A;  1FYB A;  1TBQ R;  3BJI A;  2JW6 A;  2N17 A;  2GKT I;  2E73 A;  5CCM A;  2NU4 I;  2V1C C;  2ENN A;  1IY5 A;  5HQ8 A;  2WCY A;  2DB6 A;  2LUY A;  4UXJ A;  2OVO A;  1UVG A;  3UEJ A;  1R79 A;  1BUS A;  1PTQ A;  1YTP A;  1NUB A;  3MEK A;  1TGS I;  2NU2 I;  4GI3 C;  3TJQ A;  1AN1 I;  2P6A C;  3CXL A;  3OVO A;  2JA1 A;  3FC3 A;  1HPT A;  1TUR A;  2E5R A;  3OXF A;  2SGD I;  2GKV A;  1BMO A;  1SGR I;  1XX6 A;  2NU1 I;  2ORV A;  5JHW C;  1SGQ I;  1X74 A;  3OL0 A;  1PJU A;  1DS3 I;  4A24 A;  1Y8F A;  3GOX A;  1HJA I;  3UGL A;  2QQE A;  1Z7K B;  4UXI A;  1TUS A;  3UGI A;  2N1A B;  2QPO A;  1OVO A;  1M8B A;  2KMP A;  1Y1C A;  2V1C A;  4JCV E;  1TBN A;  2CJS C;  5FUV A;  1CHO I;  1HDL A;  4OVO A;  2K9H A;  1PTR A;  3VE5 A;  2SGF I;  2OD1 A;  1IW4 A;  2F3C I;  1IY6 A;  3E2I A;  3RU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...