1HDLA

Lekti domain one
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
55
structure length
55
Chain Sequence
KNEDQEMCHEFQAFMKNGKLFCPQDKKFFQSLDGIMFINKCATCKMILEKEAKSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Putative serine proteinase inhibitor
molecule keywords SERINE PROTEINASE INHIBITOR LEKTI
publication title Homologous Proteins with Different Folds: The Three-Dimensional Structures of Domains 1 and 6 of the Multiple Kazal-Type Inhibitor Lekti
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2000-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1hdlA00
2JYYA 3QTLD 5JHWC 1MT1A 1N13A 1PPFI 1CT2I 2SGEI 2NU3I 1CSOI 1NUBA 2GKTI 2SGPI 1UVGA 2SGQI 1CT0I 1OMTA 2KMRA 2KMQA 4OVOA 1IY5A 1HDLA 1IW4A 2XRCA 5DAEA 2KCXA 1Z7KB 2ERWA 2QQCA 1CT4I 1SGQI 3SEKC 3SGQI 2GKVA 1UVFA 2NU1I 1IY6A 2JXDA 2M5XA 4HGUA 1Y1CA 1PJUA 1UUCA 2ARPF 1BMOA 1CGII 1M8BA 1OMUA 1LR7A 1LR9A 1H0ZA 1LR8A 2OVOA 1SGDI 2NU4I 3HH2C 1R0RI 1KMAA 2SGDI 2P6AC 3OVOA 2QQDA 2V53A 1FYBA 2BUSA 1TBQR 2JZMA 2N52A 1TIHA 2NU0I 1YU6C 2F3CI 1OVOA 1DS3I 2N71A 1AN1I 3SGBI 1CGJI 1PCEA 1Y1BA 4SGBI 1TURA 1TBRR 1SGPI 1CE3A 2GKRI 1BUSA 1M8CA 2B0UC 1CHOI 2N17A 1SGYI 1YTPA 1SGEI 1HPTA 1OYVI 2KMPA 2KMOA 2NU2I 3TJQA 4GI3C 2LEOA 1HJAI 2WCYA 1DS2I 1TUSA 2SGFI 3B4VC 1TGSI 1SGRI 1SGNI
chains in the Genus database with same CATH superfamily
1ULKA 2E5RA 2ELIA 3QWPA 1FY7A 2JYYA 2WVJA 3QTLD 3RU0A 5JHWC 5CCLA 1K7TA 1MT1A 2DIPA 1N13A 4AMLA 3TO7A 1PPFI 1CT2I 2SGEI 2V1CC 2NU3I 1CSOI 1NUBA 2GKTI 2DKVA 1X74A 2ODDA 1K7UA 3UGDA 3KY9A 2QQ0A 2SGPI 2K9HA 4UXHA 1UVGA 1Z2IA 2SGQI 1CT0I 1PTQA 1W4RA 1OMTA 2KMRA 2KMQA 1TBNA 4OVOA 1FARA 1IY5A 3MEKA 3UGIA 1TBOA 1IW4A 1HDLA 3FSYA 1XBTA 3TO9A 2XRCA 2UVOA 5DAEA 2KCXA 3TOAA 1K7VA 2CJSC 1Z7KB 3VDUA 1XX6A 2ERWA 2A20A 3PDNA 1WGTA 1CT4I 2QQCA 1SGQI 2CWGA 3SEKC 3SGQI 5EX0A 5CCMA 2GKVA 1S20A 2J87A 5J8CA 1UVFA 2NU1I 3VE5A 3OXGA 1IY6A 3UOEA 4A24A 4FKDA 2LUYA 2CWHA 2JA1A 2JXDA 2M5XA 2RIJA 4HGUA 1Y1CA 2E73A 1NXUA 1PJUA 1UUCA 2ARPF 3CXLA 1W3SA 1BMOA 1CGII 1M8BA 1OMUA 1LR7A 1LR9A 1ULMA 1LR8A 2ORVA 1H0ZA 2FNFX 2LB7A 2OVOA 2YUUA 3TO6A 2UZ3A 1SGDI 2NU4I 3HH2C 4WP4A 1X4SA 1R0RI 3VDPA 3UGLA 1U5KA 2V1CA 1KMAA 5FUVA 1XA6A 3UEJA 2SGDI 1PTRA 2J9RA 2P6AC 2X3TA 1WKXA 1VDDA 4B6DA 1MJBA 2VRWB 3D00A 3TOBA 1KBEA 1TOTA 1MJAA 1V1IA 1WTJA 3OVOA 3R5DA 2QQDA 2W0TA 2V53A 1FYBA 3GOXA 1HEVA 2X52A 2GIVA 3OL0A 3OXLA 4MPIA 5HQ8A 4UXIA 3OXFA 2BUSA 1TBQR 2L8EA 2ROWA 5E3RA 3R5AA 5FUYA 9WGAA 2ORWA 2JZMA 2DB6A 2N52A 4E1PA 1TIHA 2NU0I 1YU6C 2F3CI 3R5CA 1OVOA 2YQPA 1DS3I 5J8FA 2N71A 1V1HA 2ENZA 1AN1I 2L7XA 3FC3A 5HI7A 5E3PA 3QAHA 3SGBI 1CGJI 2GVIA 3R5BA 5FUWA 1FAQA 1PCEA 2CWFA 1MJ9A 1Y1BA 4SGBI 2OD1A 2N1AB 5E3QA 1TURA 2B8TA 3UFFA 1R79A 1P9GA 1TBRR 1SGPI 4DNCA 1CE3A 2GKRI 5EX3A 4UXJA 2OU2A 1BUSA 1M8CA 2ENNA 2OZUA 2PQ8A 2B0UC 1CHOI 2QPOA 2N17A 2QQEA 2RC4A 1RFHA 1SGYI 2Y0MA 1YTPA 4JCVE 1P9ZA 1HPTA 1OYVI 1SGEI 1UHAA 1Y8FA 2JW6A 2KMPA 2KMOA 3UEYA 2NU2I 4E1RA 1KBFA 3TJQA 4GI3C 2LEOA 1HJAI 7WGAA 3BJIA 3E2IA 1WGCA 2WCYA 1DS2I 1Q9BA 1TUSA 2SGFI 3B4VC 3E59A 5FUXA 3FSXA 1ULNA 1TGSI 2WGCA 4L9MA 1SGRI 1SGNI
chains in the Genus database with same CATH topology
3QWPA 2E5RA 2ELIA 2JYYA 2WVJA 3QTLD 3RU0A 5JHWC 5CCLA 1MT1A 2DIPA 1N13A 1PPFI 1CT2I 2SGEI 2V1CC 2NU3I 1CSOI 1NUBA 2GKTI 1X74A 2ODDA 3UGDA 3KY9A 2QQ0A 2SGPI 2K9HA 4UXHA 1UVGA 2SGQI 1CT0I 1PTQA 1W4RA 1OMTA 2KMRA 2KMQA 1TBNA 4OVOA 1FARA 1IY5A 3MEKA 3UGIA 1TBOA 1IW4A 1HDLA 1XBTA 2XRCA 5DAEA 2KCXA 1Z7KB 3VDUA 1XX6A 2ERWA 2A20A 3PDNA 2QQCA 1CT4I 1SGQI 3SEKC 3SGQI 5EX0A 5CCMA 2GKVA 2J87A 1UVFA 2NU1I 3VE5A 3OXGA 1IY6A 4A24A 4FKDA 2LUYA 2JA1A 2JXDA 2M5XA 4HGUA 1Y1CA 2E73A 1PJUA 1UUCA 2ARPF 3CXLA 1W3SA 1BMOA 1CGII 1M8BA 1OMUA 1LR7A 1LR9A 2ORVA 1LR8A 1H0ZA 2FNFX 2OVOA 2YUUA 2UZ3A 1SGDI 2NU4I 3HH2C 1X4SA 1R0RI 3VDPA 3UGLA 1U5KA 2V1CA 1KMAA 5FUVA 1XA6A 3UEJA 2SGDI 1PTRA 2J9RA 2P6AC 1VDDA 4B6DA 2VRWB 3D00A 1KBEA 1TOTA 1V1IA 3OVOA 2QQDA 2W0TA 2V53A 1FYBA 3GOXA 3OXLA 3OL0A 5HQ8A 4UXIA 3OXFA 2BUSA 1TBQR 2L8EA 2ROWA 5FUYA 2ORWA 2JZMA 2DB6A 2N52A 4E1PA 1TIHA 2NU0I 1YU6C 2F3CI 1OVOA 2YQPA 1DS3I 2N71A 1V1HA 2ENZA 1AN1I 2L7XA 3FC3A 5HI7A 3SGBI 1CGJI 2GVIA 1FAQA 5FUWA 1PCEA 1Y1BA 4SGBI 2OD1A 2N1AB 1TURA 2B8TA 3UFFA 1R79A 1TBRR 1SGPI 1CE3A 2GKRI 5EX3A 4UXJA 1BUSA 1M8CA 2ENNA 2QPOA 2B0UC 1CHOI 2N17A 2QQEA 1RFHA 1SGYI 1YTPA 4JCVE 1SGEI 1HPTA 1OYVI 1Y8FA 2JW6A 2KMPA 2KMOA 3UEYA 2NU2I 4E1RA 1KBFA 3TJQA 4GI3C 2LEOA 1HJAI 3BJIA 3E2IA 2WCYA 1DS2I 3E59A 1TUSA 2SGFI 3B4VC 5FUXA 1SGNI 1TGSI 4L9MA 1SGRI 2CJSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JYY A;  3QTL D;  5JHW C;  1MT1 A;  1N13 A;  1PPF I;  1CT2 I;  2SGE I;  2NU3 I;  1CSO I;  1NUB A;  2GKT I;  2SGP I;  1UVG A;  2SGQ I;  1CT0 I;  1OMT A;  2KMR A;  2KMQ A;  4OVO A;  1IY5 A;  1HDL A;  1IW4 A;  2XRC A;  5DAE A;  2KCX A;  1Z7K B;  2ERW A;  2QQC A;  1CT4 I;  1SGQ I;  3SEK C;  3SGQ I;  2GKV A;  1UVF A;  2NU1 I;  1IY6 A;  2JXD A;  2M5X A;  4HGU A;  1Y1C A;  1PJU A;  1UUC A;  2ARP F;  1BMO A;  1CGI I;  1M8B A;  1OMU A;  1LR7 A;  1LR9 A;  1H0Z A;  1LR8 A;  2OVO A;  1SGD I;  2NU4 I;  3HH2 C;  1R0R I;  1KMA A;  2SGD I;  2P6A C;  3OVO A;  2QQD A;  2V53 A;  1FYB A;  2BUS A;  1TBQ R;  2JZM A;  2N52 A;  1TIH A;  2NU0 I;  1YU6 C;  2F3C I;  1OVO A;  1DS3 I;  2N71 A;  1AN1 I;  3SGB I;  1CGJ I;  1PCE A;  1Y1B A;  4SGB I;  1TUR A;  1TBR R;  1SGP I;  1CE3 A;  2GKR I;  1BUS A;  1M8C A;  2B0U C;  1CHO I;  2N17 A;  1SGY I;  1YTP A;  1SGE I;  1HPT A;  1OYV I;  2KMP A;  2KMO A;  2NU2 I;  3TJQ A;  4GI3 C;  2LEO A;  1HJA I;  2WCY A;  1DS2 I;  1TUS A;  2SGF I;  3B4V C;  1TGS I;  1SGR I;  1SGN I; 
#chains in the Genus database with same CATH topology
 1ULK A;  2E5R A;  2ELI A;  3QWP A;  1FY7 A;  2JYY A;  2WVJ A;  3QTL D;  3RU0 A;  5JHW C;  5CCL A;  1K7T A;  1MT1 A;  2DIP A;  1N13 A;  4AML A;  3TO7 A;  1PPF I;  1CT2 I;  2SGE I;  2V1C C;  2NU3 I;  1CSO I;  1NUB A;  2GKT I;  2DKV A;  1X74 A;  2ODD A;  1K7U A;  3UGD A;  3KY9 A;  2QQ0 A;  2SGP I;  2K9H A;  4UXH A;  1UVG A;  1Z2I A;  2SGQ I;  1CT0 I;  1PTQ A;  1W4R A;  1OMT A;  2KMR A;  2KMQ A;  1TBN A;  4OVO A;  1FAR A;  1IY5 A;  3MEK A;  3UGI A;  1TBO A;  1IW4 A;  1HDL A;  3FSY A;  1XBT A;  3TO9 A;  2XRC A;  2UVO A;  5DAE A;  2KCX A;  3TOA A;  1K7V A;  2CJS C;  1Z7K B;  3VDU A;  1XX6 A;  2ERW A;  2A20 A;  3PDN A;  1WGT A;  1CT4 I;  2QQC A;  1SGQ I;  2CWG A;  3SEK C;  3SGQ I;  5EX0 A;  5CCM A;  2GKV A;  1S20 A;  2J87 A;  5J8C A;  1UVF A;  2NU1 I;  3VE5 A;  3OXG A;  1IY6 A;  3UOE A;  4A24 A;  4FKD A;  2LUY A;  2CWH A;  2JA1 A;  2JXD A;  2M5X A;  2RIJ A;  4HGU A;  1Y1C A;  2E73 A;  1NXU A;  1PJU A;  1UUC A;  2ARP F;  3CXL A;  1W3S A;  1BMO A;  1CGI I;  1M8B A;  1OMU A;  1LR7 A;  1LR9 A;  1ULM A;  1LR8 A;  2ORV A;  1H0Z A;  2FNF X;  2LB7 A;  2OVO A;  2YUU A;  3TO6 A;  2UZ3 A;  1SGD I;  2NU4 I;  3HH2 C;  4WP4 A;  1X4S A;  1R0R I;  3VDP A;  3UGL A;  1U5K A;  2V1C A;  1KMA A;  5FUV A;  1XA6 A;  3UEJ A;  2SGD I;  1PTR A;  2J9R A;  2P6A C;  2X3T A;  1WKX A;  1VDD A;  4B6D A;  1MJB A;  2VRW B;  3D00 A;  3TOB A;  1KBE A;  1TOT A;  1MJA A;  1V1I A;  1WTJ A;  3OVO A;  3R5D A;  2QQD A;  2W0T A;  2V53 A;  1FYB A;  3GOX A;  1HEV A;  2X52 A;  2GIV A;  3OL0 A;  3OXL A;  4MPI A;  5HQ8 A;  4UXI A;  3OXF A;  2BUS A;  1TBQ R;  2L8E A;  2ROW A;  5E3R A;  3R5A A;  5FUY A;  9WGA A;  2ORW A;  2JZM A;  2DB6 A;  2N52 A;  4E1P A;  1TIH A;  2NU0 I;  1YU6 C;  2F3C I;  3R5C A;  1OVO A;  2YQP A;  1DS3 I;  5J8F A;  2N71 A;  1V1H A;  2ENZ A;  1AN1 I;  2L7X A;  3FC3 A;  5HI7 A;  5E3P A;  3QAH A;  3SGB I;  1CGJ I;  2GVI A;  3R5B A;  5FUW A;  1FAQ A;  1PCE A;  2CWF A;  1MJ9 A;  1Y1B A;  4SGB I;  2OD1 A;  2N1A B;  5E3Q A;  1TUR A;  2B8T A;  3UFF A;  1R79 A;  1P9G A;  1TBR R;  1SGP I;  4DNC A;  1CE3 A;  2GKR I;  5EX3 A;  4UXJ A;  2OU2 A;  1BUS A;  1M8C A;  2ENN A;  2OZU A;  2PQ8 A;  2B0U C;  1CHO I;  2QPO A;  2N17 A;  2QQE A;  2RC4 A;  1RFH A;  1SGY I;  2Y0M A;  1YTP A;  4JCV E;  1P9Z A;  1HPT A;  1OYV I;  1SGE I;  1UHA A;  1Y8F A;  2JW6 A;  2KMP A;  2KMO A;  3UEY A;  2NU2 I;  4E1R A;  1KBF A;  3TJQ A;  4GI3 C;  2LEO A;  1HJA I;  7WGA A;  3BJI A;  3E2I A;  1WGC A;  2WCY A;  1DS2 I;  1Q9B A;  1TUS A;  2SGF I;  3B4V C;  3E59 A;  5FUX A;  3FSX A;  1ULN A;  1TGS I;  2WGC A;  4L9M A;  1SGR I;  1SGN I; 
#chains in the Genus database with same CATH homology
 3QWP A;  2E5R A;  2ELI A;  2JYY A;  2WVJ A;  3QTL D;  3RU0 A;  5JHW C;  5CCL A;  1MT1 A;  2DIP A;  1N13 A;  1PPF I;  1CT2 I;  2SGE I;  2V1C C;  2NU3 I;  1CSO I;  1NUB A;  2GKT I;  1X74 A;  2ODD A;  3UGD A;  3KY9 A;  2QQ0 A;  2SGP I;  2K9H A;  4UXH A;  1UVG A;  2SGQ I;  1CT0 I;  1PTQ A;  1W4R A;  1OMT A;  2KMR A;  2KMQ A;  1TBN A;  4OVO A;  1FAR A;  1IY5 A;  3MEK A;  3UGI A;  1TBO A;  1IW4 A;  1HDL A;  1XBT A;  2XRC A;  5DAE A;  2KCX A;  1Z7K B;  3VDU A;  1XX6 A;  2ERW A;  2A20 A;  3PDN A;  2QQC A;  1CT4 I;  1SGQ I;  3SEK C;  3SGQ I;  5EX0 A;  5CCM A;  2GKV A;  2J87 A;  1UVF A;  2NU1 I;  3VE5 A;  3OXG A;  1IY6 A;  4A24 A;  4FKD A;  2LUY A;  2JA1 A;  2JXD A;  2M5X A;  4HGU A;  1Y1C A;  2E73 A;  1PJU A;  1UUC A;  2ARP F;  3CXL A;  1W3S A;  1BMO A;  1CGI I;  1M8B A;  1OMU A;  1LR7 A;  1LR9 A;  2ORV A;  1LR8 A;  1H0Z A;  2FNF X;  2OVO A;  2YUU A;  2UZ3 A;  1SGD I;  2NU4 I;  3HH2 C;  1X4S A;  1R0R I;  3VDP A;  3UGL A;  1U5K A;  2V1C A;  1KMA A;  5FUV A;  1XA6 A;  3UEJ A;  2SGD I;  1PTR A;  2J9R A;  2P6A C;  1VDD A;  4B6D A;  2VRW B;  3D00 A;  1KBE A;  1TOT A;  1V1I A;  3OVO A;  2QQD A;  2W0T A;  2V53 A;  1FYB A;  3GOX A;  3OXL A;  3OL0 A;  5HQ8 A;  4UXI A;  3OXF A;  2BUS A;  1TBQ R;  2L8E A;  2ROW A;  5FUY A;  2ORW A;  2JZM A;  2DB6 A;  2N52 A;  4E1P A;  1TIH A;  2NU0 I;  1YU6 C;  2F3C I;  1OVO A;  2YQP A;  1DS3 I;  2N71 A;  1V1H A;  2ENZ A;  1AN1 I;  2L7X A;  3FC3 A;  5HI7 A;  3SGB I;  1CGJ I;  2GVI A;  1FAQ A;  5FUW A;  1PCE A;  1Y1B A;  4SGB I;  2OD1 A;  2N1A B;  1TUR A;  2B8T A;  3UFF A;  1R79 A;  1TBR R;  1SGP I;  1CE3 A;  2GKR I;  5EX3 A;  4UXJ A;  1BUS A;  1M8C A;  2ENN A;  2QPO A;  2B0U C;  1CHO I;  2N17 A;  2QQE A;  1RFH A;  1SGY I;  1YTP A;  4JCV E;  1SGE I;  1HPT A;  1OYV I;  1Y8F A;  2JW6 A;  2KMP A;  2KMO A;  3UEY A;  2NU2 I;  4E1R A;  1KBF A;  3TJQ A;  4GI3 C;  2LEO A;  1HJA I;  3BJI A;  3E2I A;  2WCY A;  1DS2 I;  3E59 A;  1TUS A;  2SGF I;  3B4V C;  5FUX A;  1SGN I;  1TGS I;  4L9M A;  1SGR I;  2CJS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...