2ROWA

The c1 domain of rock ii
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
84
structure length
84
Chain Sequence
ESKKEPEFPVEPVGEKSNYICHKGHEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho-associated protein kinase 2
publication title The C1 domain of ROCK II
rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 10
structure length 84
sequence length 84
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2rowA01
2UZ3A 4L9MA 2JA1A 2J87A 2ORWA 1Y8FA 2VRWB 3CXLA 2GVIA 4FKDA 2DB6A 1RFHA 5FUVA 5FUYA 1XA6A 1TBNA 3BJIA 2YUUA 3UEYA 2QQEA 4UXHA 1TBOA 1R79A 2ENNA 2QPOA 4UXIA 1XBTA 1KBFA 2ELIA 3KY9A 1FAQA 2WVJA 2B8TA 4B6DA 3UGDA 1FARA 1XX6A 4UXJA 2ENZA 2QQ0A 1PTRA 5FUXA 3UGLA 1PTQA 2ORVA 3E2IA 3UFFA 2FNFX 3UEJA 1KBEA 3UGIA 1W4RA 5FUWA 2ROWA 2E73A 2J9RA
chains in the Genus database with same CATH superfamily
2N17A 1BUSA 2KMRA 3TJQA 2LEOA 2K9HA 4L9MA 3PDNA 4AMLA 4E1PA 2J87A 4E1RA 1LR8A 2SGQI 5CCMA 1NUBA 1R0RI 2DB6A 3B4VC 5FUVA 1HPTA 1HEVA 3GOXA 1UUCA 5E3PA 1UVGA 2YUUA 2QQEA 2NU4I 1Q9BA 1R79A 1AN1I 2QPOA 1XBTA 1H0ZA 2KCXA 1HJAI 3MEKA 3RU0A 2B0UC 2XRCA 3OXFA 4B6DA 2SGPI 1XX6A 2ENZA 2NU0I 1Y1BA 1PTQA 1U5KA 1DS3I 5HI7A 2ARPF 2JXDA 3R5AA 4SGBI 5EX3A 1UVFA 2F3CI 2QQDA 3TO9A 2SGFI 2UVOA 1Y1CA 1IY5A 2M5XA 3OXLA 3FC3A 3OXGA 2JA1A 2NU2I 3TOBA 2ORWA 3FSYA 3CXLA 1OMTA 1K7TA 2WCYA 1Z7KB 9WGAA 1IW4A 1TBQR 1P9GA 3D00A 2SGDI 2JZMA 2W0TA 1K7VA 2L8EA 3E59A 2OU2A 3OL0A 3TO7A 5E3RA 2CWGA 1TGSI 4JCVE 1XA6A 2A20A 1CT0I 1BMOA 3UEYA 2GKTI 4UXHA 2N71A 2ENNA 1OMUA 4UXIA 4MPIA 2QQCA 1OYVI 2ELIA 3FSXA 1WKXA 3UGDA 1MT1A 1WTJA 2LUYA 3QTLD 4UXJA 1TOTA 2KMOA 2L7XA 2PQ8A 2QQ0A 2WGCA 2RC4A 1CGII 3QWPA 3SGQI 1SGPI 1LR7A 1V1HA 2NU1I 7WGAA 1ULNA 1VDDA 2CWHA 4A24A 1KBEA 1SGNI 2KMQA 1W4RA 4WP4A 2P6AC 3TO6A 2ROWA 3VDUA 1KMAA 2E73A 3QAHA 2NU3I 2DKVA 1M8CA 1S20A 1SGYI 4GI3C 5EX0A 1SGRI 1YU6C 2ERWA 2GIVA 1IY6A 1Y8FA 2RIJA 2X52A 1M8BA 3UOEA 2OVOA 2JW6A 2OD1A 1WGTA 2Y0MA 1TBRR 5FUYA 1TBNA 2V53A 3R5DA 1UHAA 2LB7A 1KBFA 3VE5A 1FAQA 2WVJA 2BUSA 2N52A 3OVOA 5FUXA 1PTRA 1MJBA 5J8CA 2SGEI 2ORVA 1N13A 2FNFX 1CSOI 4DNCA 1SGDI 3R5BA 2OZUA 3VDPA 1CHOI 2E5RA 1OVOA 1PPFI 4HGUA 2J9RA 2CWFA 3BJIA 2ODDA 1CE3A 2UZ3A 1TUSA 4OVOA 5CCLA 2VRWB 3TOAA 3R5CA 2YQPA 1DS2I 2GVIA 1HDLA 4FKDA 1W3SA 1RFHA 2DIPA 1WGCA 2V1CC 1PCEA 1CGJI 1CT4I 2KMPA 3SEKC 3SGBI 1ULKA 1MJ9A 3HH2C 1TBOA 2CJSC 1MJAA 1SGEI 2GKVA 2N1AB 1V1IA 3KY9A 1P9ZA 5J8FA 2B8TA 1FARA 2X3TA 1Z2IA 5DAEA 1CT2I 1X4SA 1LR9A 1TIHA 1ULMA 3UGLA 1FY7A 3E2IA 1PJUA 1SGQI 2JYYA 3UFFA 2GKRI 3UEJA 1K7UA 5HQ8A 1X74A 5JHWC 3UGIA 5FUWA 1TURA 1YTPA 1NXUA 2V1CA 1FYBA 5E3QA
chains in the Genus database with same CATH topology
2N17A 1BUSA 2KMRA 3TJQA 2LEOA 2K9HA 4L9MA 3PDNA 4E1PA 5CCMA 2J87A 4E1RA 1LR8A 2SGQI 1NUBA 1R0RI 2DB6A 3B4VC 5FUVA 1HPTA 3GOXA 1UUCA 1UVGA 2YUUA 2QQEA 2NU4I 1R79A 1AN1I 2QPOA 1XBTA 1H0ZA 2KCXA 1HJAI 3MEKA 3RU0A 2B0UC 2XRCA 3OXFA 4B6DA 2SGPI 1XX6A 2ENZA 2NU0I 1Y1BA 1PTQA 1U5KA 1DS3I 5HI7A 2ARPF 2JXDA 4SGBI 5EX3A 1UVFA 2F3CI 2QQDA 2SGFI 1Y1CA 1IY5A 2M5XA 3OXLA 3FC3A 3OXGA 2JA1A 2NU2I 2ORWA 3CXLA 1OMTA 2WCYA 1IW4A 1Z7KB 1TBQR 3D00A 2SGDI 2JZMA 2W0TA 3E59A 2L8EA 3OL0A 1TGSI 4JCVE 1XA6A 2A20A 1CT0I 1BMOA 3UEYA 2GKTI 4UXHA 2N71A 2ENNA 1OMUA 4UXIA 2QQCA 1OYVI 2ELIA 3UGDA 1MT1A 4UXJA 2LUYA 3QTLD 1TOTA 2KMOA 2L7XA 2QQ0A 3QWPA 1CGII 3SGQI 1SGPI 1LR7A 1V1HA 2NU1I 1VDDA 4A24A 1KBEA 1SGNI 2KMQA 1W4RA 2P6AC 2ROWA 3VDUA 1KMAA 2E73A 2NU3I 1M8CA 1SGYI 4GI3C 5EX0A 1SGRI 1YU6C 2ERWA 1IY6A 1Y8FA 1M8BA 2OVOA 2JW6A 2OD1A 5FUYA 1TBRR 1TBNA 2V53A 1KBFA 3VE5A 1FAQA 2WVJA 2BUSA 2N52A 3OVOA 5FUXA 1PTRA 2SGEI 2ORVA 1N13A 2FNFX 1CSOI 1SGDI 3VDPA 1CHOI 2E5RA 1OVOA 1PPFI 4HGUA 2J9RA 3BJIA 1CE3A 2ODDA 2UZ3A 1TUSA 4OVOA 5CCLA 2VRWB 2YQPA 1DS2I 2GVIA 1HDLA 4FKDA 1W3SA 1RFHA 2DIPA 2V1CC 1PCEA 1CGJI 1CT4I 2KMPA 3SEKC 3SGBI 3HH2C 1TBOA 2CJSC 1SGEI 2GKVA 2N1AB 1V1IA 3KY9A 2B8TA 1FARA 5DAEA 1CT2I 1X4SA 1LR9A 1TIHA 3UGLA 3E2IA 1PJUA 1SGQI 2JYYA 3UFFA 2GKRI 3UEJA 5HQ8A 1X74A 5JHWC 3UGIA 5FUWA 1TURA 1YTPA 2V1CA 1FYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZ3 A;  4L9M A;  2JA1 A;  2J87 A;  2ORW A;  1Y8F A;  2VRW B;  3CXL A;  2GVI A;  4FKD A;  2DB6 A;  1RFH A;  5FUV A;  5FUY A;  1XA6 A;  1TBN A;  3BJI A;  2YUU A;  3UEY A;  2QQE A;  4UXH A;  1TBO A;  1R79 A;  2ENN A;  2QPO A;  4UXI A;  1XBT A;  1KBF A;  2ELI A;  3KY9 A;  1FAQ A;  2WVJ A;  2B8T A;  4B6D A;  3UGD A;  1FAR A;  1XX6 A;  4UXJ A;  2ENZ A;  2QQ0 A;  1PTR A;  5FUX A;  3UGL A;  1PTQ A;  2ORV A;  3E2I A;  3UFF A;  2FNF X;  3UEJ A;  1KBE A;  3UGI A;  1W4R A;  5FUW A;  2ROW A;  2E73 A;  2J9R A; 
#chains in the Genus database with same CATH topology
 2N17 A;  1BUS A;  2KMR A;  3TJQ A;  2LEO A;  2K9H A;  4L9M A;  3PDN A;  4AML A;  4E1P A;  2J87 A;  4E1R A;  1LR8 A;  2SGQ I;  5CCM A;  1NUB A;  1R0R I;  2DB6 A;  3B4V C;  5FUV A;  1HPT A;  1HEV A;  3GOX A;  1UUC A;  5E3P A;  1UVG A;  2YUU A;  2QQE A;  2NU4 I;  1Q9B A;  1R79 A;  1AN1 I;  2QPO A;  1XBT A;  1H0Z A;  2KCX A;  1HJA I;  3MEK A;  3RU0 A;  2B0U C;  2XRC A;  3OXF A;  4B6D A;  2SGP I;  1XX6 A;  2ENZ A;  2NU0 I;  1Y1B A;  1PTQ A;  1U5K A;  1DS3 I;  5HI7 A;  2ARP F;  2JXD A;  3R5A A;  4SGB I;  5EX3 A;  1UVF A;  2F3C I;  2QQD A;  3TO9 A;  2SGF I;  2UVO A;  1Y1C A;  1IY5 A;  2M5X A;  3OXL A;  3FC3 A;  3OXG A;  2JA1 A;  2NU2 I;  3TOB A;  2ORW A;  3FSY A;  3CXL A;  1OMT A;  1K7T A;  2WCY A;  1Z7K B;  9WGA A;  1IW4 A;  1TBQ R;  1P9G A;  3D00 A;  2SGD I;  2JZM A;  2W0T A;  1K7V A;  2L8E A;  3E59 A;  2OU2 A;  3OL0 A;  3TO7 A;  5E3R A;  2CWG A;  1TGS I;  4JCV E;  1XA6 A;  2A20 A;  1CT0 I;  1BMO A;  3UEY A;  2GKT I;  4UXH A;  2N71 A;  2ENN A;  1OMU A;  4UXI A;  4MPI A;  2QQC A;  1OYV I;  2ELI A;  3FSX A;  1WKX A;  3UGD A;  1MT1 A;  1WTJ A;  2LUY A;  3QTL D;  4UXJ A;  1TOT A;  2KMO A;  2L7X A;  2PQ8 A;  2QQ0 A;  2WGC A;  2RC4 A;  1CGI I;  3QWP A;  3SGQ I;  1SGP I;  1LR7 A;  1V1H A;  2NU1 I;  7WGA A;  1ULN A;  1VDD A;  2CWH A;  4A24 A;  1KBE A;  1SGN I;  2KMQ A;  1W4R A;  4WP4 A;  2P6A C;  3TO6 A;  2ROW A;  3VDU A;  1KMA A;  2E73 A;  3QAH A;  2NU3 I;  2DKV A;  1M8C A;  1S20 A;  1SGY I;  4GI3 C;  5EX0 A;  1SGR I;  1YU6 C;  2ERW A;  2GIV A;  1IY6 A;  1Y8F A;  2RIJ A;  2X52 A;  1M8B A;  3UOE A;  2OVO A;  2JW6 A;  2OD1 A;  1WGT A;  2Y0M A;  1TBR R;  5FUY A;  1TBN A;  2V53 A;  3R5D A;  1UHA A;  2LB7 A;  1KBF A;  3VE5 A;  1FAQ A;  2WVJ A;  2BUS A;  2N52 A;  3OVO A;  5FUX A;  1PTR A;  1MJB A;  5J8C A;  2SGE I;  2ORV A;  1N13 A;  2FNF X;  1CSO I;  4DNC A;  1SGD I;  3R5B A;  2OZU A;  3VDP A;  1CHO I;  2E5R A;  1OVO A;  1PPF I;  4HGU A;  2J9R A;  2CWF A;  3BJI A;  2ODD A;  1CE3 A;  2UZ3 A;  1TUS A;  4OVO A;  5CCL A;  2VRW B;  3TOA A;  3R5C A;  2YQP A;  1DS2 I;  2GVI A;  1HDL A;  4FKD A;  1W3S A;  1RFH A;  2DIP A;  1WGC A;  2V1C C;  1PCE A;  1CGJ I;  1CT4 I;  2KMP A;  3SEK C;  3SGB I;  1ULK A;  1MJ9 A;  3HH2 C;  1TBO A;  2CJS C;  1MJA A;  1SGE I;  2GKV A;  2N1A B;  1V1I A;  3KY9 A;  1P9Z A;  5J8F A;  2B8T A;  1FAR A;  2X3T A;  1Z2I A;  5DAE A;  1CT2 I;  1X4S A;  1LR9 A;  1TIH A;  1ULM A;  3UGL A;  1FY7 A;  3E2I A;  1PJU A;  1SGQ I;  2JYY A;  3UFF A;  2GKR I;  3UEJ A;  1K7U A;  5HQ8 A;  1X74 A;  5JHW C;  3UGI A;  5FUW A;  1TUR A;  1YTP A;  1NXU A;  2V1C A;  1FYB A;  5E3Q A; 
#chains in the Genus database with same CATH homology
 2N17 A;  1BUS A;  2KMR A;  3TJQ A;  2LEO A;  2K9H A;  4L9M A;  3PDN A;  4E1P A;  5CCM A;  2J87 A;  4E1R A;  1LR8 A;  2SGQ I;  1NUB A;  1R0R I;  2DB6 A;  3B4V C;  5FUV A;  1HPT A;  3GOX A;  1UUC A;  1UVG A;  2YUU A;  2QQE A;  2NU4 I;  1R79 A;  1AN1 I;  2QPO A;  1XBT A;  1H0Z A;  2KCX A;  1HJA I;  3MEK A;  3RU0 A;  2B0U C;  2XRC A;  3OXF A;  4B6D A;  2SGP I;  1XX6 A;  2ENZ A;  2NU0 I;  1Y1B A;  1PTQ A;  1U5K A;  1DS3 I;  5HI7 A;  2ARP F;  2JXD A;  4SGB I;  5EX3 A;  1UVF A;  2F3C I;  2QQD A;  2SGF I;  1Y1C A;  1IY5 A;  2M5X A;  3OXL A;  3FC3 A;  3OXG A;  2JA1 A;  2NU2 I;  2ORW A;  3CXL A;  1OMT A;  2WCY A;  1IW4 A;  1Z7K B;  1TBQ R;  3D00 A;  2SGD I;  2JZM A;  2W0T A;  3E59 A;  2L8E A;  3OL0 A;  1TGS I;  4JCV E;  1XA6 A;  2A20 A;  1CT0 I;  1BMO A;  3UEY A;  2GKT I;  4UXH A;  2N71 A;  2ENN A;  1OMU A;  4UXI A;  2QQC A;  1OYV I;  2ELI A;  3UGD A;  1MT1 A;  4UXJ A;  2LUY A;  3QTL D;  1TOT A;  2KMO A;  2L7X A;  2QQ0 A;  3QWP A;  1CGI I;  3SGQ I;  1SGP I;  1LR7 A;  1V1H A;  2NU1 I;  1VDD A;  4A24 A;  1KBE A;  1SGN I;  2KMQ A;  1W4R A;  2P6A C;  2ROW A;  3VDU A;  1KMA A;  2E73 A;  2NU3 I;  1M8C A;  1SGY I;  4GI3 C;  5EX0 A;  1SGR I;  1YU6 C;  2ERW A;  1IY6 A;  1Y8F A;  1M8B A;  2OVO A;  2JW6 A;  2OD1 A;  5FUY A;  1TBR R;  1TBN A;  2V53 A;  1KBF A;  3VE5 A;  1FAQ A;  2WVJ A;  2BUS A;  2N52 A;  3OVO A;  5FUX A;  1PTR A;  2SGE I;  2ORV A;  1N13 A;  2FNF X;  1CSO I;  1SGD I;  3VDP A;  1CHO I;  2E5R A;  1OVO A;  1PPF I;  4HGU A;  2J9R A;  3BJI A;  1CE3 A;  2ODD A;  2UZ3 A;  1TUS A;  4OVO A;  5CCL A;  2VRW B;  2YQP A;  1DS2 I;  2GVI A;  1HDL A;  4FKD A;  1W3S A;  1RFH A;  2DIP A;  2V1C C;  1PCE A;  1CGJ I;  1CT4 I;  2KMP A;  3SEK C;  3SGB I;  3HH2 C;  1TBO A;  2CJS C;  1SGE I;  2GKV A;  2N1A B;  1V1I A;  3KY9 A;  2B8T A;  1FAR A;  5DAE A;  1CT2 I;  1X4S A;  1LR9 A;  1TIH A;  3UGL A;  3E2I A;  1PJU A;  1SGQ I;  2JYY A;  3UFF A;  2GKR I;  3UEJ A;  5HQ8 A;  1X74 A;  5JHW C;  3UGI A;  5FUW A;  1TUR A;  1YTP A;  2V1C A;  1FYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...