2ROWA

The c1 domain of rock ii
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
84
structure length
84
Chain Sequence
ESKKEPEFPVEPVGEKSNYICHKGHEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Rho-associated protein kinase 2
publication title The C1 domain of ROCK II
rcsb
source organism Rattus norvegicus
total genus 10
structure length 84
sequence length 84
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2rowA01
2WVJA 1W4RA 2ORWA 1Y8FA 3BJIA 2J87A 2DB6A 1XA6A 5FUXA 1RFHA 1PTQA 2FNFX 1XBTA 2J9RA 1FARA 2QQ0A 3UEJA 3KY9A 4UXIA 2ENZA 4B6DA 2GVIA 2ROWA 4FKDA 3E2IA 3UGDA 1FAQA 1TBOA 2ENNA 1XX6A 2QQEA 2YUUA 5FUWA 3UFFA 2QPOA 2UZ3A 3UEYA 2E73A 1KBFA 3CXLA 3UGIA 1TBNA 5FUYA 1R79A 4UXHA 5FUVA 1PTRA 4L9MA 2ORVA 2ELIA 2B8TA 2JA1A 1KBEA 3UGLA 2VRWB 4UXJA
chains in the Genus database with same CATH superfamily
2WVJA 1WGCA 2ORWA 2WGCA 2KCXA 1TIHA 1WGTA 1M8CA 1XA6A 1MJ9A 2W0TA 5FUXA 1TBRR 2F3CI 1BUSA 1R0RI 1NXUA 2FNFX 2NU0I 3FSYA 1FARA 3KY9A 1PPFI 1SGQI 1LR7A 2GVIA 1TURA 1Y1BA 2ROWA 2N1AB 3E2IA 2SGDI 4FKDA 7WGAA 1K7VA 1HDLA 1SGRI 2LUYA 1UVFA 2ENNA 2QQEA 5FUWA 3R5AA 3UFFA 2UZ3A 3VDUA 9WGAA 2NU1I 5EX3A 3UGIA 2UVOA 1YTPA 2RC4A 1TBNA 5HI7A 5JHWC 1CSOI 1S20A 1CT0I 1TGSI 5J8FA 2SGFI 4UXHA 1HJAI 1U5KA 2PQ8A 3TO9A 1DS2I 1BMOA 1ULMA 3OXGA 1UUCA 1MT1A 1YU6C 2DB6A 2YQPA 2B0UC 1K7TA 1AN1I 1RFHA 2A20A 1PTQA 2M5XA 2ODDA 4A24A 2XRCA 2DIPA 2J9RA 2QQ0A 1SGEI 3UEJA 4E1RA 2NU3I 3FC3A 1H0ZA 2N17A 4UXIA 2CWGA 1X74A 1WKXA 3OXLA 3D00A 1FAQA 2WCYA 2KMQA 4OVOA 1SGNI 2L8EA 3QTLD 1XX6A 4AMLA 2YUUA 2NU4I 3PDNA 1TUSA 1Z7KB 2E73A 1CT2I 1SGPI 1Y1CA 3B4VC 3CXLA 2CWHA 2L7XA 2OU2A 1MJAA 2RIJA 1N13A 1CGJI 1PTRA 4UXJA 2BUSA 1UHAA 4HGUA 3HH2C 1PCEA 1Q9BA 2CWFA 2KMRA 2OZUA 3R5BA 5HQ8A 3GOXA 2VRWB 3FSXA 4MPIA 1TOTA 1W4RA 2DKVA 3SGQI 2OVOA 3BJIA 3TO7A 2J87A 1HPTA 1OMUA 2QQDA 3TOAA 5E3PA 2SGQI 1TBQR 2V1CA 3TOBA 1KMAA 1P9ZA 2ENZA 2KMPA 3OL0A 5E3RA 1LR8A 4SGBI 1V1IA 3UGDA 2GKVA 1UVGA 1MJBA 5E3QA 1CE3A 1M8BA 2X52A 2N52A 1SGYI 3UEYA 5DAEA 3QWPA 1KBFA 1P9GA 4JCVE 2P6AC 3SGBI 1LR9A 1NUBA 1CT4I 4DNCA 2ORVA 2LB7A 1Z2IA 2B8TA 1CHOI 2Y0MA 1VDDA 2OD1A 3TJQA 1KBEA 3UGLA 3OVOA 2ERWA 2SGEI 1OVOA 2X3TA 3RU0A 3E59A 1Y8FA 3VE5A 1OMTA 2V1CC 1OYVI 4E1PA 1WTJA 1IY5A 2K9HA 3OXFA 1V1HA 2GKTI 3QAHA 1FYBA 1XBTA 5J8CA 2KMOA 2JZMA 2SGPI 2NU2I 4B6DA 1ULKA 1CGII 1PJUA 3VDPA 1X4SA 1DS3I 1TBOA 2JYYA 2N71A 1IY6A 1HEVA 2QPOA 1K7UA 1W3SA 2ARPF 5CCMA 1SGDI 2GKRI 4WP4A 5FUYA 2E5RA 2QQCA 3TO6A 5EX0A 1FY7A 2CJSC 1R79A 2JXDA 5FUVA 1IW4A 4GI3C 4L9MA 2LEOA 2GIVA 2V53A 2ELIA 3R5DA 5CCLA 3SEKC 2JA1A 1ULNA 3UOEA 3R5CA 2JW6A 3MEKA
chains in the Genus database with same CATH topology
2WVJA 2ORWA 2KCXA 1TIHA 1M8CA 1XA6A 2W0TA 5FUXA 1TBRR 2F3CI 1BUSA 1R0RI 2FNFX 2NU0I 1FARA 3KY9A 1PPFI 1SGQI 1LR7A 2GVIA 1TURA 1Y1BA 2ROWA 2N1AB 3E2IA 2SGDI 4FKDA 1IW4A 1HDLA 1SGRI 2LUYA 1UVFA 2ENNA 2QQEA 5FUWA 3UFFA 2UZ3A 3VDUA 2NU1I 5EX3A 3UGIA 1YTPA 1TBNA 5HI7A 5JHWC 1CSOI 1CT0I 1TGSI 2SGFI 4UXHA 1HJAI 1U5KA 1DS2I 1BMOA 3OXGA 1UUCA 1MT1A 1YU6C 2DB6A 2YQPA 2B0UC 1AN1I 1RFHA 2A20A 1PTQA 2M5XA 2ODDA 4A24A 2XRCA 2DIPA 2J9RA 2QQ0A 1SGEI 3UEJA 4E1RA 2NU3I 3FC3A 1H0ZA 2N17A 4UXIA 1X74A 3OXLA 3D00A 1FAQA 2WCYA 2KMQA 4OVOA 1SGNI 2L8EA 3QTLD 1XX6A 2YUUA 2NU4I 3PDNA 1TUSA 1Z7KB 2E73A 1CT2I 1SGPI 1Y1CA 3B4VC 3CXLA 2L7XA 1N13A 1CGJI 1PTRA 4UXJA 2BUSA 4HGUA 3HH2C 1PCEA 2KMRA 5HQ8A 3GOXA 2VRWB 1TOTA 1W4RA 3SGQI 2OVOA 3BJIA 2J87A 1HPTA 1OMUA 2QQDA 2SGQI 1TBQR 2V1CA 1KMAA 2KMPA 2ENZA 3OL0A 1LR8A 4SGBI 1V1IA 3UGDA 2GKVA 1UVGA 1CE3A 1M8BA 2N52A 1SGYI 3UEYA 5DAEA 3QWPA 1KBFA 4JCVE 2P6AC 3SGBI 1LR9A 1NUBA 1CT4I 2ORVA 2B8TA 1CHOI 1VDDA 2OD1A 3TJQA 1KBEA 3UGLA 3OVOA 2ERWA 2SGEI 1OVOA 3RU0A 3E59A 1Y8FA 3VE5A 1OMTA 2V1CC 1OYVI 4E1PA 1IY5A 2K9HA 3OXFA 1V1HA 2GKTI 1FYBA 1XBTA 2KMOA 2JZMA 2SGPI 2NU2I 4B6DA 1CGII 1PJUA 3VDPA 1X4SA 1DS3I 1TBOA 2JYYA 2N71A 1IY6A 2QPOA 1W3SA 2ARPF 5CCMA 1SGDI 2GKRI 5FUYA 2E5RA 2QQCA 5EX0A 2CJSC 1R79A 2JXDA 5FUVA 4GI3C 4L9MA 2LEOA 2V53A 2ELIA 5CCLA 3SEKC 2JA1A 2JW6A 3MEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WVJ A;  1W4R A;  2ORW A;  1Y8F A;  3BJI A;  2J87 A;  2DB6 A;  1XA6 A;  5FUX A;  1RFH A;  1PTQ A;  2FNF X;  1XBT A;  2J9R A;  1FAR A;  2QQ0 A;  3UEJ A;  3KY9 A;  4UXI A;  2ENZ A;  4B6D A;  2GVI A;  2ROW A;  4FKD A;  3E2I A;  3UGD A;  1FAQ A;  1TBO A;  2ENN A;  1XX6 A;  2QQE A;  2YUU A;  5FUW A;  3UFF A;  2QPO A;  2UZ3 A;  3UEY A;  2E73 A;  1KBF A;  3CXL A;  3UGI A;  1TBN A;  5FUY A;  1R79 A;  4UXH A;  5FUV A;  1PTR A;  4L9M A;  2ORV A;  2ELI A;  2B8T A;  2JA1 A;  1KBE A;  3UGL A;  2VRW B;  4UXJ A; 
#chains in the Genus database with same CATH topology
 2WVJ A;  1WGC A;  2ORW A;  2WGC A;  2KCX A;  1TIH A;  1WGT A;  1M8C A;  1XA6 A;  1MJ9 A;  2W0T A;  5FUX A;  1TBR R;  2F3C I;  1BUS A;  1R0R I;  1NXU A;  2FNF X;  2NU0 I;  3FSY A;  1FAR A;  3KY9 A;  1PPF I;  1SGQ I;  1LR7 A;  2GVI A;  1TUR A;  1Y1B A;  2ROW A;  2N1A B;  3E2I A;  2SGD I;  4FKD A;  7WGA A;  1K7V A;  1HDL A;  1SGR I;  2LUY A;  1UVF A;  2ENN A;  2QQE A;  5FUW A;  3R5A A;  3UFF A;  2UZ3 A;  3VDU A;  9WGA A;  2NU1 I;  5EX3 A;  3UGI A;  2UVO A;  1YTP A;  2RC4 A;  1TBN A;  5HI7 A;  5JHW C;  1CSO I;  1S20 A;  1CT0 I;  1TGS I;  5J8F A;  2SGF I;  4UXH A;  1HJA I;  1U5K A;  2PQ8 A;  3TO9 A;  1DS2 I;  1BMO A;  1ULM A;  3OXG A;  1UUC A;  1MT1 A;  1YU6 C;  2DB6 A;  2YQP A;  2B0U C;  1K7T A;  1AN1 I;  1RFH A;  2A20 A;  1PTQ A;  2M5X A;  2ODD A;  4A24 A;  2XRC A;  2DIP A;  2J9R A;  2QQ0 A;  1SGE I;  3UEJ A;  4E1R A;  2NU3 I;  3FC3 A;  1H0Z A;  2N17 A;  4UXI A;  2CWG A;  1X74 A;  1WKX A;  3OXL A;  3D00 A;  1FAQ A;  2WCY A;  2KMQ A;  4OVO A;  1SGN I;  2L8E A;  3QTL D;  1XX6 A;  4AML A;  2YUU A;  2NU4 I;  3PDN A;  1TUS A;  1Z7K B;  2E73 A;  1CT2 I;  1SGP I;  1Y1C A;  3B4V C;  3CXL A;  2CWH A;  2L7X A;  2OU2 A;  1MJA A;  2RIJ A;  1N13 A;  1CGJ I;  1PTR A;  4UXJ A;  2BUS A;  1UHA A;  4HGU A;  3HH2 C;  1PCE A;  1Q9B A;  2CWF A;  2KMR A;  2OZU A;  3R5B A;  5HQ8 A;  3GOX A;  2VRW B;  3FSX A;  4MPI A;  1TOT A;  1W4R A;  2DKV A;  3SGQ I;  2OVO A;  3BJI A;  3TO7 A;  2J87 A;  1HPT A;  1OMU A;  2QQD A;  3TOA A;  5E3P A;  2SGQ I;  1TBQ R;  2V1C A;  3TOB A;  1KMA A;  1P9Z A;  2ENZ A;  2KMP A;  3OL0 A;  5E3R A;  1LR8 A;  4SGB I;  1V1I A;  3UGD A;  2GKV A;  1UVG A;  1MJB A;  5E3Q A;  1CE3 A;  1M8B A;  2X52 A;  2N52 A;  1SGY I;  3UEY A;  5DAE A;  3QWP A;  1KBF A;  1P9G A;  4JCV E;  2P6A C;  3SGB I;  1LR9 A;  1NUB A;  1CT4 I;  4DNC A;  2ORV A;  2LB7 A;  1Z2I A;  2B8T A;  1CHO I;  2Y0M A;  1VDD A;  2OD1 A;  3TJQ A;  1KBE A;  3UGL A;  3OVO A;  2ERW A;  2SGE I;  1OVO A;  2X3T A;  3RU0 A;  3E59 A;  1Y8F A;  3VE5 A;  1OMT A;  2V1C C;  1OYV I;  4E1P A;  1WTJ A;  1IY5 A;  2K9H A;  3OXF A;  1V1H A;  2GKT I;  3QAH A;  1FYB A;  1XBT A;  5J8C A;  2KMO A;  2JZM A;  2SGP I;  2NU2 I;  4B6D A;  1ULK A;  1CGI I;  1PJU A;  3VDP A;  1X4S A;  1DS3 I;  1TBO A;  2JYY A;  2N71 A;  1IY6 A;  1HEV A;  2QPO A;  1K7U A;  1W3S A;  2ARP F;  5CCM A;  1SGD I;  2GKR I;  4WP4 A;  5FUY A;  2E5R A;  2QQC A;  3TO6 A;  5EX0 A;  1FY7 A;  2CJS C;  1R79 A;  2JXD A;  5FUV A;  1IW4 A;  4GI3 C;  4L9M A;  2LEO A;  2GIV A;  2V53 A;  2ELI A;  3R5D A;  5CCL A;  3SEK C;  2JA1 A;  1ULN A;  3UOE A;  3R5C A;  2JW6 A;  3MEK A; 
#chains in the Genus database with same CATH homology
 2WVJ A;  2ORW A;  2KCX A;  1TIH A;  1M8C A;  1XA6 A;  2W0T A;  5FUX A;  1TBR R;  2F3C I;  1BUS A;  1R0R I;  2FNF X;  2NU0 I;  1FAR A;  3KY9 A;  1PPF I;  1SGQ I;  1LR7 A;  2GVI A;  1TUR A;  1Y1B A;  2ROW A;  2N1A B;  3E2I A;  2SGD I;  4FKD A;  1IW4 A;  1HDL A;  1SGR I;  2LUY A;  1UVF A;  2ENN A;  2QQE A;  5FUW A;  3UFF A;  2UZ3 A;  3VDU A;  2NU1 I;  5EX3 A;  3UGI A;  1YTP A;  1TBN A;  5HI7 A;  5JHW C;  1CSO I;  1CT0 I;  1TGS I;  2SGF I;  4UXH A;  1HJA I;  1U5K A;  1DS2 I;  1BMO A;  3OXG A;  1UUC A;  1MT1 A;  1YU6 C;  2DB6 A;  2YQP A;  2B0U C;  1AN1 I;  1RFH A;  2A20 A;  1PTQ A;  2M5X A;  2ODD A;  4A24 A;  2XRC A;  2DIP A;  2J9R A;  2QQ0 A;  1SGE I;  3UEJ A;  4E1R A;  2NU3 I;  3FC3 A;  1H0Z A;  2N17 A;  4UXI A;  1X74 A;  3OXL A;  3D00 A;  1FAQ A;  2WCY A;  2KMQ A;  4OVO A;  1SGN I;  2L8E A;  3QTL D;  1XX6 A;  2YUU A;  2NU4 I;  3PDN A;  1TUS A;  1Z7K B;  2E73 A;  1CT2 I;  1SGP I;  1Y1C A;  3B4V C;  3CXL A;  2L7X A;  1N13 A;  1CGJ I;  1PTR A;  4UXJ A;  2BUS A;  4HGU A;  3HH2 C;  1PCE A;  2KMR A;  5HQ8 A;  3GOX A;  2VRW B;  1TOT A;  1W4R A;  3SGQ I;  2OVO A;  3BJI A;  2J87 A;  1HPT A;  1OMU A;  2QQD A;  2SGQ I;  1TBQ R;  2V1C A;  1KMA A;  2KMP A;  2ENZ A;  3OL0 A;  1LR8 A;  4SGB I;  1V1I A;  3UGD A;  2GKV A;  1UVG A;  1CE3 A;  1M8B A;  2N52 A;  1SGY I;  3UEY A;  5DAE A;  3QWP A;  1KBF A;  4JCV E;  2P6A C;  3SGB I;  1LR9 A;  1NUB A;  1CT4 I;  2ORV A;  2B8T A;  1CHO I;  1VDD A;  2OD1 A;  3TJQ A;  1KBE A;  3UGL A;  3OVO A;  2ERW A;  2SGE I;  1OVO A;  3RU0 A;  3E59 A;  1Y8F A;  3VE5 A;  1OMT A;  2V1C C;  1OYV I;  4E1P A;  1IY5 A;  2K9H A;  3OXF A;  1V1H A;  2GKT I;  1FYB A;  1XBT A;  2KMO A;  2JZM A;  2SGP I;  2NU2 I;  4B6D A;  1CGI I;  1PJU A;  3VDP A;  1X4S A;  1DS3 I;  1TBO A;  2JYY A;  2N71 A;  1IY6 A;  2QPO A;  1W3S A;  2ARP F;  5CCM A;  1SGD I;  2GKR I;  5FUY A;  2E5R A;  2QQC A;  5EX0 A;  2CJS C;  1R79 A;  2JXD A;  5FUV A;  4GI3 C;  4L9M A;  2LEO A;  2V53 A;  2ELI A;  5CCL A;  3SEK C;  2JA1 A;  2JW6 A;  3MEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...