2ROWA

The c1 domain of rock ii
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
84
structure length
84
Chain Sequence
b'ESKKEPEFPVEPVGEKSNYICHKGHEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho-associated protein kinase 2
publication title The C1 domain of ROCK II
rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 10
structure length 84
sequence length 84
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2rowA01
1KBEA 1KBFA 3UGDA 2JA1A 1FARA 4FKDA 3E2IA 3UGIA 5FUVA 5FUYA 2UZ3A 3UEJA 5FUWA 2QQEA 1FAQA 2E73A 4L9MA 2ORVA 2YUUA 3UGLA 2DB6A 1PTRA 4UXJA 1XA6A 2VRWB 2ENZA 4B6DA 2ENNA 1XBTA 2ELIA 2ORWA 3BJIA 3UEYA 1R79A 2QPOA 2ROWA 2J9RA 5FUXA 1TBOA 1RFHA 4UXHA 2FNFX 1Y8FA 2QQ0A 3CXLA 1W4RA 1XX6A 2B8TA 1PTQA 2J87A 2WVJA 3UFFA 3KY9A 2GVIA 4UXIA 1TBNA
chains in the Genus database with same CATH superfamily
1KBEA 3VE5A 3QWPA 3UGDA 1K7UA 1CT0I 2KMPA 2UZ3A 2Y0MA 1CHOI 5FUYA 5FUWA 3TO7A 1LR8A 4E1PA 1CT2I 2CWGA 1NUBA 1UVFA 2E73A 2OU2A 2PQ8A 2RIJA 1OYVI 1X74A 3FSXA 3B4VC 1NXUA 1TIHA 2N17A 1BMOA 2CWHA 2XRCA 2ENNA 2ELIA 1SGPI 1TBRR 2ARPF 2X3TA 1M8CA 2QQDA 2QPOA 2LEOA 2ROWA 9WGAA 1RFHA 2FNFX 1BUSA 1LR9A 3FC3A 3R5DA 2NU1I 1PTQA 1WKXA 2J87A 2WVJA 5E3PA 3QTLD 3UFFA 5EX3A 3R5CA 7WGAA 2OZUA 1R0RI 1XA6A 3MEKA 4OVOA 1P9GA 3R5BA 3TOAA 2JA1A 3UGIA 1CE3A 1PCEA 3GOXA 2JYYA 1FAQA 1CT4I 2KCXA 4L9MA 2ORVA 1UHAA 2N52A 2W0TA 2N71A 2YUUA 3PDNA 1PTRA 1CGII 2V53A 1Q9BA 2X52A 1UVGA 3TOBA 5CCLA 5JHWC 1H0ZA 1HEVA 1MJBA 2JW6A 2ENZA 2L7XA 1SGYI 2KMRA 1IW4A 1HDLA 2QQCA 4MPIA 3UEYA 2SGPI 4DNCA 1R79A 1TBQR 1MT1A 1TUSA 5FUXA 3UOEA 1TBOA 2BUSA 4UXHA 4WP4A 1ULNA 5HI7A 5E3QA 2GKTI 5HQ8A 2QQ0A 5J8FA 4AMLA 3QAHA 1W4RA 1XX6A 2V1CA 2B8TA 2YQPA 3OXFA 3E59A 4E1RA 2JXDA 3UEJA 1V1IA 2GVIA 1OVOA 2P6AC 3SEKC 1WGTA 2SGFI 4HGUA 3E2IA 5FUVA 2CWFA 3FSYA 2OVOA 4SGBI 1TURA 2SGQI 1CGJI 1MJ9A 3UGLA 2DB6A 4UXIA 3SGBI 5E3RA 2A20A 3OVOA 5DAEA 1IY5A 1SGEI 2VRWB 2F3CI 2N1AB 1YU6C 2CJSC 4GI3C 1XBTA 1S20A 3TJQA 2ORWA 1FYBA 1HJAI 1VDDA 1UUCA 3SGQI 3D00A 2GKRI 1X4SA 2OD1A 2V1CC 1SGRI 5EX0A 1TOTA 1P9ZA 2LB7A 1OMUA 2SGEI 1YTPA 1Z2IA 2JZMA 1PJUA 1LR7A 1U5KA 1ULMA 2DKVA 1KBFA 1FARA 2GKVA 4FKDA 1CSOI 3TO6A 3OL0A 3R5AA 2E5RA 2ODDA 1IY6A 2QQEA 4JCVE 1DS3I 1SGDI 2KMOA 4A24A 1K7TA 2LUYA 2WCYA 3TO9A 1N13A 3HH2C 3OXLA 1WGCA 1OMTA 4UXJA 1KMAA 2NU0I 2NU3I 2UVOA 2M5XA 3VDPA 2RC4A 1W3SA 1PPFI 2DIPA 2ERWA 4B6DA 1K7VA 2B0UC 1AN1I 1HPTA 1DS2I 2GIVA 2K9HA 2KMQA 1WTJA 2L8EA 3BJIA 1SGQI 1TGSI 3RU0A 1SGNI 1Y1BA 2J9RA 3VDUA 2NU2I 1Z7KB 3OXGA 2NU4I 5J8CA 1M8BA 1Y8FA 1ULKA 3CXLA 1MJAA 2SGDI 5CCMA 2WGCA 3KY9A 1FY7A 1Y1CA 1TBNA 1V1HA
chains in the Genus database with same CATH topology
1KBEA 3VE5A 3QWPA 3UGDA 2KMPA 1CT0I 5FUYA 2UZ3A 1CHOI 5FUWA 1LR8A 4E1PA 1CT2I 2E73A 1NUBA 1UVFA 1OYVI 1X74A 3B4VC 1TIHA 2N17A 1BMOA 2XRCA 2ENNA 2ELIA 1SGPI 1TBRR 2ARPF 1M8CA 2QQDA 2QPOA 2LEOA 2ROWA 1RFHA 2FNFX 1BUSA 1LR9A 3FC3A 2NU1I 1PTQA 2J87A 2WVJA 3UFFA 3QTLD 5EX3A 1R0RI 1XA6A 3MEKA 4OVOA 3UGIA 2JA1A 1CE3A 1PCEA 3GOXA 2JYYA 1FAQA 1CT4I 2KCXA 4L9MA 2ORVA 2N52A 2YUUA 2W0TA 2N71A 3PDNA 1PTRA 1CGII 2V53A 1H0ZA 5JHWC 1UVGA 5CCLA 2JW6A 2ENZA 2L7XA 1SGYI 2KMRA 1IW4A 1HDLA 2QQCA 3UEYA 2SGPI 1R79A 1TBQR 1MT1A 1TUSA 5FUXA 1TBOA 2BUSA 4UXHA 5HI7A 2GKTI 5HQ8A 2QQ0A 4E1RA 1W4RA 1XX6A 2V1CA 2B8TA 2YQPA 3OXFA 3E59A 2JXDA 3UEJA 1V1IA 2GVIA 1OVOA 2P6AC 3SEKC 2SGFI 4HGUA 3E2IA 5FUVA 2OVOA 4SGBI 1TURA 2SGQI 1CGJI 3UGLA 2DB6A 3SGBI 2A20A 3OVOA 5DAEA 1IY5A 1SGEI 2VRWB 2F3CI 2N1AB 1YU6C 2CJSC 4GI3C 1XBTA 3TJQA 2ORWA 1FYBA 1HJAI 1VDDA 1UUCA 3SGQI 3D00A 2GKRI 1X4SA 2OD1A 2V1CC 1SGRI 5EX0A 1TOTA 2SGEI 1OMUA 1YTPA 2JZMA 1PJUA 1LR7A 1U5KA 1KBFA 1FARA 2GKVA 4FKDA 1CSOI 3OL0A 2E5RA 2ODDA 1IY6A 2QQEA 4JCVE 1DS3I 1SGDI 2KMOA 4A24A 2LUYA 2WCYA 1N13A 3HH2C 3OXLA 4UXJA 1OMTA 1KMAA 2NU0I 2NU3I 2M5XA 3VDPA 1W3SA 1PPFI 2DIPA 2ERWA 4B6DA 2B0UC 1AN1I 1HPTA 1DS2I 2K9HA 2KMQA 2L8EA 3BJIA 1SGQI 1TGSI 3RU0A 1SGNI 1Y1BA 2J9RA 3VDUA 2NU2I 1Z7KB 3OXGA 2NU4I 1M8BA 1Y8FA 3CXLA 2SGDI 5CCMA 3KY9A 4UXIA 1Y1CA 1TBNA 1V1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KBE A;  1KBF A;  3UGD A;  2JA1 A;  1FAR A;  4FKD A;  3E2I A;  3UGI A;  5FUV A;  5FUY A;  2UZ3 A;  3UEJ A;  5FUW A;  2QQE A;  1FAQ A;  2E73 A;  4L9M A;  2ORV A;  2YUU A;  3UGL A;  2DB6 A;  1PTR A;  4UXJ A;  1XA6 A;  2VRW B;  2ENZ A;  4B6D A;  2ENN A;  1XBT A;  2ELI A;  2ORW A;  3BJI A;  3UEY A;  1R79 A;  2QPO A;  2ROW A;  2J9R A;  5FUX A;  1TBO A;  1RFH A;  4UXH A;  2FNF X;  1Y8F A;  2QQ0 A;  3CXL A;  1W4R A;  1XX6 A;  2B8T A;  1PTQ A;  2J87 A;  2WVJ A;  3UFF A;  3KY9 A;  2GVI A;  4UXI A;  1TBN A; 
#chains in the Genus database with same CATH topology
 1KBE A;  3VE5 A;  3QWP A;  3UGD A;  1K7U A;  1CT0 I;  2KMP A;  2UZ3 A;  2Y0M A;  1CHO I;  5FUY A;  5FUW A;  3TO7 A;  1LR8 A;  4E1P A;  1CT2 I;  2CWG A;  1NUB A;  1UVF A;  2E73 A;  2OU2 A;  2PQ8 A;  2RIJ A;  1OYV I;  1X74 A;  3FSX A;  3B4V C;  1NXU A;  1TIH A;  2N17 A;  1BMO A;  2CWH A;  2XRC A;  2ENN A;  2ELI A;  1SGP I;  1TBR R;  2ARP F;  2X3T A;  1M8C A;  2QQD A;  2QPO A;  2LEO A;  2ROW A;  9WGA A;  1RFH A;  2FNF X;  1BUS A;  1LR9 A;  3FC3 A;  3R5D A;  2NU1 I;  1PTQ A;  1WKX A;  2J87 A;  2WVJ A;  5E3P A;  3QTL D;  3UFF A;  5EX3 A;  3R5C A;  7WGA A;  2OZU A;  1R0R I;  1XA6 A;  3MEK A;  4OVO A;  1P9G A;  3R5B A;  3TOA A;  2JA1 A;  3UGI A;  1CE3 A;  1PCE A;  3GOX A;  2JYY A;  1FAQ A;  1CT4 I;  2KCX A;  4L9M A;  2ORV A;  1UHA A;  2N52 A;  2W0T A;  2N71 A;  2YUU A;  3PDN A;  1PTR A;  1CGI I;  2V53 A;  1Q9B A;  2X52 A;  1UVG A;  3TOB A;  5CCL A;  5JHW C;  1H0Z A;  1HEV A;  1MJB A;  2JW6 A;  2ENZ A;  2L7X A;  1SGY I;  2KMR A;  1IW4 A;  1HDL A;  2QQC A;  4MPI A;  3UEY A;  2SGP I;  4DNC A;  1R79 A;  1TBQ R;  1MT1 A;  1TUS A;  5FUX A;  3UOE A;  1TBO A;  2BUS A;  4UXH A;  4WP4 A;  1ULN A;  5HI7 A;  5E3Q A;  2GKT I;  5HQ8 A;  2QQ0 A;  5J8F A;  4AML A;  3QAH A;  1W4R A;  1XX6 A;  2V1C A;  2B8T A;  2YQP A;  3OXF A;  3E59 A;  4E1R A;  2JXD A;  3UEJ A;  1V1I A;  2GVI A;  1OVO A;  2P6A C;  3SEK C;  1WGT A;  2SGF I;  4HGU A;  3E2I A;  5FUV A;  2CWF A;  3FSY A;  2OVO A;  4SGB I;  1TUR A;  2SGQ I;  1CGJ I;  1MJ9 A;  3UGL A;  2DB6 A;  4UXI A;  3SGB I;  5E3R A;  2A20 A;  3OVO A;  5DAE A;  1IY5 A;  1SGE I;  2VRW B;  2F3C I;  2N1A B;  1YU6 C;  2CJS C;  4GI3 C;  1XBT A;  1S20 A;  3TJQ A;  2ORW A;  1FYB A;  1HJA I;  1VDD A;  1UUC A;  3SGQ I;  3D00 A;  2GKR I;  1X4S A;  2OD1 A;  2V1C C;  1SGR I;  5EX0 A;  1TOT A;  1P9Z A;  2LB7 A;  1OMU A;  2SGE I;  1YTP A;  1Z2I A;  2JZM A;  1PJU A;  1LR7 A;  1U5K A;  1ULM A;  2DKV A;  1KBF A;  1FAR A;  2GKV A;  4FKD A;  1CSO I;  3TO6 A;  3OL0 A;  3R5A A;  2E5R A;  2ODD A;  1IY6 A;  2QQE A;  4JCV E;  1DS3 I;  1SGD I;  2KMO A;  4A24 A;  1K7T A;  2LUY A;  2WCY A;  3TO9 A;  1N13 A;  3HH2 C;  3OXL A;  1WGC A;  1OMT A;  4UXJ A;  1KMA A;  2NU0 I;  2NU3 I;  2UVO A;  2M5X A;  3VDP A;  2RC4 A;  1W3S A;  1PPF I;  2DIP A;  2ERW A;  4B6D A;  1K7V A;  2B0U C;  1AN1 I;  1HPT A;  1DS2 I;  2GIV A;  2K9H A;  2KMQ A;  1WTJ A;  2L8E A;  3BJI A;  1SGQ I;  1TGS I;  3RU0 A;  1SGN I;  1Y1B A;  2J9R A;  3VDU A;  2NU2 I;  1Z7K B;  3OXG A;  2NU4 I;  5J8C A;  1M8B A;  1Y8F A;  1ULK A;  3CXL A;  1MJA A;  2SGD I;  5CCM A;  2WGC A;  3KY9 A;  1FY7 A;  1Y1C A;  1TBN A;  1V1H A; 
#chains in the Genus database with same CATH homology
 1KBE A;  3VE5 A;  3QWP A;  3UGD A;  2KMP A;  1CT0 I;  5FUY A;  2UZ3 A;  1CHO I;  5FUW A;  1LR8 A;  4E1P A;  1CT2 I;  2E73 A;  1NUB A;  1UVF A;  1OYV I;  1X74 A;  3B4V C;  1TIH A;  2N17 A;  1BMO A;  2XRC A;  2ENN A;  2ELI A;  1SGP I;  1TBR R;  2ARP F;  1M8C A;  2QQD A;  2QPO A;  2LEO A;  2ROW A;  1RFH A;  2FNF X;  1BUS A;  1LR9 A;  3FC3 A;  2NU1 I;  1PTQ A;  2J87 A;  2WVJ A;  3UFF A;  3QTL D;  5EX3 A;  1R0R I;  1XA6 A;  3MEK A;  4OVO A;  3UGI A;  2JA1 A;  1CE3 A;  1PCE A;  3GOX A;  2JYY A;  1FAQ A;  1CT4 I;  2KCX A;  4L9M A;  2ORV A;  2N52 A;  2YUU A;  2W0T A;  2N71 A;  3PDN A;  1PTR A;  1CGI I;  2V53 A;  1H0Z A;  5JHW C;  1UVG A;  5CCL A;  2JW6 A;  2ENZ A;  2L7X A;  1SGY I;  2KMR A;  1IW4 A;  1HDL A;  2QQC A;  3UEY A;  2SGP I;  1R79 A;  1TBQ R;  1MT1 A;  1TUS A;  5FUX A;  1TBO A;  2BUS A;  4UXH A;  5HI7 A;  2GKT I;  5HQ8 A;  2QQ0 A;  4E1R A;  1W4R A;  1XX6 A;  2V1C A;  2B8T A;  2YQP A;  3OXF A;  3E59 A;  2JXD A;  3UEJ A;  1V1I A;  2GVI A;  1OVO A;  2P6A C;  3SEK C;  2SGF I;  4HGU A;  3E2I A;  5FUV A;  2OVO A;  4SGB I;  1TUR A;  2SGQ I;  1CGJ I;  3UGL A;  2DB6 A;  3SGB I;  2A20 A;  3OVO A;  5DAE A;  1IY5 A;  1SGE I;  2VRW B;  2F3C I;  2N1A B;  1YU6 C;  2CJS C;  4GI3 C;  1XBT A;  3TJQ A;  2ORW A;  1FYB A;  1HJA I;  1VDD A;  1UUC A;  3SGQ I;  3D00 A;  2GKR I;  1X4S A;  2OD1 A;  2V1C C;  1SGR I;  5EX0 A;  1TOT A;  2SGE I;  1OMU A;  1YTP A;  2JZM A;  1PJU A;  1LR7 A;  1U5K A;  1KBF A;  1FAR A;  2GKV A;  4FKD A;  1CSO I;  3OL0 A;  2E5R A;  2ODD A;  1IY6 A;  2QQE A;  4JCV E;  1DS3 I;  1SGD I;  2KMO A;  4A24 A;  2LUY A;  2WCY A;  1N13 A;  3HH2 C;  3OXL A;  4UXJ A;  1OMT A;  1KMA A;  2NU0 I;  2NU3 I;  2M5X A;  3VDP A;  1W3S A;  1PPF I;  2DIP A;  2ERW A;  4B6D A;  2B0U C;  1AN1 I;  1HPT A;  1DS2 I;  2K9H A;  2KMQ A;  2L8E A;  3BJI A;  1SGQ I;  1TGS I;  3RU0 A;  1SGN I;  1Y1B A;  2J9R A;  3VDU A;  2NU2 I;  1Z7K B;  3OXG A;  2NU4 I;  1M8B A;  1Y8F A;  3CXL A;  2SGD I;  5CCM A;  3KY9 A;  4UXI A;  1Y1C A;  1TBN A;  1V1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...