2ROWA

The c1 domain of rock ii
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
84
structure length
84
Chain Sequence
ESKKEPEFPVEPVGEKSNYICHKGHEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The C1 domain of ROCK II
rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Rho-associated protein kinase 2
total genus 10
structure length 84
sequence length 84
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2rowA01
2DB6A 3KY9A 2B8TA 1KBEA 2ENNA 2QQEA 3UGDA 1PTRA 2J87A 1W4RA 4UXJA 1RFHA 2VRWB 3UGIA 4B6DA 2ELIA 2QPOA 1Y8FA 2GVIA 5FUYA 1FARA 2YUUA 3CXLA 5FUWA 3UEJA 2ENZA 2E73A 3UFFA 1TBOA 1TBNA 2J9RA 1FAQA 1XX6A 3BJIA 4FKDA 1XA6A 1PTQA 5FUVA 2ORVA 2UZ3A 2FNFX 5FUXA 4L9MA 2WVJA 1KBFA 2QQ0A 2ORWA 1R79A 3UGLA 2ROWA 1XBTA 3UEYA 2JA1A 3E2IA 4UXHA 4UXIA
chains in the Genus database with same CATH superfamily
3R5AA 2JW6A 3OXLA 1SGEI 1OVOA 2CWHA 1NXUA 2ENNA 2Y0MA 1CT0I 5DAEA 1HPTA 2VRWB 1UVFA 1Y1CA 3TOAA 1PPFI 1WGTA 3R5CA 5E3PA 2GKTI 3TO9A 2DIPA 2V1CA 2V1CC 3UEJA 3VDPA 2KMRA 1TBOA 1CGJI 1MT1A 1TBNA 1V1IA 2N71A 1ULNA 1XX6A 2SGDI 4FKDA 3VDUA 2ODDA 1BUSA 1P9GA 2UVOA 2UZ3A 1SGRI 2NU2I 4SGBI 2N52A 2RC4A 1PCEA 1K7UA 2XRCA 1MJ9A 4OVOA 5FUXA 1UUCA 1OYVI 2CWGA 1K7TA 2L8EA 2CJSC 3UOEA 3OVOA 3UGLA 5CCLA 1VDDA 5EX0A 2GKVA 1XBTA 4JCVE 4UXHA 2KMOA 2GKRI 2P6AC 2X52A 3RU0A 1ULKA 3KY9A 1R0RI 1TUSA 1PTRA 3OL0A 1MJAA 1W3SA 1TIHA 2NU1I 4B6DA 1HEVA 1X74A 5CCMA 1CGII 1HJAI 2E73A 2JXDA 1DS2I 2A20A 2SGQI 2J9RA 5E3RA 2OVOA 3FSXA 3QTLD 2V53A 2NU0I 1Q9BA 2FNFX 1IY5A 5J8CA 2L7XA 1TURA 2WVJA 1LR8A 2QQ0A 2ERWA 2M5XA 2ORWA 5J8FA 1SGQI 9WGAA 1K7VA 2KMPA 1M8CA 1KMAA 1AN1I 2LUYA 2QQDA 2ROWA 1SGYI 3PDNA 4WP4A 3SGBI 3TO6A 3TOBA 3UEYA 3GOXA 2DB6A 2RIJA 1SGDI 2B8TA 1KBEA 2QQEA 3UGDA 1NUBA 2B0UC 2ARPF 1W4RA 2J87A 2K9HA 1N13A 4E1PA 1MJBA 2LB7A 2YQPA 2NU4I 1WGCA 1CT4I 2ELIA 2QPOA 1CSOI 1M8BA 1ULMA 1Y8FA 2GVIA 1WKXA 3QWPA 5FUYA 1H0ZA 2YUUA 3CXLA 4HGUA 1PJUA 2ENZA 3FSYA 3TO7A 2SGPI 3UFFA 4E1RA 2E5RA 3R5DA 3BJIA 3QAHA 1P9ZA 2OD1A 1CHOI 1PTQA 5FUVA 2GIVA 3MEKA 7WGAA 1FY7A 3TJQA 1SGPI 3E59A 4L9MA 1KBFA 3SEKC 1TOTA 1CE3A 1BMOA 5E3QA 4MPIA 5JHWC 1FYBA 3SGQI 2JA1A 2SGFI 1Z2IA 1LR7A 3E2IA 3R5BA 1V1HA 2KMQA 1OMUA 5EX3A 2CWFA 4A24A 1U5KA 2JYYA 2SGEI 4UXJA 1OMTA 2OZUA 3HH2C 5HQ8A 3FC3A 1RFHA 1Y1BA 3UGIA 1YTPA 1TBRR 5HI7A 2OU2A 4GI3C 1UVGA 1UHAA 2X3TA 3VE5A 4DNCA 1FARA 1X4SA 2KCXA 5FUWA 1IY6A 1TGSI 2N1AB 2WCYA 1FAQA 1IW4A 3D00A 1TBQR 1LR9A 1SGNI 1XA6A 2WGCA 2W0TA 1HDLA 2ORVA 2PQ8A 4AMLA 3OXFA 2QQCA 1YU6C 2N17A 1WTJA 1Z7KB 2JZMA 2BUSA 3B4VC 3OXGA 1S20A 1R79A 2LEOA 2F3CI 1CT2I 2NU3I 2DKVA 1DS3I 4UXIA
chains in the Genus database with same CATH topology
2JW6A 3OXLA 1SGEI 1OVOA 2ENNA 1CT0I 5DAEA 1HPTA 2VRWB 1UVFA 1Y1CA 1PPFI 2GKTI 2DIPA 2V1CA 2V1CC 3UEJA 3VDPA 2KMRA 1TBOA 1CGJI 1MT1A 1TBNA 1V1IA 2N71A 2SGDI 1XX6A 3VDUA 4FKDA 1BUSA 2ODDA 2UZ3A 1SGRI 2NU2I 4SGBI 2N52A 4OVOA 1PCEA 2XRCA 5FUXA 1UUCA 1OYVI 2L8EA 2CJSC 3OVOA 3UGLA 5CCLA 1VDDA 5EX0A 2GKVA 1XBTA 4JCVE 4UXHA 2KMOA 2GKRI 2P6AC 3RU0A 3KY9A 1R0RI 1TUSA 1PTRA 3OL0A 1W3SA 1TIHA 2NU1I 4B6DA 1X74A 5CCMA 1CGII 1HJAI 2E73A 2JXDA 1DS2I 2A20A 2SGQI 2J9RA 2OVOA 3QTLD 2V53A 2NU0I 2FNFX 1IY5A 2L7XA 1TURA 2WVJA 1LR8A 2QQ0A 2ERWA 2M5XA 2ORWA 1SGQI 1KMAA 2KMPA 1M8CA 1AN1I 2LUYA 2QQDA 2ROWA 1SGYI 3PDNA 3SGBI 3UEYA 2DB6A 1SGDI 2B8TA 1KBEA 2QQEA 3UGDA 1NUBA 2B0UC 2ARPF 1W4RA 2J87A 2K9HA 1N13A 4E1PA 2YQPA 2NU4I 1CT4I 2ELIA 2QPOA 1CSOI 1M8BA 1Y8FA 2GVIA 5FUYA 1H0ZA 3QWPA 2YUUA 3CXLA 4HGUA 1PJUA 2ENZA 3UFFA 2SGPI 4E1RA 2E5RA 3BJIA 2OD1A 1CHOI 1PTQA 5FUVA 3MEKA 3TJQA 1SGPI 3E59A 4L9MA 1KBFA 3SEKC 1TOTA 1CE3A 1BMOA 5JHWC 1FYBA 3SGQI 2JA1A 2SGFI 3E2IA 1LR7A 1V1HA 2KMQA 1OMUA 5EX3A 4A24A 1U5KA 2JYYA 2SGEI 4UXJA 1OMTA 3HH2C 5HQ8A 3FC3A 1RFHA 1Y1BA 3UGIA 1YTPA 1TBRR 5HI7A 4GI3C 1UVGA 3VE5A 1FARA 1X4SA 2KCXA 5FUWA 1IY6A 1TGSI 2N1AB 2WCYA 1FAQA 1IW4A 3D00A 1TBQR 1LR9A 1SGNI 1XA6A 1HDLA 2W0TA 2ORVA 3OXFA 2QQCA 1YU6C 2N17A 3B4VC 1Z7KB 2JZMA 2BUSA 3OXGA 1R79A 2LEOA 2F3CI 1CT2I 2NU3I 3GOXA 1DS3I 4UXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DB6 A;  3KY9 A;  2B8T A;  1KBE A;  2ENN A;  2QQE A;  3UGD A;  1PTR A;  2J87 A;  1W4R A;  4UXJ A;  1RFH A;  2VRW B;  3UGI A;  4B6D A;  2ELI A;  2QPO A;  1Y8F A;  2GVI A;  5FUY A;  1FAR A;  2YUU A;  3CXL A;  5FUW A;  3UEJ A;  2ENZ A;  2E73 A;  3UFF A;  1TBO A;  1TBN A;  2J9R A;  1FAQ A;  1XX6 A;  3BJI A;  4FKD A;  1XA6 A;  1PTQ A;  5FUV A;  2ORV A;  2UZ3 A;  2FNF X;  5FUX A;  4L9M A;  2WVJ A;  1KBF A;  2QQ0 A;  2ORW A;  1R79 A;  3UGL A;  2ROW A;  1XBT A;  3UEY A;  2JA1 A;  3E2I A;  4UXH A;  4UXI A; 
#chains in the Genus database with same CATH topology
 3R5A A;  2JW6 A;  3OXL A;  1SGE I;  1OVO A;  2CWH A;  1NXU A;  2ENN A;  2Y0M A;  1CT0 I;  5DAE A;  1HPT A;  2VRW B;  1UVF A;  1Y1C A;  3TOA A;  1PPF I;  1WGT A;  3R5C A;  5E3P A;  2GKT I;  3TO9 A;  2DIP A;  2V1C A;  2V1C C;  3UEJ A;  3VDP A;  2KMR A;  1TBO A;  1CGJ I;  1MT1 A;  1TBN A;  1V1I A;  2N71 A;  1ULN A;  1XX6 A;  2SGD I;  4FKD A;  3VDU A;  2ODD A;  1BUS A;  1P9G A;  2UVO A;  2UZ3 A;  1SGR I;  2NU2 I;  4SGB I;  2N52 A;  2RC4 A;  1PCE A;  1K7U A;  2XRC A;  1MJ9 A;  4OVO A;  5FUX A;  1UUC A;  1OYV I;  2CWG A;  1K7T A;  2L8E A;  2CJS C;  3UOE A;  3OVO A;  3UGL A;  5CCL A;  1VDD A;  5EX0 A;  2GKV A;  1XBT A;  4JCV E;  4UXH A;  2KMO A;  2GKR I;  2P6A C;  2X52 A;  3RU0 A;  1ULK A;  3KY9 A;  1R0R I;  1TUS A;  1PTR A;  3OL0 A;  1MJA A;  1W3S A;  1TIH A;  2NU1 I;  4B6D A;  1HEV A;  1X74 A;  5CCM A;  1CGI I;  1HJA I;  2E73 A;  2JXD A;  1DS2 I;  2A20 A;  2SGQ I;  2J9R A;  5E3R A;  2OVO A;  3FSX A;  3QTL D;  2V53 A;  2NU0 I;  1Q9B A;  2FNF X;  1IY5 A;  5J8C A;  2L7X A;  1TUR A;  2WVJ A;  1LR8 A;  2QQ0 A;  2ERW A;  2M5X A;  2ORW A;  5J8F A;  1SGQ I;  9WGA A;  1K7V A;  2KMP A;  1M8C A;  1KMA A;  1AN1 I;  2LUY A;  2QQD A;  2ROW A;  1SGY I;  3PDN A;  4WP4 A;  3SGB I;  3TO6 A;  3TOB A;  3UEY A;  3GOX A;  2DB6 A;  2RIJ A;  1SGD I;  2B8T A;  1KBE A;  2QQE A;  3UGD A;  1NUB A;  2B0U C;  2ARP F;  1W4R A;  2J87 A;  2K9H A;  1N13 A;  4E1P A;  1MJB A;  2LB7 A;  2YQP A;  2NU4 I;  1WGC A;  1CT4 I;  2ELI A;  2QPO A;  1CSO I;  1M8B A;  1ULM A;  1Y8F A;  2GVI A;  1WKX A;  3QWP A;  5FUY A;  1H0Z A;  2YUU A;  3CXL A;  4HGU A;  1PJU A;  2ENZ A;  3FSY A;  3TO7 A;  2SGP I;  3UFF A;  4E1R A;  2E5R A;  3R5D A;  3BJI A;  3QAH A;  1P9Z A;  2OD1 A;  1CHO I;  1PTQ A;  5FUV A;  2GIV A;  3MEK A;  7WGA A;  1FY7 A;  3TJQ A;  1SGP I;  3E59 A;  4L9M A;  1KBF A;  3SEK C;  1TOT A;  1CE3 A;  1BMO A;  5E3Q A;  4MPI A;  5JHW C;  1FYB A;  3SGQ I;  2JA1 A;  2SGF I;  1Z2I A;  1LR7 A;  3E2I A;  3R5B A;  1V1H A;  2KMQ A;  1OMU A;  5EX3 A;  2CWF A;  4A24 A;  1U5K A;  2JYY A;  2SGE I;  4UXJ A;  1OMT A;  2OZU A;  3HH2 C;  5HQ8 A;  3FC3 A;  1RFH A;  1Y1B A;  3UGI A;  1YTP A;  1TBR R;  5HI7 A;  2OU2 A;  4GI3 C;  1UVG A;  1UHA A;  2X3T A;  3VE5 A;  4DNC A;  1FAR A;  1X4S A;  2KCX A;  5FUW A;  1IY6 A;  1TGS I;  2N1A B;  2WCY A;  1FAQ A;  1IW4 A;  3D00 A;  1TBQ R;  1LR9 A;  1SGN I;  1XA6 A;  2WGC A;  2W0T A;  1HDL A;  2ORV A;  2PQ8 A;  4AML A;  3OXF A;  2QQC A;  1YU6 C;  2N17 A;  1WTJ A;  1Z7K B;  2JZM A;  2BUS A;  3B4V C;  3OXG A;  1S20 A;  1R79 A;  2LEO A;  2F3C I;  1CT2 I;  2NU3 I;  2DKV A;  1DS3 I;  4UXI A; 
#chains in the Genus database with same CATH homology
 2JW6 A;  3OXL A;  1SGE I;  1OVO A;  2ENN A;  1CT0 I;  5DAE A;  1HPT A;  2VRW B;  1UVF A;  1Y1C A;  1PPF I;  2GKT I;  2DIP A;  2V1C A;  2V1C C;  3UEJ A;  3VDP A;  2KMR A;  1TBO A;  1CGJ I;  1MT1 A;  1TBN A;  1V1I A;  2N71 A;  2SGD I;  1XX6 A;  3VDU A;  4FKD A;  1BUS A;  2ODD A;  2UZ3 A;  1SGR I;  2NU2 I;  4SGB I;  2N52 A;  4OVO A;  1PCE A;  2XRC A;  5FUX A;  1UUC A;  1OYV I;  2L8E A;  2CJS C;  3OVO A;  3UGL A;  5CCL A;  1VDD A;  5EX0 A;  2GKV A;  1XBT A;  4JCV E;  4UXH A;  2KMO A;  2GKR I;  2P6A C;  3RU0 A;  3KY9 A;  1R0R I;  1TUS A;  1PTR A;  3OL0 A;  1W3S A;  1TIH A;  2NU1 I;  4B6D A;  1X74 A;  5CCM A;  1CGI I;  1HJA I;  2E73 A;  2JXD A;  1DS2 I;  2A20 A;  2SGQ I;  2J9R A;  2OVO A;  3QTL D;  2V53 A;  2NU0 I;  2FNF X;  1IY5 A;  2L7X A;  1TUR A;  2WVJ A;  1LR8 A;  2QQ0 A;  2ERW A;  2M5X A;  2ORW A;  1SGQ I;  1KMA A;  2KMP A;  1M8C A;  1AN1 I;  2LUY A;  2QQD A;  2ROW A;  1SGY I;  3PDN A;  3SGB I;  3UEY A;  2DB6 A;  1SGD I;  2B8T A;  1KBE A;  2QQE A;  3UGD A;  1NUB A;  2B0U C;  2ARP F;  1W4R A;  2J87 A;  2K9H A;  1N13 A;  4E1P A;  2YQP A;  2NU4 I;  1CT4 I;  2ELI A;  2QPO A;  1CSO I;  1M8B A;  1Y8F A;  2GVI A;  5FUY A;  1H0Z A;  3QWP A;  2YUU A;  3CXL A;  4HGU A;  1PJU A;  2ENZ A;  3UFF A;  2SGP I;  4E1R A;  2E5R A;  3BJI A;  2OD1 A;  1CHO I;  1PTQ A;  5FUV A;  3MEK A;  3TJQ A;  1SGP I;  3E59 A;  4L9M A;  1KBF A;  3SEK C;  1TOT A;  1CE3 A;  1BMO A;  5JHW C;  1FYB A;  3SGQ I;  2JA1 A;  2SGF I;  3E2I A;  1LR7 A;  1V1H A;  2KMQ A;  1OMU A;  5EX3 A;  4A24 A;  1U5K A;  2JYY A;  2SGE I;  4UXJ A;  1OMT A;  3HH2 C;  5HQ8 A;  3FC3 A;  1RFH A;  1Y1B A;  3UGI A;  1YTP A;  1TBR R;  5HI7 A;  4GI3 C;  1UVG A;  3VE5 A;  1FAR A;  1X4S A;  2KCX A;  5FUW A;  1IY6 A;  1TGS I;  2N1A B;  2WCY A;  1FAQ A;  1IW4 A;  3D00 A;  1TBQ R;  1LR9 A;  1SGN I;  1XA6 A;  1HDL A;  2W0T A;  2ORV A;  3OXF A;  2QQC A;  1YU6 C;  2N17 A;  3B4V C;  1Z7K B;  2JZM A;  2BUS A;  3OXG A;  1R79 A;  2LEO A;  2F3C I;  1CT2 I;  2NU3 I;  3GOX A;  1DS3 I;  4UXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...