2NU4I

Accommodation of positively-charged residues in a hydrophobic specificity pocket: crystal structures of sgpb in complex with omtky3 variants lys18i and arg18i
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTKEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B, Proteinase B
publication title Accommodation of positively-charged residues in a hydrophobic specificity pocket: Crystal structures of SGPB in complex with OMTKY3 variants Lys18I and Arg18I
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase
total genus 14
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2nu4I00
1IY6A 1SGQI 1UUCA 1TBQR 5JHWC 4SGBI 1SGNI 1M8CA 2B0UC 1BUSA 1CSOI 2ARPF 2ERWA 1TIHA 2SGDI 2SGPI 1CT0I 1DS3I 2JZMA 2NU0I 1UVFA 1CGJI 1M8BA 1PJUA 1UVGA 1SGPI 1H0ZA 3OVOA 2F3CI 1YU6C 2OVOA 1CHOI 2SGEI 1OMUA 2KCXA 1R0RI 1Z7KB 3TJQA 2P6AC 1FYBA 1MT1A 1PPFI 1BMOA 1HPTA 1TBRR 1OVOA 2V53A 1TUSA 1Y1CA 2JYYA 2KMRA 2BUSA 2N17A 1NUBA 1IW4A 1OYVI 3HH2C 2KMOA 1CGII 2GKVA 2NU2I 1YTPA 3QTLD 5DAEA 1CE3A 1IY5A 1KMAA 3B4VC 1DS2I 3SEKC 2QQCA 2NU3I 1Y1BA 2KMPA 2N52A 2JXDA 2M5XA 1SGDI 1LR7A 3SGQI 1SGYI 2QQDA 2SGQI 2N71A 2XRCA 1AN1I 1TGSI 4OVOA 3SGBI 2WCYA 2GKTI 2KMQA 2NU4I 2LEOA 2NU1I 1CT2I 1CT4I 1HJAI 1HDLA 4HGUA 1SGEI 1SGRI 1OMTA 1PCEA 2SGFI 1TURA 4GI3C 1N13A 1LR8A 2GKRI 1LR9A
chains in the Genus database with same CATH superfamily
2FNFX 1IY6A 2YQPA 1SGQI 3UGLA 1PTQA 5EX0A 4UXJA 4B6DA 2E73A 1UUCA 1V1HA 1W4RA 1TBQR 3R5AA 3GOXA 1ULMA 2N1AB 5JHWC 4SGBI 1SGNI 1M8CA 2B0UC 3VDUA 3R5CA 1BUSA 1CSOI 2ARPF 2ERWA 1R79A 3OL0A 3VDPA 1TIHA 2SGDI 4E1RA 4E1PA 2W0TA 3UEJA 2SGPI 3FC3A 2Y0MA 4MPIA 1U5KA 1CT0I 1K7UA 1DS3I 1KBEA 2JZMA 2NU0I 1UVFA 3R5BA 1CGJI 3UOEA 1M8BA 3TO7A 1PJUA 2J87A 2DB6A 1Q9BA 3UGDA 3QAHA 1UVGA 3VE5A 1SGPI 1TOTA 2CWHA 3MEKA 3KY9A 1H0ZA 2L8EA 1ULNA 1FARA 2ENNA 2F3CI 1YU6C 1P9GA 1WGTA 1CHOI 2ORVA 2OVOA 1RFHA 2SGEI 5FUXA 3RU0A 3CXLA 1OMUA 2KCXA 1NXUA 1R0RI 1Z7KB 3TJQA 2JW6A 1WKXA 2P6AC 2WGCA 3OXLA 1MT1A 2DIPA 1FYBA 1PPFI 1BMOA 1HPTA 2ELIA 2V1CC 1MJ9A 2GVIA 2L7XA 1TBRR 1OVOA 2B8TA 2OU2A 2V53A 2X3TA 5J8CA 1TUSA 1Y1CA 2JYYA 4WP4A 2KMRA 2BUSA 2CJSC 2N17A 5E3RA 2JA1A 3UFFA 1NUBA 2RIJA 5J8FA 3E59A 4UXHA 1IW4A 1OYVI 2LB7A 1X4SA 2KMOA 2QQEA 3HH2C 1CGII 2GKVA 2ODDA 5HI7A 5CCMA 4UXIA 2LUYA 1WGCA 2K9HA 1FY7A 2NU2I 2QPOA 3E2IA 2ENZA 1YTPA 1Z2IA 2VRWB 1Y8FA 3OXFA 3QTLD 4L9MA 1WTJA 5DAEA 3OXGA 5FUVA 1CE3A 1K7VA 5EX3A 4JCVE 1HEVA 1IY5A 2CWGA 1KMAA 3B4VC 2E5RA 1DS2I 3SEKC 2QQCA 1UHAA 2NU3I 1Y1BA 3OVOA 2A20A 5HQ8A 1MJAA 5E3QA 2PQ8A 2KMPA 1XA6A 2UVOA 3R5DA 1ULKA 1XX6A 2N52A 7WGAA 2J9RA 5FUYA 2JXDA 1TBOA 1S20A 1SGDI 2M5XA 1P9ZA 1LR7A 3TOBA 1X74A 2OD1A 1PTRA 2OZUA 3SGQI 3D00A 3TO6A 1SGYI 5E3PA 2QQDA 5FUWA 2ORWA 2ROWA 1TBNA 2SGQI 1XBTA 2UZ3A 2N71A 5CCLA 2XRCA 3FSXA 1V1IA 1AN1I 1TGSI 2QQ0A 3QWPA 4OVOA 3SGBI 3TO9A 3UGIA 2WCYA 4AMLA 2GKTI 2KMQA 2NU4I 3FSYA 4A24A 1FAQA 3BJIA 2LEOA 2NU1I 1CT2I 2YUUA 1CT4I 1HJAI 1HDLA 9WGAA 3PDNA 4HGUA 1SGEI 3TOAA 1SGRI 1OMTA 2V1CA 2WVJA 1PCEA 1VDDA 2DKVA 2SGFI 2RC4A 2GIVA 2CWFA 4FKDA 1TURA 3UEYA 4GI3C 1N13A 4DNCA 2X52A 1MJBA 1LR8A 2GKRI 1KBFA 1LR9A 1K7TA 1W3SA
chains in the Genus database with same CATH topology
2FNFX 1IY6A 2YQPA 1SGQI 3UGLA 1PTQA 5EX0A 4UXJA 2E73A 1UUCA 1V1HA 1W4RA 1TBQR 3GOXA 2N1AB 5JHWC 4SGBI 1SGNI 1M8CA 2B0UC 3VDUA 1BUSA 1CSOI 2ARPF 2ERWA 1R79A 3OL0A 3VDPA 1TIHA 2SGDI 4E1RA 4E1PA 2W0TA 3UEJA 2SGPI 3FC3A 1U5KA 1CT0I 1DS3I 1KBEA 2JZMA 2NU0I 1UVFA 1CGJI 1M8BA 1PJUA 2J87A 2DB6A 3UGDA 1UVGA 3VE5A 1SGPI 1TOTA 3MEKA 3KY9A 1H0ZA 2L8EA 3OVOA 1FARA 2ENNA 2F3CI 1YU6C 2ORVA 2OVOA 1CHOI 3RU0A 5FUXA 1RFHA 2SGEI 3CXLA 1OMUA 2KCXA 1R0RI 1Z7KB 3TJQA 2JW6A 2P6AC 3OXLA 1MT1A 2DIPA 1FYBA 1PPFI 1BMOA 1HPTA 2ELIA 2V1CC 2GVIA 2L7XA 1TBRR 1OVOA 2B8TA 2V53A 1TUSA 1Y1CA 2JYYA 2KMRA 2BUSA 2CJSC 2N17A 2JA1A 3UFFA 1NUBA 3E59A 4UXHA 1IW4A 1OYVI 1X4SA 2KMOA 2QQEA 3HH2C 1CGII 2GKVA 2ODDA 5HI7A 5CCMA 4UXIA 2LUYA 2K9HA 2NU2I 2QPOA 3E2IA 2ENZA 1YTPA 2VRWB 3OXFA 1Y8FA 3QTLD 4L9MA 5DAEA 5FUVA 1CE3A 3OXGA 5EX3A 4JCVE 1IY5A 1KMAA 3B4VC 2E5RA 1DS2I 3SEKC 2QQCA 2NU3I 1Y1BA 2A20A 5HQ8A 2KMPA 1XA6A 1XX6A 2N52A 2J9RA 5FUYA 2JXDA 1TBOA 2M5XA 1SGDI 1LR7A 1X74A 2OD1A 1PTRA 3SGQI 3D00A 1SGYI 2QQDA 5FUWA 2ORWA 2ROWA 1TBNA 2SGQI 1XBTA 2UZ3A 2N71A 5CCLA 2XRCA 1V1IA 1AN1I 1TGSI 2QQ0A 3QWPA 4OVOA 3SGBI 3UGIA 2WCYA 2GKTI 2KMQA 2NU4I 4A24A 1FAQA 3BJIA 2LEOA 2NU1I 1CT2I 2YUUA 1CT4I 1HJAI 1HDLA 3PDNA 4HGUA 1SGEI 1SGRI 1OMTA 2V1CA 2WVJA 1PCEA 1VDDA 2SGFI 4FKDA 4B6DA 1TURA 3UEYA 4GI3C 1N13A 1LR8A 2GKRI 1KBFA 1LR9A 1W3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IY6 A;  1SGQ I;  1UUC A;  1TBQ R;  5JHW C;  4SGB I;  1SGN I;  1M8C A;  2B0U C;  1BUS A;  1CSO I;  2ARP F;  2ERW A;  1TIH A;  2SGD I;  2SGP I;  1CT0 I;  1DS3 I;  2JZM A;  2NU0 I;  1UVF A;  1CGJ I;  1M8B A;  1PJU A;  1UVG A;  1SGP I;  1H0Z A;  3OVO A;  2F3C I;  1YU6 C;  2OVO A;  1CHO I;  2SGE I;  1OMU A;  2KCX A;  1R0R I;  1Z7K B;  3TJQ A;  2P6A C;  1FYB A;  1MT1 A;  1PPF I;  1BMO A;  1HPT A;  1TBR R;  1OVO A;  2V53 A;  1TUS A;  1Y1C A;  2JYY A;  2KMR A;  2BUS A;  2N17 A;  1NUB A;  1IW4 A;  1OYV I;  3HH2 C;  2KMO A;  1CGI I;  2GKV A;  2NU2 I;  1YTP A;  3QTL D;  5DAE A;  1CE3 A;  1IY5 A;  1KMA A;  3B4V C;  1DS2 I;  3SEK C;  2QQC A;  2NU3 I;  1Y1B A;  2KMP A;  2N52 A;  2JXD A;  2M5X A;  1SGD I;  1LR7 A;  3SGQ I;  1SGY I;  2QQD A;  2SGQ I;  2N71 A;  2XRC A;  1AN1 I;  1TGS I;  4OVO A;  3SGB I;  2WCY A;  2GKT I;  2KMQ A;  2NU4 I;  2LEO A;  2NU1 I;  1CT2 I;  1CT4 I;  1HJA I;  1HDL A;  4HGU A;  1SGE I;  1SGR I;  1OMT A;  1PCE A;  2SGF I;  1TUR A;  4GI3 C;  1N13 A;  1LR8 A;  2GKR I;  1LR9 A; 
#chains in the Genus database with same CATH topology
 2FNF X;  1IY6 A;  2YQP A;  1SGQ I;  3UGL A;  1PTQ A;  5EX0 A;  4UXJ A;  4B6D A;  2E73 A;  1UUC A;  1V1H A;  1W4R A;  1TBQ R;  3R5A A;  3GOX A;  1ULM A;  2N1A B;  5JHW C;  4SGB I;  1SGN I;  1M8C A;  2B0U C;  3VDU A;  3R5C A;  1BUS A;  1CSO I;  2ARP F;  2ERW A;  1R79 A;  3OL0 A;  3VDP A;  1TIH A;  2SGD I;  4E1R A;  4E1P A;  2W0T A;  3UEJ A;  2SGP I;  3FC3 A;  2Y0M A;  4MPI A;  1U5K A;  1CT0 I;  1K7U A;  1DS3 I;  1KBE A;  2JZM A;  2NU0 I;  1UVF A;  3R5B A;  1CGJ I;  3UOE A;  1M8B A;  3TO7 A;  1PJU A;  2J87 A;  2DB6 A;  1Q9B A;  3UGD A;  3QAH A;  1UVG A;  3VE5 A;  1SGP I;  1TOT A;  2CWH A;  3MEK A;  3KY9 A;  1H0Z A;  2L8E A;  1ULN A;  1FAR A;  2ENN A;  2F3C I;  1YU6 C;  1P9G A;  1WGT A;  1CHO I;  2ORV A;  2OVO A;  1RFH A;  2SGE I;  5FUX A;  3RU0 A;  3CXL A;  1OMU A;  2KCX A;  1NXU A;  1R0R I;  1Z7K B;  3TJQ A;  2JW6 A;  1WKX A;  2P6A C;  2WGC A;  3OXL A;  1MT1 A;  2DIP A;  1FYB A;  1PPF I;  1BMO A;  1HPT A;  2ELI A;  2V1C C;  1MJ9 A;  2GVI A;  2L7X A;  1TBR R;  1OVO A;  2B8T A;  2OU2 A;  2V53 A;  2X3T A;  5J8C A;  1TUS A;  1Y1C A;  2JYY A;  4WP4 A;  2KMR A;  2BUS A;  2CJS C;  2N17 A;  5E3R A;  2JA1 A;  3UFF A;  1NUB A;  2RIJ A;  5J8F A;  3E59 A;  4UXH A;  1IW4 A;  1OYV I;  2LB7 A;  1X4S A;  2KMO A;  2QQE A;  3HH2 C;  1CGI I;  2GKV A;  2ODD A;  5HI7 A;  5CCM A;  4UXI A;  2LUY A;  1WGC A;  2K9H A;  1FY7 A;  2NU2 I;  2QPO A;  3E2I A;  2ENZ A;  1YTP A;  1Z2I A;  2VRW B;  1Y8F A;  3OXF A;  3QTL D;  4L9M A;  1WTJ A;  5DAE A;  3OXG A;  5FUV A;  1CE3 A;  1K7V A;  5EX3 A;  4JCV E;  1HEV A;  1IY5 A;  2CWG A;  1KMA A;  3B4V C;  2E5R A;  1DS2 I;  3SEK C;  2QQC A;  1UHA A;  2NU3 I;  1Y1B A;  3OVO A;  2A20 A;  5HQ8 A;  1MJA A;  5E3Q A;  2PQ8 A;  2KMP A;  1XA6 A;  2UVO A;  3R5D A;  1ULK A;  1XX6 A;  2N52 A;  7WGA A;  2J9R A;  5FUY A;  2JXD A;  1TBO A;  1S20 A;  1SGD I;  2M5X A;  1P9Z A;  1LR7 A;  3TOB A;  1X74 A;  2OD1 A;  1PTR A;  2OZU A;  3SGQ I;  3D00 A;  3TO6 A;  1SGY I;  5E3P A;  2QQD A;  5FUW A;  2ORW A;  2ROW A;  1TBN A;  2SGQ I;  1XBT A;  2UZ3 A;  2N71 A;  5CCL A;  2XRC A;  3FSX A;  1V1I A;  1AN1 I;  1TGS I;  2QQ0 A;  3QWP A;  4OVO A;  3SGB I;  3TO9 A;  3UGI A;  2WCY A;  4AML A;  2GKT I;  2KMQ A;  2NU4 I;  3FSY A;  4A24 A;  1FAQ A;  3BJI A;  2LEO A;  2NU1 I;  1CT2 I;  2YUU A;  1CT4 I;  1HJA I;  1HDL A;  9WGA A;  3PDN A;  4HGU A;  1SGE I;  3TOA A;  1SGR I;  1OMT A;  2V1C A;  2WVJ A;  1PCE A;  1VDD A;  2DKV A;  2SGF I;  2RC4 A;  2GIV A;  2CWF A;  4FKD A;  1TUR A;  3UEY A;  4GI3 C;  1N13 A;  4DNC A;  2X52 A;  1MJB A;  1LR8 A;  2GKR I;  1KBF A;  1LR9 A;  1K7T A;  1W3S A; 
#chains in the Genus database with same CATH homology
 2FNF X;  1IY6 A;  2YQP A;  1SGQ I;  3UGL A;  1PTQ A;  5EX0 A;  4UXJ A;  2E73 A;  1UUC A;  1V1H A;  1W4R A;  1TBQ R;  3GOX A;  2N1A B;  5JHW C;  4SGB I;  1SGN I;  1M8C A;  2B0U C;  3VDU A;  1BUS A;  1CSO I;  2ARP F;  2ERW A;  1R79 A;  3OL0 A;  3VDP A;  1TIH A;  2SGD I;  4E1R A;  4E1P A;  2W0T A;  3UEJ A;  2SGP I;  3FC3 A;  1U5K A;  1CT0 I;  1DS3 I;  1KBE A;  2JZM A;  2NU0 I;  1UVF A;  1CGJ I;  1M8B A;  1PJU A;  2J87 A;  2DB6 A;  3UGD A;  1UVG A;  3VE5 A;  1SGP I;  1TOT A;  3MEK A;  3KY9 A;  1H0Z A;  2L8E A;  3OVO A;  1FAR A;  2ENN A;  2F3C I;  1YU6 C;  2ORV A;  2OVO A;  1CHO I;  3RU0 A;  5FUX A;  1RFH A;  2SGE I;  3CXL A;  1OMU A;  2KCX A;  1R0R I;  1Z7K B;  3TJQ A;  2JW6 A;  2P6A C;  3OXL A;  1MT1 A;  2DIP A;  1FYB A;  1PPF I;  1BMO A;  1HPT A;  2ELI A;  2V1C C;  2GVI A;  2L7X A;  1TBR R;  1OVO A;  2B8T A;  2V53 A;  1TUS A;  1Y1C A;  2JYY A;  2KMR A;  2BUS A;  2CJS C;  2N17 A;  2JA1 A;  3UFF A;  1NUB A;  3E59 A;  4UXH A;  1IW4 A;  1OYV I;  1X4S A;  2KMO A;  2QQE A;  3HH2 C;  1CGI I;  2GKV A;  2ODD A;  5HI7 A;  5CCM A;  4UXI A;  2LUY A;  2K9H A;  2NU2 I;  2QPO A;  3E2I A;  2ENZ A;  1YTP A;  2VRW B;  3OXF A;  1Y8F A;  3QTL D;  4L9M A;  5DAE A;  5FUV A;  1CE3 A;  3OXG A;  5EX3 A;  4JCV E;  1IY5 A;  1KMA A;  3B4V C;  2E5R A;  1DS2 I;  3SEK C;  2QQC A;  2NU3 I;  1Y1B A;  2A20 A;  5HQ8 A;  2KMP A;  1XA6 A;  1XX6 A;  2N52 A;  2J9R A;  5FUY A;  2JXD A;  1TBO A;  2M5X A;  1SGD I;  1LR7 A;  1X74 A;  2OD1 A;  1PTR A;  3SGQ I;  3D00 A;  1SGY I;  2QQD A;  5FUW A;  2ORW A;  2ROW A;  1TBN A;  2SGQ I;  1XBT A;  2UZ3 A;  2N71 A;  5CCL A;  2XRC A;  1V1I A;  1AN1 I;  1TGS I;  2QQ0 A;  3QWP A;  4OVO A;  3SGB I;  3UGI A;  2WCY A;  2GKT I;  2KMQ A;  2NU4 I;  4A24 A;  1FAQ A;  3BJI A;  2LEO A;  2NU1 I;  1CT2 I;  2YUU A;  1CT4 I;  1HJA I;  1HDL A;  3PDN A;  4HGU A;  1SGE I;  1SGR I;  1OMT A;  2V1C A;  2WVJ A;  1PCE A;  1VDD A;  2SGF I;  4FKD A;  4B6D A;  1TUR A;  3UEY A;  4GI3 C;  1N13 A;  1LR8 A;  2GKR I;  1KBF A;  1LR9 A;  1W3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...