2NU4I

Accommodation of positively-charged residues in a hydrophobic specificity pocket: crystal structures of sgpb in complex with omtky3 variants lys18i and arg18i
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTKEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Streptogrisin B, Proteinase B
publication title Accommodation of positively-charged residues in a hydrophobic specificity pocket: Crystal structures of SGPB in complex with OMTKY3 variants Lys18I and Arg18I
rcsb
source organism Meleagris gallopavo
total genus 14
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2nu4I00
1BUSA 1UVFA 2KCXA 4OVOA 2F3CI 1CT2I 1NUBA 1OVOA 5DAEA 1TGSI 2P6AC 1SGEI 2N71A 3SGBI 2GKTI 2JZMA 2BUSA 1UVGA 2SGQI 5JHWC 1YU6C 2NU4I 1M8BA 1OMTA 2KMQA 1AN1I 1LR9A 4GI3C 2XRCA 3TJQA 2SGPI 3QTLD 1PPFI 1CHOI 1H0ZA 2WCYA 1HPTA 1HDLA 2JYYA 1TBRR 1Z7KB 1KMAA 3SGQI 1CT0I 2M5XA 2LEOA 2NU2I 1R0RI 1PJUA 2NU0I 2V53A 2KMOA 2NU1I 1DS2I 1SGDI 2KMRA 2N17A 2QQCA 1LR8A 1Y1BA 1PCEA 1CSOI 1OMUA 1IY6A 1SGQI 2GKRI 2SGDI 2N52A 1SGRI 1IY5A 1SGYI 1DS3I 2B0UC 1BMOA 2ERWA 1CE3A 1M8CA 1TURA 4HGUA 1TIHA 2SGFI 3SEKC 2KMPA 3OVOA 1HJAI 1TUSA 1OYVI 1YTPA 2ARPF 3HH2C 1CGII 1IW4A 2GKVA 2QQDA 2SGEI 1MT1A 1SGPI 3B4VC 1LR7A 1Y1CA 2OVOA 4SGBI 1N13A 2NU3I 1CGJI 1UUCA 1TBQR 1SGNI 2JXDA 1CT4I 1FYBA
chains in the Genus database with same CATH superfamily
3VDUA 5J8CA 1BUSA 1UVFA 4E1RA 2KCXA 4OVOA 1PTRA 2F3CI 1CT2I 2B8TA 3PDNA 3RU0A 1NUBA 2RC4A 4FKDA 1TOTA 2X52A 1OVOA 4B6DA 1ULMA 5DAEA 2UVOA 1TGSI 2V1CC 4AMLA 1ULKA 2P6AC 1SGEI 1Z2IA 1Q9BA 1WTJA 2N71A 1U5KA 2RIJA 3SGBI 2GKTI 2JZMA 2BUSA 3R5DA 1WGTA 3UGIA 3VE5A 2L7XA 1UVGA 3QAHA 2SGQI 5FUXA 1KBFA 5JHWC 1YU6C 3MEKA 2DB6A 2W0TA 4A24A 2NU4I 1M8BA 1OMTA 2KMQA 1AN1I 1LR9A 3D00A 4GI3C 3TO9A 5E3RA 2XRCA 4DNCA 1K7UA 2E5RA 3TJQA 5CCLA 2SGPI 1V1IA 3QTLD 2OU2A 4L9MA 2DIPA 3R5AA 1PPFI 1NXUA 2K9HA 1CHOI 2VRWB 3E59A 1H0ZA 2WCYA 1FARA 1FY7A 1HPTA 1HDLA 2JYYA 4MPIA 1TBRR 1Z7KB 1S20A 2Y0MA 3SGQI 1KMAA 1CT0I 2M5XA 2LEOA 2DKVA 1PTQA 3TOBA 1KBEA 2NU2I 1R0RI 1PJUA 4JCVE 2NU0I 1RFHA 2V53A 2KMOA 2NU1I 1DS2I 1XBTA 1UHAA 1XX6A 2ENZA 2WGCA 5EX0A 1SGDI 2KMRA 2GIVA 2N17A 3OL0A 2QQCA 5E3PA 1HEVA 2CJSC 5FUVA 1LR8A 4UXHA 1MJ9A 3UGDA 4UXJA 5HI7A 1Y1BA 2QPOA 2ROWA 2CWGA 1K7VA 9WGAA 5J8FA 3FC3A 4UXIA 2V1CA 1PCEA 3OXLA 1CSOI 1OMUA 1TBNA 3BJIA 1IY6A 1SGQI 2GKRI 2SGDI 3FSXA 2J87A 2N52A 2QQ0A 1SGRI 2A20A 2ORWA 3GOXA 1IY5A 1WGCA 3OXFA 1SGYI 2UZ3A 3UOEA 1DS3I 2B0UC 2OD1A 3QWPA 5FUWA 3UFFA 2WVJA 3UGLA 1BMOA 2ERWA 5CCMA 1CE3A 1M8CA 2QQEA 1TURA 4HGUA 1P9ZA 2E73A 2ODDA 1V1HA 1TIHA 2SGFI 3SEKC 1FAQA 2L8EA 1Y8FA 3R5CA 1MJBA 1P9GA 2ELIA 2KMPA 3E2IA 3FSYA 3OVOA 2JW6A 3CXLA 1TBOA 5EX3A 3R5BA 1HJAI 2GVIA 4WP4A 1K7TA 1X74A 1TUSA 1W3SA 3UEYA 2X3TA 1OYVI 1YTPA 2ARPF 3OXGA 3TO6A 2LUYA 3HH2C 1CGII 3VDPA 1IW4A 1WKXA 2GKVA 5FUYA 2N1AB 2QQDA 2ORVA 1MT1A 2SGEI 1MJAA 2PQ8A 2YUUA 5HQ8A 3TO7A 1W4RA 2CWFA 1SGPI 3B4VC 3UEJA 1LR7A 1ULNA 1Y1CA 2OVOA 4SGBI 1N13A 2JA1A 1VDDA 1CGJI 1UUCA 2LB7A 2NU3I 3KY9A 1R79A 1TBQR 3TOAA 1SGNI 2CWHA 1XA6A 7WGAA 2J9RA 2YQPA 2JXDA 1X4SA 2ENNA 2OZUA 4E1PA 2FNFX 5E3QA 1CT4I 1FYBA
chains in the Genus database with same CATH topology
3VDUA 1BUSA 1UVFA 4E1RA 2KCXA 4OVOA 1PTRA 2F3CI 1CT2I 2B8TA 3PDNA 3RU0A 1NUBA 4FKDA 1TOTA 1OVOA 4B6DA 5DAEA 1TGSI 2V1CC 2P6AC 1SGEI 2N71A 1U5KA 3SGBI 3UGIA 2GKTI 2JZMA 2BUSA 3VE5A 2L7XA 1UVGA 5FUXA 2SGQI 1KBFA 5JHWC 1YU6C 3MEKA 2DB6A 2W0TA 4A24A 2NU4I 1M8BA 1OMTA 2KMQA 1AN1I 1LR9A 3D00A 4GI3C 2XRCA 2E5RA 3TJQA 5CCLA 2SGPI 1V1IA 3QTLD 4L9MA 2DIPA 1PPFI 3E59A 2K9HA 1CHOI 2VRWB 1H0ZA 2WCYA 1FARA 1HPTA 1HDLA 2JYYA 1TBRR 1Z7KB 1KMAA 3SGQI 1CT0I 2M5XA 2LEOA 1PTQA 1KBEA 2NU2I 1R0RI 1PJUA 4JCVE 2NU0I 1RFHA 2V53A 2KMOA 2NU1I 1DS2I 1XBTA 1XX6A 5EX0A 2ENZA 1SGDI 2KMRA 2N17A 3OL0A 2QQCA 2CJSC 5FUVA 1LR8A 4UXHA 3UGDA 4UXJA 5HI7A 1Y1BA 2QPOA 2ROWA 3FC3A 4UXIA 2V1CA 1PCEA 3OXLA 1CSOI 1OMUA 1TBNA 3BJIA 1IY6A 1SGQI 2GKRI 2SGDI 2J87A 2N52A 2QQ0A 1SGRI 2A20A 2ORWA 3GOXA 1IY5A 3OXFA 1SGYI 2UZ3A 1DS3I 2B0UC 2OD1A 3QWPA 5FUWA 3UFFA 2WVJA 3UGLA 1BMOA 2ERWA 5CCMA 1CE3A 1M8CA 2QQEA 1TURA 4HGUA 2E73A 2ODDA 1V1HA 1TIHA 2SGFI 3SEKC 1FAQA 2L8EA 1Y8FA 2KMPA 2ELIA 3E2IA 3OVOA 2JW6A 3CXLA 1TBOA 5EX3A 1HJAI 2GVIA 1X74A 1TUSA 1W3SA 3UEYA 1OYVI 1YTPA 2ARPF 3OXGA 2LUYA 3HH2C 1CGII 3VDPA 1IW4A 2GKVA 5FUYA 2N1AB 2QQDA 2ORVA 1MT1A 2SGEI 2YUUA 5HQ8A 3UEJA 1W4RA 1SGPI 3B4VC 1LR7A 1Y1CA 2OVOA 4SGBI 1N13A 2JA1A 1VDDA 1CGJI 1UUCA 2NU3I 3KY9A 1R79A 1TBQR 1SGNI 1XA6A 2J9RA 2YQPA 2JXDA 1X4SA 2ENNA 4E1PA 2FNFX 1CT4I 1FYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BUS A;  1UVF A;  2KCX A;  4OVO A;  2F3C I;  1CT2 I;  1NUB A;  1OVO A;  5DAE A;  1TGS I;  2P6A C;  1SGE I;  2N71 A;  3SGB I;  2GKT I;  2JZM A;  2BUS A;  1UVG A;  2SGQ I;  5JHW C;  1YU6 C;  2NU4 I;  1M8B A;  1OMT A;  2KMQ A;  1AN1 I;  1LR9 A;  4GI3 C;  2XRC A;  3TJQ A;  2SGP I;  3QTL D;  1PPF I;  1CHO I;  1H0Z A;  2WCY A;  1HPT A;  1HDL A;  2JYY A;  1TBR R;  1Z7K B;  1KMA A;  3SGQ I;  1CT0 I;  2M5X A;  2LEO A;  2NU2 I;  1R0R I;  1PJU A;  2NU0 I;  2V53 A;  2KMO A;  2NU1 I;  1DS2 I;  1SGD I;  2KMR A;  2N17 A;  2QQC A;  1LR8 A;  1Y1B A;  1PCE A;  1CSO I;  1OMU A;  1IY6 A;  1SGQ I;  2GKR I;  2SGD I;  2N52 A;  1SGR I;  1IY5 A;  1SGY I;  1DS3 I;  2B0U C;  1BMO A;  2ERW A;  1CE3 A;  1M8C A;  1TUR A;  4HGU A;  1TIH A;  2SGF I;  3SEK C;  2KMP A;  3OVO A;  1HJA I;  1TUS A;  1OYV I;  1YTP A;  2ARP F;  3HH2 C;  1CGI I;  1IW4 A;  2GKV A;  2QQD A;  2SGE I;  1MT1 A;  1SGP I;  3B4V C;  1LR7 A;  1Y1C A;  2OVO A;  4SGB I;  1N13 A;  2NU3 I;  1CGJ I;  1UUC A;  1TBQ R;  1SGN I;  2JXD A;  1CT4 I;  1FYB A; 
#chains in the Genus database with same CATH topology
 3VDU A;  5J8C A;  1BUS A;  1UVF A;  4E1R A;  2KCX A;  4OVO A;  1PTR A;  2F3C I;  1CT2 I;  2B8T A;  3PDN A;  3RU0 A;  1NUB A;  2RC4 A;  4FKD A;  1TOT A;  2X52 A;  1OVO A;  4B6D A;  1ULM A;  5DAE A;  2UVO A;  1TGS I;  2V1C C;  4AML A;  1ULK A;  2P6A C;  1SGE I;  1Z2I A;  1Q9B A;  1WTJ A;  2N71 A;  1U5K A;  2RIJ A;  3SGB I;  2GKT I;  2JZM A;  2BUS A;  3R5D A;  1WGT A;  3UGI A;  3VE5 A;  2L7X A;  1UVG A;  3QAH A;  2SGQ I;  5FUX A;  1KBF A;  5JHW C;  1YU6 C;  3MEK A;  2DB6 A;  2W0T A;  4A24 A;  2NU4 I;  1M8B A;  1OMT A;  2KMQ A;  1AN1 I;  1LR9 A;  3D00 A;  4GI3 C;  3TO9 A;  5E3R A;  2XRC A;  4DNC A;  1K7U A;  2E5R A;  3TJQ A;  5CCL A;  2SGP I;  1V1I A;  3QTL D;  2OU2 A;  4L9M A;  2DIP A;  3R5A A;  1PPF I;  1NXU A;  2K9H A;  1CHO I;  2VRW B;  3E59 A;  1H0Z A;  2WCY A;  1FAR A;  1FY7 A;  1HPT A;  1HDL A;  2JYY A;  4MPI A;  1TBR R;  1Z7K B;  1S20 A;  2Y0M A;  3SGQ I;  1KMA A;  1CT0 I;  2M5X A;  2LEO A;  2DKV A;  1PTQ A;  3TOB A;  1KBE A;  2NU2 I;  1R0R I;  1PJU A;  4JCV E;  2NU0 I;  1RFH A;  2V53 A;  2KMO A;  2NU1 I;  1DS2 I;  1XBT A;  1UHA A;  1XX6 A;  2ENZ A;  2WGC A;  5EX0 A;  1SGD I;  2KMR A;  2GIV A;  2N17 A;  3OL0 A;  2QQC A;  5E3P A;  1HEV A;  2CJS C;  5FUV A;  1LR8 A;  4UXH A;  1MJ9 A;  3UGD A;  4UXJ A;  5HI7 A;  1Y1B A;  2QPO A;  2ROW A;  2CWG A;  1K7V A;  9WGA A;  5J8F A;  3FC3 A;  4UXI A;  2V1C A;  1PCE A;  3OXL A;  1CSO I;  1OMU A;  1TBN A;  3BJI A;  1IY6 A;  1SGQ I;  2GKR I;  2SGD I;  3FSX A;  2J87 A;  2N52 A;  2QQ0 A;  1SGR I;  2A20 A;  2ORW A;  3GOX A;  1IY5 A;  1WGC A;  3OXF A;  1SGY I;  2UZ3 A;  3UOE A;  1DS3 I;  2B0U C;  2OD1 A;  3QWP A;  5FUW A;  3UFF A;  2WVJ A;  3UGL A;  1BMO A;  2ERW A;  5CCM A;  1CE3 A;  1M8C A;  2QQE A;  1TUR A;  4HGU A;  1P9Z A;  2E73 A;  2ODD A;  1V1H A;  1TIH A;  2SGF I;  3SEK C;  1FAQ A;  2L8E A;  1Y8F A;  3R5C A;  1MJB A;  1P9G A;  2ELI A;  2KMP A;  3E2I A;  3FSY A;  3OVO A;  2JW6 A;  3CXL A;  1TBO A;  5EX3 A;  3R5B A;  1HJA I;  2GVI A;  4WP4 A;  1K7T A;  1X74 A;  1TUS A;  1W3S A;  3UEY A;  2X3T A;  1OYV I;  1YTP A;  2ARP F;  3OXG A;  3TO6 A;  2LUY A;  3HH2 C;  1CGI I;  3VDP A;  1IW4 A;  1WKX A;  2GKV A;  5FUY A;  2N1A B;  2QQD A;  2ORV A;  1MT1 A;  2SGE I;  1MJA A;  2PQ8 A;  2YUU A;  5HQ8 A;  3TO7 A;  1W4R A;  2CWF A;  1SGP I;  3B4V C;  3UEJ A;  1LR7 A;  1ULN A;  1Y1C A;  2OVO A;  4SGB I;  1N13 A;  2JA1 A;  1VDD A;  1CGJ I;  1UUC A;  2LB7 A;  2NU3 I;  3KY9 A;  1R79 A;  1TBQ R;  3TOA A;  1SGN I;  2CWH A;  1XA6 A;  7WGA A;  2J9R A;  2YQP A;  2JXD A;  1X4S A;  2ENN A;  2OZU A;  4E1P A;  2FNF X;  5E3Q A;  1CT4 I;  1FYB A; 
#chains in the Genus database with same CATH homology
 3VDU A;  1BUS A;  1UVF A;  4E1R A;  2KCX A;  4OVO A;  1PTR A;  2F3C I;  1CT2 I;  2B8T A;  3PDN A;  3RU0 A;  1NUB A;  4FKD A;  1TOT A;  1OVO A;  4B6D A;  5DAE A;  1TGS I;  2V1C C;  2P6A C;  1SGE I;  2N71 A;  1U5K A;  3SGB I;  3UGI A;  2GKT I;  2JZM A;  2BUS A;  3VE5 A;  2L7X A;  1UVG A;  5FUX A;  2SGQ I;  1KBF A;  5JHW C;  1YU6 C;  3MEK A;  2DB6 A;  2W0T A;  4A24 A;  2NU4 I;  1M8B A;  1OMT A;  2KMQ A;  1AN1 I;  1LR9 A;  3D00 A;  4GI3 C;  2XRC A;  2E5R A;  3TJQ A;  5CCL A;  2SGP I;  1V1I A;  3QTL D;  4L9M A;  2DIP A;  1PPF I;  3E59 A;  2K9H A;  1CHO I;  2VRW B;  1H0Z A;  2WCY A;  1FAR A;  1HPT A;  1HDL A;  2JYY A;  1TBR R;  1Z7K B;  1KMA A;  3SGQ I;  1CT0 I;  2M5X A;  2LEO A;  1PTQ A;  1KBE A;  2NU2 I;  1R0R I;  1PJU A;  4JCV E;  2NU0 I;  1RFH A;  2V53 A;  2KMO A;  2NU1 I;  1DS2 I;  1XBT A;  1XX6 A;  5EX0 A;  2ENZ A;  1SGD I;  2KMR A;  2N17 A;  3OL0 A;  2QQC A;  2CJS C;  5FUV A;  1LR8 A;  4UXH A;  3UGD A;  4UXJ A;  5HI7 A;  1Y1B A;  2QPO A;  2ROW A;  3FC3 A;  4UXI A;  2V1C A;  1PCE A;  3OXL A;  1CSO I;  1OMU A;  1TBN A;  3BJI A;  1IY6 A;  1SGQ I;  2GKR I;  2SGD I;  2J87 A;  2N52 A;  2QQ0 A;  1SGR I;  2A20 A;  2ORW A;  3GOX A;  1IY5 A;  3OXF A;  1SGY I;  2UZ3 A;  1DS3 I;  2B0U C;  2OD1 A;  3QWP A;  5FUW A;  3UFF A;  2WVJ A;  3UGL A;  1BMO A;  2ERW A;  5CCM A;  1CE3 A;  1M8C A;  2QQE A;  1TUR A;  4HGU A;  2E73 A;  2ODD A;  1V1H A;  1TIH A;  2SGF I;  3SEK C;  1FAQ A;  2L8E A;  1Y8F A;  2KMP A;  2ELI A;  3E2I A;  3OVO A;  2JW6 A;  3CXL A;  1TBO A;  5EX3 A;  1HJA I;  2GVI A;  1X74 A;  1TUS A;  1W3S A;  3UEY A;  1OYV I;  1YTP A;  2ARP F;  3OXG A;  2LUY A;  3HH2 C;  1CGI I;  3VDP A;  1IW4 A;  2GKV A;  5FUY A;  2N1A B;  2QQD A;  2ORV A;  1MT1 A;  2SGE I;  2YUU A;  5HQ8 A;  3UEJ A;  1W4R A;  1SGP I;  3B4V C;  1LR7 A;  1Y1C A;  2OVO A;  4SGB I;  1N13 A;  2JA1 A;  1VDD A;  1CGJ I;  1UUC A;  2NU3 I;  3KY9 A;  1R79 A;  1TBQ R;  1SGN I;  1XA6 A;  2J9R A;  2YQP A;  2JXD A;  1X4S A;  2ENN A;  4E1P A;  2FNF X;  1CT4 I;  1FYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...