1CE3A

Putative ancestral protein encoded by a single sequence repeat of the multidomain proteinase inhibitor from nicotiana alata
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
54
structure length
54
Chain Sequence
MKACTLNCDPRIAYGVCPRSEEKKNDRICTNCCAGTKGCKYFSDDGTFVCEGES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a putative ancestral protein encoded by a single sequence repeat from a multidomain proteinase inhibitor gene from Nicotiana alata.
pubmed doi rcsb
molecule keywords PROTEIN (API)
molecule tags Protease inhibitor
source organism Nicotiana alata
total genus 6
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1999-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02428 Prot_inhib_II Potato type II proteinase inhibitor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1ce3A00
1UVFA 4SGBI 2M5XA 1HDLA 1IY5A 2SGDI 2ERWA 1OVOA 1SGNI 1OMUA 1BUSA 1SGPI 1UVGA 1H0ZA 2OVOA 1SGRI 4GI3C 1HJAI 1CT2I 1UUCA 1CGJI 1TURA 1SGYI 2N71A 1CSOI 1SGQI 1HPTA 1TGSI 1LR9A 1SGDI 2KMPA 1MT1A 3OVOA 1Y1BA 1YTPA 2KCXA 2KMOA 3SEKC 1CT4I 2F3CI 2NU1I 5DAEA 2P6AC 3QTLD 2N17A 2B0UC 2JXDA 1LR8A 3TJQA 1BMOA 2KMRA 1IW4A 1CE3A 2JZMA 1SGEI 5JHWC 1TUSA 2NU2I 1Y1CA 1AN1I 2V53A 2SGPI 1OYVI 1PJUA 1PPFI 1KMAA 1IY6A 2GKRI 2JYYA 2QQCA 2KMQA 2N52A 2SGQI 1DS3I 2SGEI 1CT0I 2NU0I 1CHOI 1N13A 2NU4I 2GKVA 1LR7A 3SGBI 2ARPF 1FYBA 1Z7KB 3HH2C 1M8BA 1PCEA 4HGUA 1TIHA 2WCYA 1CGII 3SGQI 2XRCA 1R0RI 2SGFI 1YU6C 2LEOA 3B4VC 1TBRR 2QQDA 1TBQR 1NUBA 1M8CA 4OVOA 1DS2I 2NU3I 1OMTA 2BUSA 2GKTI
chains in the Genus database with same CATH superfamily
4UXHA 1UVFA 2J87A 2L8EA 3BJIA 4SGBI 4UXIA 2B8TA 1P9GA 4UXJA 3TO6A 4JCVE 2M5XA 2ENZA 2ORVA 2WGCA 1U5KA 3OL0A 5FUXA 3TO9A 1IY5A 2GVIA 1HDLA 2SGDI 4L9MA 2OZUA 3E2IA 2DKVA 2ERWA 1TBOA 1FARA 1OVOA 3RU0A 3UGIA 2ENNA 2OU2A 1WTJA 2QQEA 1SGNI 1OMUA 3PDNA 1BUSA 1SGPI 1UVGA 2L7XA 3OXFA 1H0ZA 1RFHA 3E59A 3VDPA 2OVOA 9WGAA 1SGRI 2QQ0A 2CJSC 2RIJA 1HJAI 4GI3C 3TOAA 2E73A 1CT2I 3UOEA 1UUCA 1CGJI 1WKXA 1TURA 2W0TA 2UVOA 1SGYI 3FC3A 1VDDA 2DB6A 3TOBA 1P9ZA 2N71A 1CSOI 1SGQI 3UEJA 2GIVA 2FNFX 3UFFA 1HPTA 3VE5A 1TGSI 1TBNA 2CWFA 3OXGA 3R5CA 1ULKA 1UHAA 1LR9A 1SGDI 2KMPA 1MT1A 3OVOA 5FUWA 4B6DA 2UZ3A 1Y1BA 1YTPA 2KCXA 2KMOA 3SEKC 1CT4I 2F3CI 2NU1I 5DAEA 1MJ9A 2P6AC 2V1CA 2RC4A 2VRWB 1K7UA 3QTLD 1TOTA 2JW6A 2N17A 3QWPA 2ROWA 1R79A 1WGTA 1K7TA 3R5AA 3GOXA 7WGAA 2B0UC 4E1PA 2JXDA 1LR8A 5J8FA 2E5RA 5J8CA 2LUYA 3R5DA 3TJQA 2JA1A 3UGDA 3TO7A 1BMOA 1X4SA 1S20A 2CWHA 2KMRA 5CCLA 1IW4A 1CE3A 2JZMA 1SGEI 5JHWC 4A24A 1KBEA 3UEYA 1TUSA 4MPIA 2NU2I 3R5BA 1XBTA 5HQ8A 1KBFA 1Y1CA 1AN1I 2V53A 2QPOA 2SGPI 1OYVI 3D00A 2PQ8A 1XX6A 1PJUA 1PPFI 3FSXA 4E1RA 2J9RA 1KMAA 2X52A 1IY6A 2GKRI 2CWGA 2V1CC 3CXLA 2JYYA 2QQCA 2N1AB 2ORWA 2WVJA 2KMQA 2ODDA 5E3RA 3VDUA 2N52A 4DNCA 2SGQI 1DS3I 2SGEI 2DIPA 5E3QA 2LB7A 1CT0I 2NU0I 1NXUA 1CHOI 1N13A 3QAHA 5FUVA 2NU4I 2GKVA 1LR7A 1FY7A 3SGBI 2ARPF 1PTRA 1Z7KB 4FKDA 4WP4A 5E3PA 3HH2C 1Y8FA 4AMLA 1FYBA 1M8BA 1PCEA 1MJBA 1V1HA 2YUUA 2YQPA 1MJAA 1PTQA 1TIHA 4HGUA 1K7VA 5EX0A 2WCYA 1Z2IA 3FSYA 3UGLA 5FUYA 1FAQA 1CGII 1Q9BA 3SGQI 2XRCA 1R0RI 2SGFI 1YU6C 2LEOA 3B4VC 2Y0MA 1TBRR 1W3SA 2QQDA 2ELIA 1TBQR 3OXLA 2OD1A 1WGCA 1NUBA 1XA6A 1ULNA 1M8CA 1W4RA 2A20A 5EX3A 4OVOA 3KY9A 1ULMA 2BUSA 1DS2I 2NU3I 1X74A 1HEVA 2X3TA 5HI7A 1OMTA 2K9HA 3MEKA 1V1IA 2GKTI 5CCMA
chains in the Genus database with same CATH topology
4UXHA 1UVFA 2J87A 2L8EA 3BJIA 4SGBI 4UXIA 2B8TA 4UXJA 4JCVE 2M5XA 2ENZA 5CCMA 2ORVA 3OL0A 1U5KA 5FUXA 1IY5A 1HDLA 2GVIA 2SGDI 4L9MA 3E2IA 2ERWA 1TBOA 1FARA 1OVOA 3RU0A 3UGIA 2ENNA 3PDNA 2QQEA 1SGNI 1OMUA 1BUSA 1SGPI 1UVGA 2L7XA 3OXFA 1H0ZA 1RFHA 3E59A 3VDPA 2OVOA 1SGRI 2QQ0A 2CJSC 4GI3C 1HJAI 2E73A 1CT2I 1UUCA 1CGJI 3FC3A 1TURA 2W0TA 1SGYI 1VDDA 2DB6A 2N71A 3UEJA 1CSOI 1SGQI 2FNFX 3UFFA 1HPTA 3VE5A 1TGSI 1TBNA 3OXGA 4B6DA 1LR9A 1SGDI 2KMPA 1MT1A 3OVOA 5FUWA 2UZ3A 1Y1BA 1YTPA 2KCXA 2KMOA 3SEKC 1CT4I 2F3CI 2NU1I 5DAEA 2P6AC 2V1CA 2VRWB 3QTLD 1TOTA 2JW6A 2N17A 3QWPA 2ROWA 1R79A 3GOXA 2B0UC 4E1PA 2JXDA 1LR8A 2E5RA 2LUYA 3TJQA 2JA1A 3UGDA 1BMOA 1X4SA 2KMRA 1IW4A 5CCLA 1CE3A 2JZMA 1SGEI 5JHWC 4A24A 1KBEA 3UEYA 1TUSA 2NU2I 5HQ8A 1XBTA 1KBFA 1Y1CA 1AN1I 2V53A 2QPOA 2SGPI 1OYVI 3D00A 1XX6A 1PJUA 1PPFI 4E1RA 2J9RA 1KMAA 1IY6A 2GKRI 2V1CC 3CXLA 2JYYA 2QQCA 2N1AB 2ORWA 2WVJA 2KMQA 2ODDA 3VDUA 2N52A 2SGQI 1DS3I 2SGEI 2DIPA 1CT0I 2NU0I 1CHOI 1N13A 5FUVA 2NU4I 2GKVA 1LR7A 3SGBI 2ARPF 1PTRA 1Z7KB 4FKDA 1FYBA 3HH2C 1Y8FA 1M8BA 1PCEA 1V1HA 2YUUA 2YQPA 4HGUA 1PTQA 1TIHA 5EX0A 2WCYA 3UGLA 5FUYA 1FAQA 1CGII 3SGQI 2XRCA 1R0RI 2SGFI 1YU6C 2LEOA 3B4VC 1TBRR 1W3SA 2QQDA 2ELIA 1TBQR 3OXLA 2OD1A 1NUBA 1XA6A 1W4RA 1M8CA 2A20A 5EX3A 4OVOA 3KY9A 1DS2I 2NU3I 1X74A 5HI7A 1OMTA 2K9HA 3MEKA 2BUSA 2GKTI 1V1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UVF A;  4SGB I;  2M5X A;  1HDL A;  1IY5 A;  2SGD I;  2ERW A;  1OVO A;  1SGN I;  1OMU A;  1BUS A;  1SGP I;  1UVG A;  1H0Z A;  2OVO A;  1SGR I;  4GI3 C;  1HJA I;  1CT2 I;  1UUC A;  1CGJ I;  1TUR A;  1SGY I;  2N71 A;  1CSO I;  1SGQ I;  1HPT A;  1TGS I;  1LR9 A;  1SGD I;  2KMP A;  1MT1 A;  3OVO A;  1Y1B A;  1YTP A;  2KCX A;  2KMO A;  3SEK C;  1CT4 I;  2F3C I;  2NU1 I;  5DAE A;  2P6A C;  3QTL D;  2N17 A;  2B0U C;  2JXD A;  1LR8 A;  3TJQ A;  1BMO A;  2KMR A;  1IW4 A;  1CE3 A;  2JZM A;  1SGE I;  5JHW C;  1TUS A;  2NU2 I;  1Y1C A;  1AN1 I;  2V53 A;  2SGP I;  1OYV I;  1PJU A;  1PPF I;  1KMA A;  1IY6 A;  2GKR I;  2JYY A;  2QQC A;  2KMQ A;  2N52 A;  2SGQ I;  1DS3 I;  2SGE I;  1CT0 I;  2NU0 I;  1CHO I;  1N13 A;  2NU4 I;  2GKV A;  1LR7 A;  3SGB I;  2ARP F;  1FYB A;  1Z7K B;  3HH2 C;  1M8B A;  1PCE A;  4HGU A;  1TIH A;  2WCY A;  1CGI I;  3SGQ I;  2XRC A;  1R0R I;  2SGF I;  1YU6 C;  2LEO A;  3B4V C;  1TBR R;  2QQD A;  1TBQ R;  1NUB A;  1M8C A;  4OVO A;  1DS2 I;  2NU3 I;  1OMT A;  2BUS A;  2GKT I; 
#chains in the Genus database with same CATH topology
 4UXH A;  1UVF A;  2J87 A;  2L8E A;  3BJI A;  4SGB I;  4UXI A;  2B8T A;  1P9G A;  4UXJ A;  3TO6 A;  4JCV E;  2M5X A;  2ENZ A;  2ORV A;  2WGC A;  1U5K A;  3OL0 A;  5FUX A;  3TO9 A;  1IY5 A;  2GVI A;  1HDL A;  2SGD I;  4L9M A;  2OZU A;  3E2I A;  2DKV A;  2ERW A;  1TBO A;  1FAR A;  1OVO A;  3RU0 A;  3UGI A;  2ENN A;  2OU2 A;  1WTJ A;  2QQE A;  1SGN I;  1OMU A;  3PDN A;  1BUS A;  1SGP I;  1UVG A;  2L7X A;  3OXF A;  1H0Z A;  1RFH A;  3E59 A;  3VDP A;  2OVO A;  9WGA A;  1SGR I;  2QQ0 A;  2CJS C;  2RIJ A;  1HJA I;  4GI3 C;  3TOA A;  2E73 A;  1CT2 I;  3UOE A;  1UUC A;  1CGJ I;  1WKX A;  1TUR A;  2W0T A;  2UVO A;  1SGY I;  3FC3 A;  1VDD A;  2DB6 A;  3TOB A;  1P9Z A;  2N71 A;  1CSO I;  1SGQ I;  3UEJ A;  2GIV A;  2FNF X;  3UFF A;  1HPT A;  3VE5 A;  1TGS I;  1TBN A;  2CWF A;  3OXG A;  3R5C A;  1ULK A;  1UHA A;  1LR9 A;  1SGD I;  2KMP A;  1MT1 A;  3OVO A;  5FUW A;  4B6D A;  2UZ3 A;  1Y1B A;  1YTP A;  2KCX A;  2KMO A;  3SEK C;  1CT4 I;  2F3C I;  2NU1 I;  5DAE A;  1MJ9 A;  2P6A C;  2V1C A;  2RC4 A;  2VRW B;  1K7U A;  3QTL D;  1TOT A;  2JW6 A;  2N17 A;  3QWP A;  2ROW A;  1R79 A;  1WGT A;  1K7T A;  3R5A A;  3GOX A;  7WGA A;  2B0U C;  4E1P A;  2JXD A;  1LR8 A;  5J8F A;  2E5R A;  5J8C A;  2LUY A;  3R5D A;  3TJQ A;  2JA1 A;  3UGD A;  3TO7 A;  1BMO A;  1X4S A;  1S20 A;  2CWH A;  2KMR A;  5CCL A;  1IW4 A;  1CE3 A;  2JZM A;  1SGE I;  5JHW C;  4A24 A;  1KBE A;  3UEY A;  1TUS A;  4MPI A;  2NU2 I;  3R5B A;  1XBT A;  5HQ8 A;  1KBF A;  1Y1C A;  1AN1 I;  2V53 A;  2QPO A;  2SGP I;  1OYV I;  3D00 A;  2PQ8 A;  1XX6 A;  1PJU A;  1PPF I;  3FSX A;  4E1R A;  2J9R A;  1KMA A;  2X52 A;  1IY6 A;  2GKR I;  2CWG A;  2V1C C;  3CXL A;  2JYY A;  2QQC A;  2N1A B;  2ORW A;  2WVJ A;  2KMQ A;  2ODD A;  5E3R A;  3VDU A;  2N52 A;  4DNC A;  2SGQ I;  1DS3 I;  2SGE I;  2DIP A;  5E3Q A;  2LB7 A;  1CT0 I;  2NU0 I;  1NXU A;  1CHO I;  1N13 A;  3QAH A;  5FUV A;  2NU4 I;  2GKV A;  1LR7 A;  1FY7 A;  3SGB I;  2ARP F;  1PTR A;  1Z7K B;  4FKD A;  4WP4 A;  5E3P A;  3HH2 C;  1Y8F A;  4AML A;  1FYB A;  1M8B A;  1PCE A;  1MJB A;  1V1H A;  2YUU A;  2YQP A;  1MJA A;  1PTQ A;  1TIH A;  4HGU A;  1K7V A;  5EX0 A;  2WCY A;  1Z2I A;  3FSY A;  3UGL A;  5FUY A;  1FAQ A;  1CGI I;  1Q9B A;  3SGQ I;  2XRC A;  1R0R I;  2SGF I;  1YU6 C;  2LEO A;  3B4V C;  2Y0M A;  1TBR R;  1W3S A;  2QQD A;  2ELI A;  1TBQ R;  3OXL A;  2OD1 A;  1WGC A;  1NUB A;  1XA6 A;  1ULN A;  1M8C A;  1W4R A;  2A20 A;  5EX3 A;  4OVO A;  3KY9 A;  1ULM A;  2BUS A;  1DS2 I;  2NU3 I;  1X74 A;  1HEV A;  2X3T A;  5HI7 A;  1OMT A;  2K9H A;  3MEK A;  1V1I A;  2GKT I;  5CCM A; 
#chains in the Genus database with same CATH homology
 4UXH A;  1UVF A;  2J87 A;  2L8E A;  3BJI A;  4SGB I;  4UXI A;  2B8T A;  4UXJ A;  4JCV E;  2M5X A;  2ENZ A;  5CCM A;  2ORV A;  3OL0 A;  1U5K A;  5FUX A;  1IY5 A;  1HDL A;  2GVI A;  2SGD I;  4L9M A;  3E2I A;  2ERW A;  1TBO A;  1FAR A;  1OVO A;  3RU0 A;  3UGI A;  2ENN A;  3PDN A;  2QQE A;  1SGN I;  1OMU A;  1BUS A;  1SGP I;  1UVG A;  2L7X A;  3OXF A;  1H0Z A;  1RFH A;  3E59 A;  3VDP A;  2OVO A;  1SGR I;  2QQ0 A;  2CJS C;  4GI3 C;  1HJA I;  2E73 A;  1CT2 I;  1UUC A;  1CGJ I;  3FC3 A;  1TUR A;  2W0T A;  1SGY I;  1VDD A;  2DB6 A;  2N71 A;  3UEJ A;  1CSO I;  1SGQ I;  2FNF X;  3UFF A;  1HPT A;  3VE5 A;  1TGS I;  1TBN A;  3OXG A;  4B6D A;  1LR9 A;  1SGD I;  2KMP A;  1MT1 A;  3OVO A;  5FUW A;  2UZ3 A;  1Y1B A;  1YTP A;  2KCX A;  2KMO A;  3SEK C;  1CT4 I;  2F3C I;  2NU1 I;  5DAE A;  2P6A C;  2V1C A;  2VRW B;  3QTL D;  1TOT A;  2JW6 A;  2N17 A;  3QWP A;  2ROW A;  1R79 A;  3GOX A;  2B0U C;  4E1P A;  2JXD A;  1LR8 A;  2E5R A;  2LUY A;  3TJQ A;  2JA1 A;  3UGD A;  1BMO A;  1X4S A;  2KMR A;  1IW4 A;  5CCL A;  1CE3 A;  2JZM A;  1SGE I;  5JHW C;  4A24 A;  1KBE A;  3UEY A;  1TUS A;  2NU2 I;  5HQ8 A;  1XBT A;  1KBF A;  1Y1C A;  1AN1 I;  2V53 A;  2QPO A;  2SGP I;  1OYV I;  3D00 A;  1XX6 A;  1PJU A;  1PPF I;  4E1R A;  2J9R A;  1KMA A;  1IY6 A;  2GKR I;  2V1C C;  3CXL A;  2JYY A;  2QQC A;  2N1A B;  2ORW A;  2WVJ A;  2KMQ A;  2ODD A;  3VDU A;  2N52 A;  2SGQ I;  1DS3 I;  2SGE I;  2DIP A;  1CT0 I;  2NU0 I;  1CHO I;  1N13 A;  5FUV A;  2NU4 I;  2GKV A;  1LR7 A;  3SGB I;  2ARP F;  1PTR A;  1Z7K B;  4FKD A;  1FYB A;  3HH2 C;  1Y8F A;  1M8B A;  1PCE A;  1V1H A;  2YUU A;  2YQP A;  4HGU A;  1PTQ A;  1TIH A;  5EX0 A;  2WCY A;  3UGL A;  5FUY A;  1FAQ A;  1CGI I;  3SGQ I;  2XRC A;  1R0R I;  2SGF I;  1YU6 C;  2LEO A;  3B4V C;  1TBR R;  1W3S A;  2QQD A;  2ELI A;  1TBQ R;  3OXL A;  2OD1 A;  1NUB A;  1XA6 A;  1W4R A;  1M8C A;  2A20 A;  5EX3 A;  4OVO A;  3KY9 A;  1DS2 I;  2NU3 I;  1X74 A;  5HI7 A;  1OMT A;  2K9H A;  3MEK A;  2BUS A;  2GKT I;  1V1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...