1FAQA

Raf-1 cysteine rich domain, nmr, 27 structures
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
52
structure length
52
Chain Sequence
LTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVPTMCVDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The solution structure of the Raf-1 cysteine-rich domain: a novel ras and phospholipid binding site.
pubmed doi rcsb
molecule keywords RAF-1
molecule tags Serine/threonine protein kinase
source organism Homo sapiens
total genus 4
structure length 52
sequence length 52
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1996-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1faqA00
1FAQA 1R79A 5FUVA 3UGIA 1XBTA 5FUXA 5FUWA 2ELIA 2QPOA 1KBFA 2QQEA 1W4RA 3UEYA 2WVJA 1RFHA 2J87A 2J9RA 2UZ3A 2YUUA 4UXIA 2B8TA 4UXJA 3UFFA 4B6DA 1TBNA 2DB6A 4L9MA 5FUYA 3UGLA 2ROWA 2ORWA 2FNFX 2GVIA 2ENNA 2JA1A 3BJIA 2ENZA 4FKDA 2VRWB 2QQ0A 1PTQA 1TBOA 1XX6A 1FARA 3E2IA 2ORVA 1KBEA 1Y8FA 3CXLA 3UGDA 1XA6A 2E73A 3UEJA 1PTRA 3KY9A 4UXHA
chains in the Genus database with same CATH superfamily
1WTJA 5E3RA 1UHAA 2SGDI 3UGIA 3E59A 1MJ9A 2CWGA 1UVGA 1VDDA 5E3PA 1CE3A 2ELIA 1TOTA 2QQEA 5J8FA 1PJUA 1LR8A 1YTPA 1P9ZA 1K7TA 2YUUA 4UXIA 2CWFA 2B8TA 1TBNA 1IY6A 2DB6A 1TBRR 2KMOA 1CGII 4L9MA 1TIHA 3TOBA 2ARPF 2ORWA 1H0ZA 1TUSA 1PPFI 1X4SA 2F3CI 1DS3I 2SGPI 2V1CA 2N17A 1FYBA 1S20A 1MJBA 3QAHA 2NU1I 1K7VA 1M8BA 1UVFA 1SGYI 2SGFI 2NU3I 1HPTA 1UUCA 2OVOA 1SGQI 2ORVA 3E2IA 1KBEA 3CXLA 3OXGA 3TO6A 1SGEI 3UOEA 3MEKA 2N1AB 1OMTA 3VDUA 1OMUA 1TBQR 1P9GA 1CHOI 2KCXA 3QTLD 1TGSI 1Y1BA 2E5RA 1XBTA 1SGRI 2WGCA 5FUXA 1ULMA 2QPOA 3R5BA 1KBFA 2LEOA 1WGTA 2Y0MA 1SGPI 1Y1CA 2K9HA 2NU2I 2RIJA 4AMLA 2UZ3A 4MPIA 1DS2I 1TURA 4HGUA 4UXJA 4B6DA 2ERWA 3FC3A 2PQ8A 2RC4A 3UGLA 2ROWA 1Z7KB 1V1IA 2GVIA 3B4VC 3RU0A 3TOAA 1R0RI 3OXFA 1CGJI 2ENNA 2LUYA 1SGDI 1WKXA 1HJAI 1ULNA 1ULKA 2M5XA 2LB7A 4FKDA 2VRWB 2QQ0A 3D00A 4DNCA 1PCEA 1TBOA 2L7XA 1AN1I 1M8CA 1Y8FA 2KMQA 1LR7A 2QQCA 4JCVE 3QWPA 1Z2IA 1PTRA 3UEYA 4UXHA 3UFFA 1WGCA 2KMPA 1FY7A 1CT2I 2JYYA 1KMAA 2KMRA 1LR9A 1NXUA 5J8CA 3SEKC 3SGBI 3GOXA 5CCMA 2JZMA 1W4RA 2CJSC 2W0TA 2J87A 2J9RA 3TJQA 9WGAA 3R5CA 1BMOA 7WGAA 2GIVA 2GKTI 3FSYA 5EX3A 1MT1A 5FUYA 2V53A 3VE5A 1IY5A 2FNFX 2NU4I 4E1RA 3TO9A 2OZUA 2BUSA 1Q9BA 2JA1A 1OYVI 2QQDA 2WCYA 4SGBI 5DAEA 2SGQI 2A20A 1XX6A 2X52A 5EX0A 1CT0I 1NUBA 5JHWC 2GKRI 1X74A 2X3TA 1IW4A 3UGDA 2E73A 2YQPA 5HI7A 3UEJA 3KY9A 3OL0A 1HDLA 2NU0I 1FAQA 4A24A 5E3QA 1R79A 5FUVA 1K7UA 1U5KA 4OVOA 3VDPA 2JXDA 1BUSA 5FUWA 1HEVA 2OD1A 2WVJA 3FSXA 1RFHA 4GI3C 2ODDA 5CCLA 3SGQI 3OVOA 3OXLA 3TO7A 3R5DA 2SGEI 1CSOI 2B0UC 2DIPA 1MJAA 2XRCA 2N71A 2OU2A 1CT4I 3PDNA 1N13A 4WP4A 3BJIA 3R5AA 2ENZA 2DKVA 1OVOA 1YU6C 1PTQA 2L8EA 2N52A 2P6AC 2UVOA 5HQ8A 1V1HA 1FARA 2GKVA 3HH2C 2JW6A 4E1PA 2V1CC 1XA6A 2CWHA 1W3SA 1SGNI
chains in the Genus database with same CATH topology
2SGDI 3UGIA 3E59A 1UVGA 1VDDA 1CE3A 2ELIA 1TOTA 2QQEA 1PJUA 1LR8A 1YTPA 2YUUA 4UXIA 2B8TA 1TBNA 1IY6A 2DB6A 1TBRR 2KMOA 1CGII 4L9MA 1TIHA 2ARPF 2ORWA 1H0ZA 1TUSA 1PPFI 1X4SA 2F3CI 1DS3I 2SGPI 2V1CA 2N17A 1FYBA 2NU1I 1M8BA 1UVFA 1SGYI 2SGFI 2NU3I 1HPTA 1UUCA 2OVOA 1SGQI 2ORVA 3E2IA 1KBEA 3CXLA 3OXGA 1SGEI 3MEKA 2N1AB 1OMTA 3VDUA 1OMUA 1TBQR 1CHOI 2KCXA 3QTLD 1TGSI 1Y1BA 2E5RA 1XBTA 1SGRI 5FUXA 2QPOA 1KBFA 2LEOA 1SGPI 1Y1CA 2K9HA 2NU2I 2UZ3A 1DS2I 1TURA 4HGUA 4UXJA 4B6DA 2ERWA 3FC3A 3UGLA 2ROWA 1Z7KB 1V1IA 2GVIA 3B4VC 3RU0A 1R0RI 3OXFA 1CGJI 2ENNA 2LUYA 1SGDI 1HJAI 2M5XA 4FKDA 2VRWB 2QQ0A 3D00A 1PCEA 1TBOA 2L7XA 1AN1I 1M8CA 1Y8FA 2KMQA 1LR7A 2QQCA 4JCVE 3QWPA 1PTRA 3UEYA 4UXHA 3UFFA 2KMPA 1CT2I 2JYYA 1KMAA 2KMRA 1LR9A 3SEKC 3SGBI 3GOXA 5CCMA 2JZMA 1W4RA 2CJSC 2W0TA 2J87A 2J9RA 3TJQA 1BMOA 2GKTI 5EX3A 1MT1A 5FUYA 2V53A 3VE5A 1IY5A 2FNFX 2NU4I 4E1RA 2BUSA 2JA1A 1OYVI 2QQDA 2WCYA 4SGBI 5DAEA 2SGQI 2A20A 1XX6A 5EX0A 1CT0I 1NUBA 5JHWC 2GKRI 1X74A 1IW4A 3UGDA 2E73A 2YQPA 5HI7A 3UEJA 3KY9A 3OL0A 1HDLA 2NU0I 1FAQA 4A24A 1R79A 5FUVA 1U5KA 4OVOA 3VDPA 2JXDA 1BUSA 5FUWA 2OD1A 2WVJA 1RFHA 4GI3C 2ODDA 5CCLA 3SGQI 3OVOA 3OXLA 2SGEI 1CSOI 2B0UC 2DIPA 2XRCA 2N71A 1CT4I 3PDNA 1N13A 3BJIA 2ENZA 1OVOA 1YU6C 1PTQA 2L8EA 2N52A 2P6AC 5HQ8A 1V1HA 1FARA 2GKVA 3HH2C 2JW6A 4E1PA 2V1CC 1XA6A 1W3SA 1SGNI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FAQ A;  1R79 A;  5FUV A;  3UGI A;  1XBT A;  5FUX A;  5FUW A;  2ELI A;  2QPO A;  1KBF A;  2QQE A;  1W4R A;  3UEY A;  2WVJ A;  1RFH A;  2J87 A;  2J9R A;  2UZ3 A;  2YUU A;  4UXI A;  2B8T A;  4UXJ A;  3UFF A;  4B6D A;  1TBN A;  2DB6 A;  4L9M A;  5FUY A;  3UGL A;  2ROW A;  2ORW A;  2FNF X;  2GVI A;  2ENN A;  2JA1 A;  3BJI A;  2ENZ A;  4FKD A;  2VRW B;  2QQ0 A;  1PTQ A;  1TBO A;  1XX6 A;  1FAR A;  3E2I A;  2ORV A;  1KBE A;  1Y8F A;  3CXL A;  3UGD A;  1XA6 A;  2E73 A;  3UEJ A;  1PTR A;  3KY9 A;  4UXH A; 
#chains in the Genus database with same CATH topology
 1WTJ A;  5E3R A;  1UHA A;  2SGD I;  3UGI A;  3E59 A;  1MJ9 A;  2CWG A;  1UVG A;  1VDD A;  5E3P A;  1CE3 A;  2ELI A;  1TOT A;  2QQE A;  5J8F A;  1PJU A;  1LR8 A;  1YTP A;  1P9Z A;  1K7T A;  2YUU A;  4UXI A;  2CWF A;  2B8T A;  1TBN A;  1IY6 A;  2DB6 A;  1TBR R;  2KMO A;  1CGI I;  4L9M A;  1TIH A;  3TOB A;  2ARP F;  2ORW A;  1H0Z A;  1TUS A;  1PPF I;  1X4S A;  2F3C I;  1DS3 I;  2SGP I;  2V1C A;  2N17 A;  1FYB A;  1S20 A;  1MJB A;  3QAH A;  2NU1 I;  1K7V A;  1M8B A;  1UVF A;  1SGY I;  2SGF I;  2NU3 I;  1HPT A;  1UUC A;  2OVO A;  1SGQ I;  2ORV A;  3E2I A;  1KBE A;  3CXL A;  3OXG A;  3TO6 A;  1SGE I;  3UOE A;  3MEK A;  2N1A B;  1OMT A;  3VDU A;  1OMU A;  1TBQ R;  1P9G A;  1CHO I;  2KCX A;  3QTL D;  1TGS I;  1Y1B A;  2E5R A;  1XBT A;  1SGR I;  2WGC A;  5FUX A;  1ULM A;  2QPO A;  3R5B A;  1KBF A;  2LEO A;  1WGT A;  2Y0M A;  1SGP I;  1Y1C A;  2K9H A;  2NU2 I;  2RIJ A;  4AML A;  2UZ3 A;  4MPI A;  1DS2 I;  1TUR A;  4HGU A;  4UXJ A;  4B6D A;  2ERW A;  3FC3 A;  2PQ8 A;  2RC4 A;  3UGL A;  2ROW A;  1Z7K B;  1V1I A;  2GVI A;  3B4V C;  3RU0 A;  3TOA A;  1R0R I;  3OXF A;  1CGJ I;  2ENN A;  2LUY A;  1SGD I;  1WKX A;  1HJA I;  1ULN A;  1ULK A;  2M5X A;  2LB7 A;  4FKD A;  2VRW B;  2QQ0 A;  3D00 A;  4DNC A;  1PCE A;  1TBO A;  2L7X A;  1AN1 I;  1M8C A;  1Y8F A;  2KMQ A;  1LR7 A;  2QQC A;  4JCV E;  3QWP A;  1Z2I A;  1PTR A;  3UEY A;  4UXH A;  3UFF A;  1WGC A;  2KMP A;  1FY7 A;  1CT2 I;  2JYY A;  1KMA A;  2KMR A;  1LR9 A;  1NXU A;  5J8C A;  3SEK C;  3SGB I;  3GOX A;  5CCM A;  2JZM A;  1W4R A;  2CJS C;  2W0T A;  2J87 A;  2J9R A;  3TJQ A;  9WGA A;  3R5C A;  1BMO A;  7WGA A;  2GIV A;  2GKT I;  3FSY A;  5EX3 A;  1MT1 A;  5FUY A;  2V53 A;  3VE5 A;  1IY5 A;  2FNF X;  2NU4 I;  4E1R A;  3TO9 A;  2OZU A;  2BUS A;  1Q9B A;  2JA1 A;  1OYV I;  2QQD A;  2WCY A;  4SGB I;  5DAE A;  2SGQ I;  2A20 A;  1XX6 A;  2X52 A;  5EX0 A;  1CT0 I;  1NUB A;  5JHW C;  2GKR I;  1X74 A;  2X3T A;  1IW4 A;  3UGD A;  2E73 A;  2YQP A;  5HI7 A;  3UEJ A;  3KY9 A;  3OL0 A;  1HDL A;  2NU0 I;  1FAQ A;  4A24 A;  5E3Q A;  1R79 A;  5FUV A;  1K7U A;  1U5K A;  4OVO A;  3VDP A;  2JXD A;  1BUS A;  5FUW A;  1HEV A;  2OD1 A;  2WVJ A;  3FSX A;  1RFH A;  4GI3 C;  2ODD A;  5CCL A;  3SGQ I;  3OVO A;  3OXL A;  3TO7 A;  3R5D A;  2SGE I;  1CSO I;  2B0U C;  2DIP A;  1MJA A;  2XRC A;  2N71 A;  2OU2 A;  1CT4 I;  3PDN A;  1N13 A;  4WP4 A;  3BJI A;  3R5A A;  2ENZ A;  2DKV A;  1OVO A;  1YU6 C;  1PTQ A;  2L8E A;  2N52 A;  2P6A C;  2UVO A;  5HQ8 A;  1V1H A;  1FAR A;  2GKV A;  3HH2 C;  2JW6 A;  4E1P A;  2V1C C;  1XA6 A;  2CWH A;  1W3S A;  1SGN I; 
#chains in the Genus database with same CATH homology
 2SGD I;  3UGI A;  3E59 A;  1UVG A;  1VDD A;  1CE3 A;  2ELI A;  1TOT A;  2QQE A;  1PJU A;  1LR8 A;  1YTP A;  2YUU A;  4UXI A;  2B8T A;  1TBN A;  1IY6 A;  2DB6 A;  1TBR R;  2KMO A;  1CGI I;  4L9M A;  1TIH A;  2ARP F;  2ORW A;  1H0Z A;  1TUS A;  1PPF I;  1X4S A;  2F3C I;  1DS3 I;  2SGP I;  2V1C A;  2N17 A;  1FYB A;  2NU1 I;  1M8B A;  1UVF A;  1SGY I;  2SGF I;  2NU3 I;  1HPT A;  1UUC A;  2OVO A;  1SGQ I;  2ORV A;  3E2I A;  1KBE A;  3CXL A;  3OXG A;  1SGE I;  3MEK A;  2N1A B;  1OMT A;  3VDU A;  1OMU A;  1TBQ R;  1CHO I;  2KCX A;  3QTL D;  1TGS I;  1Y1B A;  2E5R A;  1XBT A;  1SGR I;  5FUX A;  2QPO A;  1KBF A;  2LEO A;  1SGP I;  1Y1C A;  2K9H A;  2NU2 I;  2UZ3 A;  1DS2 I;  1TUR A;  4HGU A;  4UXJ A;  4B6D A;  2ERW A;  3FC3 A;  3UGL A;  2ROW A;  1Z7K B;  1V1I A;  2GVI A;  3B4V C;  3RU0 A;  1R0R I;  3OXF A;  1CGJ I;  2ENN A;  2LUY A;  1SGD I;  1HJA I;  2M5X A;  4FKD A;  2VRW B;  2QQ0 A;  3D00 A;  1PCE A;  1TBO A;  2L7X A;  1AN1 I;  1M8C A;  1Y8F A;  2KMQ A;  1LR7 A;  2QQC A;  4JCV E;  3QWP A;  1PTR A;  3UEY A;  4UXH A;  3UFF A;  2KMP A;  1CT2 I;  2JYY A;  1KMA A;  2KMR A;  1LR9 A;  3SEK C;  3SGB I;  3GOX A;  5CCM A;  2JZM A;  1W4R A;  2CJS C;  2W0T A;  2J87 A;  2J9R A;  3TJQ A;  1BMO A;  2GKT I;  5EX3 A;  1MT1 A;  5FUY A;  2V53 A;  3VE5 A;  1IY5 A;  2FNF X;  2NU4 I;  4E1R A;  2BUS A;  2JA1 A;  1OYV I;  2QQD A;  2WCY A;  4SGB I;  5DAE A;  2SGQ I;  2A20 A;  1XX6 A;  5EX0 A;  1CT0 I;  1NUB A;  5JHW C;  2GKR I;  1X74 A;  1IW4 A;  3UGD A;  2E73 A;  2YQP A;  5HI7 A;  3UEJ A;  3KY9 A;  3OL0 A;  1HDL A;  2NU0 I;  1FAQ A;  4A24 A;  1R79 A;  5FUV A;  1U5K A;  4OVO A;  3VDP A;  2JXD A;  1BUS A;  5FUW A;  2OD1 A;  2WVJ A;  1RFH A;  4GI3 C;  2ODD A;  5CCL A;  3SGQ I;  3OVO A;  3OXL A;  2SGE I;  1CSO I;  2B0U C;  2DIP A;  2XRC A;  2N71 A;  1CT4 I;  3PDN A;  1N13 A;  3BJI A;  2ENZ A;  1OVO A;  1YU6 C;  1PTQ A;  2L8E A;  2N52 A;  2P6A C;  5HQ8 A;  1V1H A;  1FAR A;  2GKV A;  3HH2 C;  2JW6 A;  4E1P A;  2V1C C;  1XA6 A;  1W3S A;  1SGN I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...