1FYBA

Solution structure of c1-t1, a two-domain proteinase inhibitor derived from the circular precursor protein na-propi from nicotiana alata
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
111
structure length
111
Chain Sequence
DRICTNCCAGTKGCKYFSDDGTFVCEGESDPRNPKACTLNCDPRIAYGVCPRSEEKKNDRICTNCCAGTKGCKYFSDDGTFVCEGESDPRNPKACPRNCDPRIAYGICPLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of C1-T1, a two-domain proteinase inhibitor derived from a circular precursor protein from Nicotiana alata.
pubmed doi rcsb
molecule keywords PROTEINASE INHIBITOR
molecule tags Hydrolase inhibitor
source organism Nicotiana alata
total genus 12
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2000-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02428 Prot_inhib_II Potato type II proteinase inhibitor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1fybA02
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1fybA01
1UVFA 1R0RI 2N17A 1CSOI 4OVOA 1Z7KB 1H0ZA 1TBQR 4GI3C 1HDLA 1DS3I 1CT2I 2JXDA 1BUSA 1TIHA 2ERWA 2M5XA 2NU1I 2NU2I 2QQCA 2SGDI 1AN1I 3OVOA 1SGEI 3SGQI 1LR9A 2GKVA 3SGBI 1SGRI 1OMUA 2BUSA 1TGSI 2XRCA 1TBRR 2KMOA 1IW4A 1YTPA 1BMOA 2F3CI 3SEKC 1OYVI 2OVOA 2P6AC 2GKTI 1PJUA 1FYBA 1TURA 2KMQA 1LR8A 1MT1A 2SGQI 4SGBI 3TJQA 1CE3A 2QQDA 1CT0I 1HPTA 1YU6C 2NU4I 2B0UC 1SGNI 2N71A 5DAEA 1CGJI 1OMTA 1SGQI 2SGFI 1KMAA 1Y1BA 2NU3I 1N13A 1SGPI 2ARPF 1M8CA 1DS2I 2V53A 2KMRA 1IY6A 1SGDI 1CHOI 1TUSA 5JHWC 1LR7A 1PCEA 1UVGA 2N52A 1OVOA 1HJAI 2SGPI 2JZMA 1M8BA 3HH2C 2WCYA 2LEOA 2NU0I 1UUCA 1NUBA 2SGEI 4HGUA 3QTLD 2GKRI 1Y1CA 1IY5A 1CT4I 2KMPA 2KCXA 1CGII 1SGYI 3B4VC 2JYYA 1PPFI
chains in the Genus database with same CATH superfamily
3D00A 1UVFA 1ULKA 2OU2A 3FSXA 1R0RI 2N17A 2A20A 1CSOI 1X74A 4OVOA 3SGBI 3BJIA 1Z7KB 1H0ZA 1TBQR 1WTJA 4GI3C 1HDLA 1DS3I 1CT2I 2JXDA 3TOBA 4E1RA 1BUSA 5CCLA 1TBNA 1TIHA 2JW6A 2ENNA 2ERWA 2M5XA 2NU1I 2NU2I 2QQCA 2SGDI 2L8EA 2V1CC 2WVJA 2CWFA 3R5DA 2UZ3A 3R5AA 1AN1I 1K7VA 1UHAA 2JA1A 2E5RA 3OVOA 1SGEI 3SGQI 5CCMA 1LR9A 1PTQA 4JCVE 2GKVA 3QWPA 2ELIA 2X52A 1SGRI 2GVIA 1XBTA 1NXUA 1W4RA 1Y8FA 2W0TA 2CWHA 3OXLA 3OXGA 3UEJA 1OMUA 2BUSA 2J87A 1TGSI 2XRCA 1TBRR 2DB6A 4UXHA 1FAQA 2KMOA 1IW4A 1YTPA 2K9HA 3VDPA 1KBEA 1BMOA 1MJBA 2F3CI 3SEKC 5FUVA 3FSYA 3E2IA 1HEVA 1OYVI 3QAHA 2B8TA 4FKDA 2CJSC 2OD1A 2J9RA 2OVOA 2OZUA 2P6AC 2VRWB 4WP4A 3TOAA 2GKTI 5E3RA 3VE5A 4L9MA 5EX3A 3PDNA 1PJUA 3OL0A 1FYBA 3GOXA 1TURA 3OXFA 5EX0A 1VDDA 1MJAA 3E59A 2QQ0A 2KMQA 5FUXA 1WKXA 1LR8A 1KBFA 1MT1A 3UGLA 2SGQI 4SGBI 3TJQA 3UGDA 3VDUA 5J8FA 1CE3A 2ODDA 2QQDA 1CT0I 1HPTA 2QPOA 3UFFA 1V1HA 1YU6C 1K7UA 2E73A 1WGCA 2RIJA 3R5BA 2NU4I 1W3SA 2B0UC 5FUYA 1SGNI 2N71A 5DAEA 2ORVA 9WGAA 1CGJI 1OMTA 1R79A 1SGQI 2SGFI 3UEYA 1P9ZA 5J8CA 1Y1BA 2V1CA 2NU3I 1N13A 1KMAA 1FARA 2ORWA 1ULNA 5E3PA 5E3QA 1Z2IA 4B6DA 2LB7A 1SGPI 2ARPF 1M8CA 1DS2I 1FY7A 4AMLA 3R5CA 3CXLA 2V53A 2Y0MA 4E1PA 2WGCA 1WGTA 2KMRA 1IY6A 1Q9BA 1SGDI 2DKVA 1CHOI 1TUSA 1U5KA 4UXJA 3TO9A 3UOEA 5JHWC 3FC3A 1LR7A 1XA6A 1ULMA 2GIVA 2N1AB 1PCEA 1UVGA 2X3TA 4MPIA 1X4SA 2N52A 1OVOA 1HJAI 2CWGA 2L7XA 1S20A 1TOTA 2SGPI 5HQ8A 4UXIA 2JZMA 2UVOA 1PTRA 1M8BA 1TBOA 3HH2C 2ENZA 2YQPA 2WCYA 1XX6A 2LEOA 5HI7A 2NU0I 2FNFX 1UUCA 1NUBA 2SGEI 4HGUA 3QTLD 7WGAA 2GKRI 1Y1CA 1IY5A 2ROWA 2YUUA 1CT4I 2KMPA 3MEKA 2KCXA 3KY9A 1RFHA 1CGII 1SGYI 2RC4A 1V1IA 1K7TA 1P9GA 3UGIA 3RU0A 3TO7A 2LUYA 5FUWA 3B4VC 1MJ9A 2QQEA 4A24A 2JYYA 1PPFI 2DIPA 2PQ8A 4DNCA 3TO6A
chains in the Genus database with same CATH topology
3D00A 1UVFA 1R0RI 2N17A 2A20A 1CSOI 1X74A 4OVOA 3BJIA 1Z7KB 1H0ZA 1TBQR 4GI3C 1HDLA 1DS3I 1CT2I 2JXDA 4E1RA 1BUSA 5CCLA 1TBNA 1TIHA 2JW6A 2ENNA 2ERWA 2M5XA 2NU1I 2NU2I 2QQCA 2SGDI 2L8EA 2V1CC 2WVJA 2UZ3A 1AN1I 2JA1A 2E5RA 3OVOA 1SGEI 3SGQI 5CCMA 1LR9A 1PTQA 4JCVE 2GKVA 3QWPA 2ELIA 3SGBI 1SGRI 2GVIA 1XBTA 1W4RA 1Y8FA 2W0TA 3OXLA 3OXGA 3UEJA 1OMUA 2BUSA 2J87A 1TGSI 2XRCA 1TBRR 2DB6A 4UXHA 1FAQA 2KMOA 1IW4A 1YTPA 2K9HA 3VDPA 1KBEA 1BMOA 2F3CI 3SEKC 5FUVA 3E2IA 1OYVI 2B8TA 4FKDA 2CJSC 2OD1A 2J9RA 2OVOA 2P6AC 2VRWB 2GKTI 3VE5A 4L9MA 5EX3A 3PDNA 1PJUA 3OL0A 1FYBA 3GOXA 1TURA 3OXFA 5EX0A 1VDDA 3E59A 2QQ0A 2KMQA 5FUXA 1LR8A 1KBFA 1MT1A 3UGLA 2SGQI 4SGBI 3TJQA 3UGDA 3VDUA 1CE3A 2ODDA 2QQDA 1CT0I 1HPTA 2QPOA 3UFFA 1V1HA 1YU6C 2E73A 2NU4I 1W3SA 2B0UC 5FUYA 1SGNI 2N71A 5DAEA 2ORVA 1CGJI 1OMTA 1R79A 1SGQI 2SGFI 3UEYA 1KMAA 1Y1BA 2V1CA 2NU3I 1N13A 1FARA 2ORWA 4B6DA 1SGPI 2ARPF 1M8CA 1DS2I 3CXLA 2V53A 4E1PA 2KMRA 1IY6A 1SGDI 1CHOI 1TUSA 1U5KA 4UXJA 3FC3A 5JHWC 1LR7A 1XA6A 2N1AB 1PCEA 1UVGA 1X4SA 2N52A 1OVOA 1HJAI 2L7XA 1TOTA 2SGPI 5HQ8A 4UXIA 2JZMA 1PTRA 1M8BA 1TBOA 3HH2C 2ENZA 2YQPA 2WCYA 1XX6A 2LEOA 5HI7A 2NU0I 2FNFX 1UUCA 1NUBA 2SGEI 4HGUA 3QTLD 2GKRI 1Y1CA 1IY5A 2ROWA 2YUUA 1CT4I 2KMPA 3MEKA 2KCXA 3KY9A 1RFHA 1CGII 1SGYI 1V1IA 3UGIA 3RU0A 2LUYA 5FUWA 3B4VC 2QQEA 4A24A 2JYYA 1PPFI 2DIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UVF A;  1R0R I;  2N17 A;  1CSO I;  4OVO A;  1Z7K B;  1H0Z A;  1TBQ R;  4GI3 C;  1HDL A;  1DS3 I;  1CT2 I;  2JXD A;  1BUS A;  1TIH A;  2ERW A;  2M5X A;  2NU1 I;  2NU2 I;  2QQC A;  2SGD I;  1AN1 I;  3OVO A;  1SGE I;  3SGQ I;  1LR9 A;  2GKV A;  3SGB I;  1SGR I;  1OMU A;  2BUS A;  1TGS I;  2XRC A;  1TBR R;  2KMO A;  1IW4 A;  1YTP A;  1BMO A;  2F3C I;  3SEK C;  1OYV I;  2OVO A;  2P6A C;  2GKT I;  1PJU A;  1FYB A;  1TUR A;  2KMQ A;  1LR8 A;  1MT1 A;  2SGQ I;  4SGB I;  3TJQ A;  1CE3 A;  2QQD A;  1CT0 I;  1HPT A;  1YU6 C;  2NU4 I;  2B0U C;  1SGN I;  2N71 A;  5DAE A;  1CGJ I;  1OMT A;  1SGQ I;  2SGF I;  1KMA A;  1Y1B A;  2NU3 I;  1N13 A;  1SGP I;  2ARP F;  1M8C A;  1DS2 I;  2V53 A;  2KMR A;  1IY6 A;  1SGD I;  1CHO I;  1TUS A;  5JHW C;  1LR7 A;  1PCE A;  1UVG A;  2N52 A;  1OVO A;  1HJA I;  2SGP I;  2JZM A;  1M8B A;  3HH2 C;  2WCY A;  2LEO A;  2NU0 I;  1UUC A;  1NUB A;  2SGE I;  4HGU A;  3QTL D;  2GKR I;  1Y1C A;  1IY5 A;  1CT4 I;  2KMP A;  2KCX A;  1CGI I;  1SGY I;  3B4V C;  2JYY A;  1PPF I; 
#chains in the Genus database with same CATH topology
 3D00 A;  1UVF A;  1ULK A;  2OU2 A;  3FSX A;  1R0R I;  2N17 A;  2A20 A;  1CSO I;  1X74 A;  4OVO A;  3SGB I;  3BJI A;  1Z7K B;  1H0Z A;  1TBQ R;  1WTJ A;  4GI3 C;  1HDL A;  1DS3 I;  1CT2 I;  2JXD A;  3TOB A;  4E1R A;  1BUS A;  5CCL A;  1TBN A;  1TIH A;  2JW6 A;  2ENN A;  2ERW A;  2M5X A;  2NU1 I;  2NU2 I;  2QQC A;  2SGD I;  2L8E A;  2V1C C;  2WVJ A;  2CWF A;  3R5D A;  2UZ3 A;  3R5A A;  1AN1 I;  1K7V A;  1UHA A;  2JA1 A;  2E5R A;  3OVO A;  1SGE I;  3SGQ I;  5CCM A;  1LR9 A;  1PTQ A;  4JCV E;  2GKV A;  3QWP A;  2ELI A;  2X52 A;  1SGR I;  2GVI A;  1XBT A;  1NXU A;  1W4R A;  1Y8F A;  2W0T A;  2CWH A;  3OXL A;  3OXG A;  3UEJ A;  1OMU A;  2BUS A;  2J87 A;  1TGS I;  2XRC A;  1TBR R;  2DB6 A;  4UXH A;  1FAQ A;  2KMO A;  1IW4 A;  1YTP A;  2K9H A;  3VDP A;  1KBE A;  1BMO A;  1MJB A;  2F3C I;  3SEK C;  5FUV A;  3FSY A;  3E2I A;  1HEV A;  1OYV I;  3QAH A;  2B8T A;  4FKD A;  2CJS C;  2OD1 A;  2J9R A;  2OVO A;  2OZU A;  2P6A C;  2VRW B;  4WP4 A;  3TOA A;  2GKT I;  5E3R A;  3VE5 A;  4L9M A;  5EX3 A;  3PDN A;  1PJU A;  3OL0 A;  1FYB A;  3GOX A;  1TUR A;  3OXF A;  5EX0 A;  1VDD A;  1MJA A;  3E59 A;  2QQ0 A;  2KMQ A;  5FUX A;  1WKX A;  1LR8 A;  1KBF A;  1MT1 A;  3UGL A;  2SGQ I;  4SGB I;  3TJQ A;  3UGD A;  3VDU A;  5J8F A;  1CE3 A;  2ODD A;  2QQD A;  1CT0 I;  1HPT A;  2QPO A;  3UFF A;  1V1H A;  1YU6 C;  1K7U A;  2E73 A;  1WGC A;  2RIJ A;  3R5B A;  2NU4 I;  1W3S A;  2B0U C;  5FUY A;  1SGN I;  2N71 A;  5DAE A;  2ORV A;  9WGA A;  1CGJ I;  1OMT A;  1R79 A;  1SGQ I;  2SGF I;  3UEY A;  1P9Z A;  5J8C A;  1Y1B A;  2V1C A;  2NU3 I;  1N13 A;  1KMA A;  1FAR A;  2ORW A;  1ULN A;  5E3P A;  5E3Q A;  1Z2I A;  4B6D A;  2LB7 A;  1SGP I;  2ARP F;  1M8C A;  1DS2 I;  1FY7 A;  4AML A;  3R5C A;  3CXL A;  2V53 A;  2Y0M A;  4E1P A;  2WGC A;  1WGT A;  2KMR A;  1IY6 A;  1Q9B A;  1SGD I;  2DKV A;  1CHO I;  1TUS A;  1U5K A;  4UXJ A;  3TO9 A;  3UOE A;  5JHW C;  3FC3 A;  1LR7 A;  1XA6 A;  1ULM A;  2GIV A;  2N1A B;  1PCE A;  1UVG A;  2X3T A;  4MPI A;  1X4S A;  2N52 A;  1OVO A;  1HJA I;  2CWG A;  2L7X A;  1S20 A;  1TOT A;  2SGP I;  5HQ8 A;  4UXI A;  2JZM A;  2UVO A;  1PTR A;  1M8B A;  1TBO A;  3HH2 C;  2ENZ A;  2YQP A;  2WCY A;  1XX6 A;  2LEO A;  5HI7 A;  2NU0 I;  2FNF X;  1UUC A;  1NUB A;  2SGE I;  4HGU A;  3QTL D;  7WGA A;  2GKR I;  1Y1C A;  1IY5 A;  2ROW A;  2YUU A;  1CT4 I;  2KMP A;  3MEK A;  2KCX A;  3KY9 A;  1RFH A;  1CGI I;  1SGY I;  2RC4 A;  1V1I A;  1K7T A;  1P9G A;  3UGI A;  3RU0 A;  3TO7 A;  2LUY A;  5FUW A;  3B4V C;  1MJ9 A;  2QQE A;  4A24 A;  2JYY A;  1PPF I;  2DIP A;  2PQ8 A;  4DNC A;  3TO6 A; 
#chains in the Genus database with same CATH homology
 3D00 A;  1UVF A;  1R0R I;  2N17 A;  2A20 A;  1CSO I;  1X74 A;  4OVO A;  3BJI A;  1Z7K B;  1H0Z A;  1TBQ R;  4GI3 C;  1HDL A;  1DS3 I;  1CT2 I;  2JXD A;  4E1R A;  1BUS A;  5CCL A;  1TBN A;  1TIH A;  2JW6 A;  2ENN A;  2ERW A;  2M5X A;  2NU1 I;  2NU2 I;  2QQC A;  2SGD I;  2L8E A;  2V1C C;  2WVJ A;  2UZ3 A;  1AN1 I;  2JA1 A;  2E5R A;  3OVO A;  1SGE I;  3SGQ I;  5CCM A;  1LR9 A;  1PTQ A;  4JCV E;  2GKV A;  3QWP A;  2ELI A;  3SGB I;  1SGR I;  2GVI A;  1XBT A;  1W4R A;  1Y8F A;  2W0T A;  3OXL A;  3OXG A;  3UEJ A;  1OMU A;  2BUS A;  2J87 A;  1TGS I;  2XRC A;  1TBR R;  2DB6 A;  4UXH A;  1FAQ A;  2KMO A;  1IW4 A;  1YTP A;  2K9H A;  3VDP A;  1KBE A;  1BMO A;  2F3C I;  3SEK C;  5FUV A;  3E2I A;  1OYV I;  2B8T A;  4FKD A;  2CJS C;  2OD1 A;  2J9R A;  2OVO A;  2P6A C;  2VRW B;  2GKT I;  3VE5 A;  4L9M A;  5EX3 A;  3PDN A;  1PJU A;  3OL0 A;  1FYB A;  3GOX A;  1TUR A;  3OXF A;  5EX0 A;  1VDD A;  3E59 A;  2QQ0 A;  2KMQ A;  5FUX A;  1LR8 A;  1KBF A;  1MT1 A;  3UGL A;  2SGQ I;  4SGB I;  3TJQ A;  3UGD A;  3VDU A;  1CE3 A;  2ODD A;  2QQD A;  1CT0 I;  1HPT A;  2QPO A;  3UFF A;  1V1H A;  1YU6 C;  2E73 A;  2NU4 I;  1W3S A;  2B0U C;  5FUY A;  1SGN I;  2N71 A;  5DAE A;  2ORV A;  1CGJ I;  1OMT A;  1R79 A;  1SGQ I;  2SGF I;  3UEY A;  1KMA A;  1Y1B A;  2V1C A;  2NU3 I;  1N13 A;  1FAR A;  2ORW A;  4B6D A;  1SGP I;  2ARP F;  1M8C A;  1DS2 I;  3CXL A;  2V53 A;  4E1P A;  2KMR A;  1IY6 A;  1SGD I;  1CHO I;  1TUS A;  1U5K A;  4UXJ A;  3FC3 A;  5JHW C;  1LR7 A;  1XA6 A;  2N1A B;  1PCE A;  1UVG A;  1X4S A;  2N52 A;  1OVO A;  1HJA I;  2L7X A;  1TOT A;  2SGP I;  5HQ8 A;  4UXI A;  2JZM A;  1PTR A;  1M8B A;  1TBO A;  3HH2 C;  2ENZ A;  2YQP A;  2WCY A;  1XX6 A;  2LEO A;  5HI7 A;  2NU0 I;  2FNF X;  1UUC A;  1NUB A;  2SGE I;  4HGU A;  3QTL D;  2GKR I;  1Y1C A;  1IY5 A;  2ROW A;  2YUU A;  1CT4 I;  2KMP A;  3MEK A;  2KCX A;  3KY9 A;  1RFH A;  1CGI I;  1SGY I;  1V1I A;  3UGI A;  3RU0 A;  2LUY A;  5FUW A;  3B4V C;  2QQE A;  4A24 A;  2JYY A;  1PPF I;  2DIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...