1FYBA

Solution structure of c1-t1, a two-domain proteinase inhibitor derived from the circular precursor protein na-propi from nicotiana alata
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
111
structure length
111
Chain Sequence
b'DRICTNCCAGTKGCKYFSDDGTFVCEGESDPRNPKACTLNCDPRIAYGVCPRSEEKKNDRICTNCCAGTKGCKYFSDDGTFVCEGESDPRNPKACPRNCDPRIAYGICPLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE INHIBITOR
publication title The solution structure of C1-T1, a two-domain proteinase inhibitor derived from a circular precursor protein from Nicotiana alata.
pubmed doi rcsb
source organism Nicotiana alata
molecule tags Hydrolase inhibitor
total genus 12
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2000-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02428 Prot_inhib_II Potato type II proteinase inhibitor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1fybA02
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1fybA01
1CHOI 1UUCA 3TJQA 1LR7A 1CT2I 2NU3I 1SGYI 1AN1I 2N17A 1CSOI 2NU4I 2JXDA 2SGFI 2KMOA 2BUSA 1OMUA 1UVGA 3B4VC 1DS3I 3OVOA 1TGSI 4OVOA 1Y1BA 1TBQR 2N71A 5DAEA 2V53A 1OMTA 2GKTI 1YU6C 1PPFI 2KMPA 1BMOA 1CGJI 1SGEI 1TBRR 1Y1CA 1HPTA 1BUSA 1MT1A 2OVOA 2NU1I 1CT0I 1LR8A 1PJUA 2GKRI 1SGQI 1OYVI 2KCXA 1TIHA 1NUBA 2SGQI 1TUSA 1TURA 1IY6A 1H0ZA 1CGII 2N52A 2P6AC 1M8CA 2SGEI 1CE3A 2ERWA 1HJAI 1SGDI 3QTLD 2B0UC 2ARPF 2SGPI 2M5XA 1SGPI 1N13A 5JHWC 1HDLA 1Z7KB 1UVFA 1PCEA 1SGRI 2WCYA 1LR9A 1DS2I 2XRCA 2JYYA 1CT4I 2KMRA 2QQDA 1KMAA 1YTPA 2KMQA 1OVOA 1R0RI 2LEOA 1IY5A 3SEKC 3SGQI 2NU0I 1SGNI 2SGDI 4GI3C 2NU2I 2QQCA 3SGBI 1M8BA 1IW4A 1FYBA 2JZMA 2F3CI 4HGUA 3HH2C 4SGBI 2GKVA
chains in the Genus database with same CATH superfamily
2N1AB 1CHOI 1V1HA 1UUCA 2E5RA 3TJQA 1LR7A 4JCVE 1CT2I 2NU3I 1V1IA 1MJBA 2K9HA 1SGYI 3VDPA 1AN1I 2LUYA 3QAHA 2N17A 1VDDA 3MEKA 1CSOI 2NU4I 2JXDA 2B8TA 2SGFI 4WP4A 2KMOA 5E3RA 2BUSA 2OU2A 2ELIA 5J8CA 1KBEA 1OMUA 1UVGA 2J87A 2V1CA 3B4VC 3VDUA 3FC3A 1DS3I 1PTQA 2FNFX 2JA1A 2WVJA 4UXIA 3OVOA 1ULNA 3TOAA 1TGSI 4OVOA 1Q9BA 1TBOA 1Y1BA 1TBQR 2N71A 5FUYA 1XX6A 5DAEA 1XBTA 1P9GA 2V53A 1OMTA 1P9ZA 2GKTI 2ODDA 1W4RA 1YU6C 3FSXA 3UGIA 5E3QA 2E73A 2X3TA 4SGBI 4A24A 1W3SA 1ULKA 5E3PA 1PPFI 3KY9A 5CCMA 2KMPA 1BMOA 1CGJI 4AMLA 4DNCA 1SGEI 2CWHA 1TBRR 1Y1CA 2OD1A 1HPTA 3E59A 1BUSA 1MT1A 3PDNA 2OZUA 5HI7A 2OVOA 2WGCA 2YQPA 3UEJA 1FARA 4L9MA 2ENNA 2LB7A 5FUXA 5FUWA 2Y0MA 2NU1I 1CT0I 1TOTA 1XA6A 3TOBA 5J8FA 1LR8A 2PQ8A 4MPIA 1FY7A 1PJUA 1MJAA 3TO6A 3CXLA 1K7VA 2QQ0A 2L8EA 2GKRI 1SGQI 2UZ3A 1OYVI 2KCXA 2VRWB 1TIHA 1NUBA 2ENZA 2SGQI 3FSYA 2QQEA 1TUSA 1TURA 1IY6A 3QWPA 1H0ZA 2RIJA 2UVOA 4FKDA 1CGII 1WGTA 2N52A 1WKXA 2P6AC 2W0TA 1Y8FA 1M8CA 2ROWA 2SGEI 3BJIA 1CE3A 2CWGA 1HJAI 2ERWA 3E2IA 2DB6A 1SGDI 1Z2IA 2GIVA 3OXLA 2A20A 1X4SA 3QTLD 2B0UC 3OL0A 4E1RA 1PTRA 2ARPF 2SGPI 1K7UA 5FUVA 3UEYA 4B6DA 2M5XA 1R79A 1SGPI 2RC4A 2JW6A 1N13A 1RFHA 3UFFA 2X52A 3D00A 3R5AA 2YUUA 3UGDA 5CCLA 5JHWC 1HDLA 1WGCA 1Z7KB 1UVFA 1S20A 1PCEA 1SGRI 1UHAA 2WCYA 4E1PA 1TBNA 2J9RA 7WGAA 2GVIA 3R5CA 1LR9A 1NXUA 1DS2I 1WTJA 2XRCA 1FAQA 3TO9A 2JYYA 1CT4I 3TO7A 2KMRA 2QQDA 3VE5A 3GOXA 1KMAA 4UXJA 1YTPA 2CWFA 2KMQA 1OVOA 1R0RI 2LEOA 3UOEA 5EX0A 3SEKC 1IY5A 5EX3A 3SGQI 1HEVA 1KBFA 2NU0I 1SGNI 2SGDI 2CJSC 2QPOA 3R5BA 4GI3C 2ORVA 9WGAA 4UXHA 2NU2I 3RU0A 1ULMA 2QQCA 2ORWA 1K7TA 3SGBI 1M8BA 1U5KA 2V1CC 1IW4A 3OXGA 2DKVA 2DIPA 1FYBA 5HQ8A 1X74A 2JZMA 3OXFA 2F3CI 4HGUA 3HH2C 3R5DA 3UGLA 1MJ9A 2L7XA 2GKVA
chains in the Genus database with same CATH topology
2N1AB 1CHOI 1V1HA 1UUCA 2E5RA 3TJQA 1LR7A 4JCVE 1CT2I 2NU3I 1V1IA 2K9HA 1SGYI 3VDPA 1AN1I 2LUYA 2N17A 1VDDA 3MEKA 1CSOI 2NU4I 2JXDA 2B8TA 2SGFI 2KMOA 2BUSA 2ELIA 1KBEA 1OMUA 1UVGA 2J87A 2V1CA 3B4VC 3VDUA 3FC3A 1DS3I 1PTQA 2FNFX 2JA1A 2WVJA 4UXIA 3OVOA 1TGSI 4OVOA 1TBOA 1Y1BA 1TBQR 2N71A 5FUYA 1XX6A 5DAEA 1XBTA 2V53A 1OMTA 2GKTI 2ODDA 1W4RA 1YU6C 3UGIA 2E73A 4A24A 1W3SA 1PPFI 3KY9A 5CCMA 2KMPA 1BMOA 1CGJI 1SGEI 1TBRR 1Y1CA 2OD1A 1HPTA 3E59A 1BUSA 1MT1A 3PDNA 5HI7A 2OVOA 2YQPA 3UEJA 1FARA 4L9MA 2ENNA 5FUXA 5FUWA 2NU1I 1CT0I 1TOTA 1XA6A 1LR8A 1PJUA 3CXLA 2QQ0A 2L8EA 2GKRI 1SGQI 2UZ3A 1OYVI 2KCXA 2VRWB 1TIHA 1NUBA 2ENZA 2SGQI 2QQEA 1TUSA 1TURA 1IY6A 3QWPA 1H0ZA 4FKDA 1CGII 2N52A 2P6AC 2W0TA 1Y8FA 1M8CA 2ROWA 2SGEI 3BJIA 1CE3A 2ERWA 1HJAI 3E2IA 2DB6A 1SGDI 3OXLA 2A20A 1X4SA 3QTLD 2B0UC 3OL0A 4E1RA 1PTRA 2ARPF 2SGPI 5FUVA 3UEYA 4B6DA 2M5XA 1R79A 1SGPI 2JW6A 1N13A 1RFHA 3UFFA 3D00A 5JHWC 3UGDA 2YUUA 1HDLA 5CCLA 1Z7KB 1UVFA 1PCEA 1SGRI 2WCYA 4E1PA 1TBNA 2J9RA 2GVIA 1LR9A 1DS2I 2XRCA 1FAQA 2JYYA 1CT4I 2KMRA 2QQDA 3VE5A 3GOXA 1KMAA 4UXJA 1YTPA 2KMQA 1OVOA 1R0RI 2LEOA 5EX0A 3SEKC 1IY5A 5EX3A 3SGQI 1KBFA 2NU0I 1SGNI 2SGDI 2CJSC 2QPOA 4GI3C 2ORVA 4UXHA 2NU2I 3RU0A 2QQCA 2ORWA 3SGBI 1M8BA 1U5KA 2V1CC 1IW4A 3OXGA 2DIPA 1FYBA 5HQ8A 1X74A 2JZMA 3OXFA 2F3CI 4HGUA 3HH2C 3UGLA 4SGBI 2L7XA 2GKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CHO I;  1UUC A;  3TJQ A;  1LR7 A;  1CT2 I;  2NU3 I;  1SGY I;  1AN1 I;  2N17 A;  1CSO I;  2NU4 I;  2JXD A;  2SGF I;  2KMO A;  2BUS A;  1OMU A;  1UVG A;  3B4V C;  1DS3 I;  3OVO A;  1TGS I;  4OVO A;  1Y1B A;  1TBQ R;  2N71 A;  5DAE A;  2V53 A;  1OMT A;  2GKT I;  1YU6 C;  1PPF I;  2KMP A;  1BMO A;  1CGJ I;  1SGE I;  1TBR R;  1Y1C A;  1HPT A;  1BUS A;  1MT1 A;  2OVO A;  2NU1 I;  1CT0 I;  1LR8 A;  1PJU A;  2GKR I;  1SGQ I;  1OYV I;  2KCX A;  1TIH A;  1NUB A;  2SGQ I;  1TUS A;  1TUR A;  1IY6 A;  1H0Z A;  1CGI I;  2N52 A;  2P6A C;  1M8C A;  2SGE I;  1CE3 A;  2ERW A;  1HJA I;  1SGD I;  3QTL D;  2B0U C;  2ARP F;  2SGP I;  2M5X A;  1SGP I;  1N13 A;  5JHW C;  1HDL A;  1Z7K B;  1UVF A;  1PCE A;  1SGR I;  2WCY A;  1LR9 A;  1DS2 I;  2XRC A;  2JYY A;  1CT4 I;  2KMR A;  2QQD A;  1KMA A;  1YTP A;  2KMQ A;  1OVO A;  1R0R I;  2LEO A;  1IY5 A;  3SEK C;  3SGQ I;  2NU0 I;  1SGN I;  2SGD I;  4GI3 C;  2NU2 I;  2QQC A;  3SGB I;  1M8B A;  1IW4 A;  1FYB A;  2JZM A;  2F3C I;  4HGU A;  3HH2 C;  4SGB I;  2GKV A; 
#chains in the Genus database with same CATH topology
 2N1A B;  1CHO I;  1V1H A;  1UUC A;  2E5R A;  3TJQ A;  1LR7 A;  4JCV E;  1CT2 I;  2NU3 I;  1V1I A;  1MJB A;  2K9H A;  1SGY I;  3VDP A;  1AN1 I;  2LUY A;  3QAH A;  2N17 A;  1VDD A;  3MEK A;  1CSO I;  2NU4 I;  2JXD A;  2B8T A;  2SGF I;  4WP4 A;  2KMO A;  5E3R A;  2BUS A;  2OU2 A;  2ELI A;  5J8C A;  1KBE A;  1OMU A;  1UVG A;  2J87 A;  2V1C A;  3B4V C;  3VDU A;  3FC3 A;  1DS3 I;  1PTQ A;  2FNF X;  2JA1 A;  2WVJ A;  4UXI A;  3OVO A;  1ULN A;  3TOA A;  1TGS I;  4OVO A;  1Q9B A;  1TBO A;  1Y1B A;  1TBQ R;  2N71 A;  5FUY A;  1XX6 A;  5DAE A;  1XBT A;  1P9G A;  2V53 A;  1OMT A;  1P9Z A;  2GKT I;  2ODD A;  1W4R A;  1YU6 C;  3FSX A;  3UGI A;  5E3Q A;  2E73 A;  2X3T A;  4SGB I;  4A24 A;  1W3S A;  1ULK A;  5E3P A;  1PPF I;  3KY9 A;  5CCM A;  2KMP A;  1BMO A;  1CGJ I;  4AML A;  4DNC A;  1SGE I;  2CWH A;  1TBR R;  1Y1C A;  2OD1 A;  1HPT A;  3E59 A;  1BUS A;  1MT1 A;  3PDN A;  2OZU A;  5HI7 A;  2OVO A;  2WGC A;  2YQP A;  3UEJ A;  1FAR A;  4L9M A;  2ENN A;  2LB7 A;  5FUX A;  5FUW A;  2Y0M A;  2NU1 I;  1CT0 I;  1TOT A;  1XA6 A;  3TOB A;  5J8F A;  1LR8 A;  2PQ8 A;  4MPI A;  1FY7 A;  1PJU A;  1MJA A;  3TO6 A;  3CXL A;  1K7V A;  2QQ0 A;  2L8E A;  2GKR I;  1SGQ I;  2UZ3 A;  1OYV I;  2KCX A;  2VRW B;  1TIH A;  1NUB A;  2ENZ A;  2SGQ I;  3FSY A;  2QQE A;  1TUS A;  1TUR A;  1IY6 A;  3QWP A;  1H0Z A;  2RIJ A;  2UVO A;  4FKD A;  1CGI I;  1WGT A;  2N52 A;  1WKX A;  2P6A C;  2W0T A;  1Y8F A;  1M8C A;  2ROW A;  2SGE I;  3BJI A;  1CE3 A;  2CWG A;  1HJA I;  2ERW A;  3E2I A;  2DB6 A;  1SGD I;  1Z2I A;  2GIV A;  3OXL A;  2A20 A;  1X4S A;  3QTL D;  2B0U C;  3OL0 A;  4E1R A;  1PTR A;  2ARP F;  2SGP I;  1K7U A;  5FUV A;  3UEY A;  4B6D A;  2M5X A;  1R79 A;  1SGP I;  2RC4 A;  2JW6 A;  1N13 A;  1RFH A;  3UFF A;  2X52 A;  3D00 A;  3R5A A;  2YUU A;  3UGD A;  5CCL A;  5JHW C;  1HDL A;  1WGC A;  1Z7K B;  1UVF A;  1S20 A;  1PCE A;  1SGR I;  1UHA A;  2WCY A;  4E1P A;  1TBN A;  2J9R A;  7WGA A;  2GVI A;  3R5C A;  1LR9 A;  1NXU A;  1DS2 I;  1WTJ A;  2XRC A;  1FAQ A;  3TO9 A;  2JYY A;  1CT4 I;  3TO7 A;  2KMR A;  2QQD A;  3VE5 A;  3GOX A;  1KMA A;  4UXJ A;  1YTP A;  2CWF A;  2KMQ A;  1OVO A;  1R0R I;  2LEO A;  3UOE A;  5EX0 A;  3SEK C;  1IY5 A;  5EX3 A;  3SGQ I;  1HEV A;  1KBF A;  2NU0 I;  1SGN I;  2SGD I;  2CJS C;  2QPO A;  3R5B A;  4GI3 C;  2ORV A;  9WGA A;  4UXH A;  2NU2 I;  3RU0 A;  1ULM A;  2QQC A;  2ORW A;  1K7T A;  3SGB I;  1M8B A;  1U5K A;  2V1C C;  1IW4 A;  3OXG A;  2DKV A;  2DIP A;  1FYB A;  5HQ8 A;  1X74 A;  2JZM A;  3OXF A;  2F3C I;  4HGU A;  3HH2 C;  3R5D A;  3UGL A;  1MJ9 A;  2L7X A;  2GKV A; 
#chains in the Genus database with same CATH homology
 2N1A B;  1CHO I;  1V1H A;  1UUC A;  2E5R A;  3TJQ A;  1LR7 A;  4JCV E;  1CT2 I;  2NU3 I;  1V1I A;  2K9H A;  1SGY I;  3VDP A;  1AN1 I;  2LUY A;  2N17 A;  1VDD A;  3MEK A;  1CSO I;  2NU4 I;  2JXD A;  2B8T A;  2SGF I;  2KMO A;  2BUS A;  2ELI A;  1KBE A;  1OMU A;  1UVG A;  2J87 A;  2V1C A;  3B4V C;  3VDU A;  3FC3 A;  1DS3 I;  1PTQ A;  2FNF X;  2JA1 A;  2WVJ A;  4UXI A;  3OVO A;  1TGS I;  4OVO A;  1TBO A;  1Y1B A;  1TBQ R;  2N71 A;  5FUY A;  1XX6 A;  5DAE A;  1XBT A;  2V53 A;  1OMT A;  2GKT I;  2ODD A;  1W4R A;  1YU6 C;  3UGI A;  2E73 A;  4A24 A;  1W3S A;  1PPF I;  3KY9 A;  5CCM A;  2KMP A;  1BMO A;  1CGJ I;  1SGE I;  1TBR R;  1Y1C A;  2OD1 A;  1HPT A;  3E59 A;  1BUS A;  1MT1 A;  3PDN A;  5HI7 A;  2OVO A;  2YQP A;  3UEJ A;  1FAR A;  4L9M A;  2ENN A;  5FUX A;  5FUW A;  2NU1 I;  1CT0 I;  1TOT A;  1XA6 A;  1LR8 A;  1PJU A;  3CXL A;  2QQ0 A;  2L8E A;  2GKR I;  1SGQ I;  2UZ3 A;  1OYV I;  2KCX A;  2VRW B;  1TIH A;  1NUB A;  2ENZ A;  2SGQ I;  2QQE A;  1TUS A;  1TUR A;  1IY6 A;  3QWP A;  1H0Z A;  4FKD A;  1CGI I;  2N52 A;  2P6A C;  2W0T A;  1Y8F A;  1M8C A;  2ROW A;  2SGE I;  3BJI A;  1CE3 A;  2ERW A;  1HJA I;  3E2I A;  2DB6 A;  1SGD I;  3OXL A;  2A20 A;  1X4S A;  3QTL D;  2B0U C;  3OL0 A;  4E1R A;  1PTR A;  2ARP F;  2SGP I;  5FUV A;  3UEY A;  4B6D A;  2M5X A;  1R79 A;  1SGP I;  2JW6 A;  1N13 A;  1RFH A;  3UFF A;  3D00 A;  5JHW C;  3UGD A;  2YUU A;  1HDL A;  5CCL A;  1Z7K B;  1UVF A;  1PCE A;  1SGR I;  2WCY A;  4E1P A;  1TBN A;  2J9R A;  2GVI A;  1LR9 A;  1DS2 I;  2XRC A;  1FAQ A;  2JYY A;  1CT4 I;  2KMR A;  2QQD A;  3VE5 A;  3GOX A;  1KMA A;  4UXJ A;  1YTP A;  2KMQ A;  1OVO A;  1R0R I;  2LEO A;  5EX0 A;  3SEK C;  1IY5 A;  5EX3 A;  3SGQ I;  1KBF A;  2NU0 I;  1SGN I;  2SGD I;  2CJS C;  2QPO A;  4GI3 C;  2ORV A;  4UXH A;  2NU2 I;  3RU0 A;  2QQC A;  2ORW A;  3SGB I;  1M8B A;  1U5K A;  2V1C C;  1IW4 A;  3OXG A;  2DIP A;  1FYB A;  5HQ8 A;  1X74 A;  2JZM A;  3OXF A;  2F3C I;  4HGU A;  3HH2 C;  3UGL A;  4SGB I;  2L7X A;  2GKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...