1IY5A

Solution structure of wild type omsvp3
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
54
structure length
54
Chain Sequence
AVSVDCSEYPKPACTMEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibitory Specificity Change of Ovomucoid Third Domain of the Silver Pheasant upon Introduction of an Engineered Cys14-Cys39 Bond
pubmed doi rcsb
molecule keywords OMSVP3
molecule tags Hydrolase
source organism Lophura nycthemera
total genus 7
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2002-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1iy5A00
3SGBI 2SGFI 3OVOA 1FYBA 1BUSA 2JXDA 1LR7A 2WCYA 1AN1I 1CSOI 2ERWA 2NU3I 2KMRA 2V53A 1TBQR 1SGDI 1SGRI 1SGEI 1CT4I 1Z7KB 2KCXA 2XRCA 2SGQI 3HH2C 1MT1A 1TGSI 1IW4A 4HGUA 1DS2I 1SGNI 1R0RI 1PPFI 1HJAI 1SGPI 1OYVI 2ARPF 1UVGA 2LEOA 2SGEI 1KMAA 1TBRR 2NU2I 1LR9A 2B0UC 1M8CA 2KMQA 1CGJI 1YU6C 1CT2I 2QQDA 5DAEA 2KMOA 2N17A 1TIHA 1TURA 3QTLD 1SGYI 1TUSA 1NUBA 5JHWC 2NU0I 2GKRI 1PJUA 3SEKC 2NU1I 1IY6A 2JZMA 1CE3A 2F3CI 1OVOA 3SGQI 1M8BA 1Y1CA 1YTPA 1N13A 2P6AC 1SGQI 1PCEA 2N52A 2SGDI 2NU4I 1CHOI 2QQCA 2JYYA 2SGPI 2KMPA 1DS3I 2GKVA 1CT0I 2M5XA 1LR8A 1OMTA 3TJQA 3B4VC 4OVOA 2GKTI 1UUCA 1CGII 1BMOA 1IY5A 1OMUA 2OVOA 1UVFA 4SGBI 1H0ZA 1Y1BA 2N71A 1HDLA 1HPTA 2BUSA 4GI3C
chains in the Genus database with same CATH superfamily
3SGBI 2SGFI 3OVOA 1P9GA 4UXJA 3QAHA 1MJBA 1FYBA 4MPIA 2OZUA 1X4SA 2ENNA 2UVOA 3FSYA 4UXIA 5EX0A 2E5RA 1K7VA 1S20A 1RFHA 2J9RA 2JXDA 1BUSA 2GVIA 1LR7A 1WKXA 2WCYA 2CWFA 1AN1I 1CSOI 2WVJA 4E1RA 2ERWA 2NU3I 2X52A 2KMRA 2V53A 1TBQR 1SGDI 2RIJA 3R5AA 5J8FA 1SGRI 3TO9A 1SGEI 1CT4I 1PTRA 1XBTA 3KY9A 3TO6A 1Z7KB 2KCXA 2XRCA 2SGQI 3HH2C 3FC3A 1MT1A 1TGSI 1V1IA 2ELIA 2V1CC 2ODDA 2PQ8A 1IW4A 2W0TA 4HGUA 1MJ9A 1DS2I 2CWHA 2CJSC 1SGNI 2JW6A 3FSXA 2ORVA 1R0RI 1PPFI 3OXFA 1HJAI 2FNFX 2WGCA 3R5BA 1SGPI 4FKDA 5HQ8A 1OYVI 1W3SA 3TOBA 1MJAA 1UVGA 2ARPF 2LEOA 5J8CA 1U5KA 2SGEI 1R79A 1KMAA 1TBRR 2NU2I 2OU2A 3VDPA 1LR9A 1ULKA 2B0UC 3D00A 1M8CA 1TBOA 1W4RA 1KBEA 2B8TA 1WGCA 2KMQA 3PDNA 1P9ZA 1CGJI 3CXLA 1YU6C 1CT2I 1FY7A 1WTJA 2UZ3A 2QQDA 2ENZA 4L9MA 4UXHA 1Y8FA 2LB7A 5DAEA 3UEJA 2KMOA 2N17A 5FUWA 1TIHA 1TURA 5E3RA 1XX6A 3QTLD 5E3PA 1SGYI 4WP4A 1TUSA 2VRWB 1NUBA 2ROWA 3BJIA 5JHWC 2NU0I 2A20A 1TOTA 2GKRI 1PJUA 3E2IA 3SEKC 2JA1A 1VDDA 2NU1I 1WGTA 1XA6A 1FAQA 1K7UA 3TOAA 1HEVA 1IY6A 2JZMA 2QQ0A 5E3QA 2DKVA 4A24A 1CE3A 3RU0A 2F3CI 2J87A 1OVOA 3SGQI 2E73A 1M8BA 1Y1CA 3UOEA 3VE5A 3OL0A 7WGAA 1YTPA 2YUUA 1N13A 1V1HA 2CWGA 4JCVE 2P6AC 3UGLA 1SGQI 1PCEA 2N52A 3VDUA 2SGDI 1K7TA 2NU4I 3E59A 1CHOI 2QQCA 4AMLA 2JYYA 2L8EA 3UGDA 3MEKA 3QWPA 2LUYA 1FARA 2SGPI 1NXUA 3R5DA 2KMPA 3TO7A 1DS3I 2GKVA 3UFFA 2GIVA 1CT0I 2DB6A 2M5XA 2N1AB 2V1CA 2QQEA 4B6DA 5CCMA 1LR8A 3UEYA 1OMTA 1ULMA 3TJQA 3B4VC 1ULNA 1Z2IA 5FUXA 2DIPA 5EX3A 4OVOA 5HI7A 1UHAA 1Q9BA 1TBNA 3UGIA 1UUCA 2GKTI 1CGII 2QPOA 5CCLA 1PTQA 1BMOA 3R5CA 3GOXA 1IY5A 2Y0MA 1OMUA 2RC4A 2YQPA 9WGAA 2ORWA 2OVOA 1X74A 3OXLA 5FUVA 1UVFA 4E1PA 2L7XA 4SGBI 1H0ZA 1Y1BA 2OD1A 2N71A 1HDLA 1HPTA 2K9HA 1KBFA 2X3TA 2BUSA 4DNCA 3OXGA 4GI3C 5FUYA
chains in the Genus database with same CATH topology
3SGBI 2SGFI 3OVOA 4UXJA 1FYBA 5HQ8A 1X4SA 2ENNA 4UXIA 3UFFA 5EX0A 2E5RA 1BUSA 1RFHA 2J9RA 2JXDA 2GVIA 1LR7A 2WCYA 1AN1I 1CSOI 2WVJA 4E1RA 2ERWA 2NU3I 2KMRA 2V53A 1TBQR 1SGDI 1SGRI 1SGEI 1CT4I 1PTRA 1XBTA 3KY9A 1Z7KB 2KCXA 2XRCA 2SGQI 3HH2C 3FC3A 1MT1A 1TGSI 1V1IA 2ELIA 2V1CC 2ODDA 1IW4A 2W0TA 4HGUA 1DS2I 2CJSC 1SGNI 2JW6A 2ORVA 1R0RI 1PPFI 3OXFA 1HJAI 2FNFX 1SGPI 4FKDA 1OYVI 1W3SA 2ARPF 1UVGA 2LEOA 1U5KA 2SGEI 1R79A 1KMAA 1TBRR 2NU2I 3VDPA 1LR9A 2B0UC 3D00A 1M8CA 1TBOA 1W4RA 1KBEA 2B8TA 2KMQA 3PDNA 1CGJI 3CXLA 1YU6C 1CT2I 2UZ3A 2QQDA 2ENZA 4L9MA 4UXHA 1Y8FA 5DAEA 3UEJA 2KMOA 2N17A 5FUWA 1TIHA 1TURA 1XX6A 3QTLD 1SGYI 1TUSA 2VRWB 1NUBA 2ROWA 3BJIA 5JHWC 2NU0I 2A20A 1TOTA 2GKRI 1PJUA 3E2IA 3SEKC 2JA1A 1VDDA 2NU1I 1XA6A 1FAQA 1IY6A 2JZMA 2QQ0A 4A24A 1CE3A 3RU0A 2F3CI 2J87A 1OVOA 3SGQI 2E73A 1M8BA 1Y1CA 3VE5A 3OL0A 1YTPA 2YUUA 1N13A 1V1HA 4JCVE 3UGLA 2P6AC 3VDUA 1SGQI 1PCEA 2N52A 2SGDI 2NU4I 3E59A 1CHOI 2QQCA 2JYYA 2L8EA 3UGDA 3MEKA 3QWPA 2LUYA 1FARA 2SGPI 2KMPA 1DS3I 2GKVA 1CT0I 2DB6A 2M5XA 2N1AB 2V1CA 2QQEA 4B6DA 5CCMA 1LR8A 3UEYA 1OMTA 3TJQA 3B4VC 5FUXA 2DIPA 5EX3A 4OVOA 5HI7A 1TBNA 3UGIA 1UUCA 2GKTI 1CGII 2QPOA 5CCLA 1PTQA 1BMOA 3GOXA 1IY5A 1OMUA 2YQPA 2ORWA 2OVOA 1X74A 3OXLA 5FUVA 1UVFA 4E1PA 2L7XA 4SGBI 1H0ZA 1Y1BA 2OD1A 2N71A 1HDLA 1HPTA 2K9HA 1KBFA 2BUSA 3OXGA 4GI3C 5FUYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SGB I;  2SGF I;  3OVO A;  1FYB A;  1BUS A;  2JXD A;  1LR7 A;  2WCY A;  1AN1 I;  1CSO I;  2ERW A;  2NU3 I;  2KMR A;  2V53 A;  1TBQ R;  1SGD I;  1SGR I;  1SGE I;  1CT4 I;  1Z7K B;  2KCX A;  2XRC A;  2SGQ I;  3HH2 C;  1MT1 A;  1TGS I;  1IW4 A;  4HGU A;  1DS2 I;  1SGN I;  1R0R I;  1PPF I;  1HJA I;  1SGP I;  1OYV I;  2ARP F;  1UVG A;  2LEO A;  2SGE I;  1KMA A;  1TBR R;  2NU2 I;  1LR9 A;  2B0U C;  1M8C A;  2KMQ A;  1CGJ I;  1YU6 C;  1CT2 I;  2QQD A;  5DAE A;  2KMO A;  2N17 A;  1TIH A;  1TUR A;  3QTL D;  1SGY I;  1TUS A;  1NUB A;  5JHW C;  2NU0 I;  2GKR I;  1PJU A;  3SEK C;  2NU1 I;  1IY6 A;  2JZM A;  1CE3 A;  2F3C I;  1OVO A;  3SGQ I;  1M8B A;  1Y1C A;  1YTP A;  1N13 A;  2P6A C;  1SGQ I;  1PCE A;  2N52 A;  2SGD I;  2NU4 I;  1CHO I;  2QQC A;  2JYY A;  2SGP I;  2KMP A;  1DS3 I;  2GKV A;  1CT0 I;  2M5X A;  1LR8 A;  1OMT A;  3TJQ A;  3B4V C;  4OVO A;  2GKT I;  1UUC A;  1CGI I;  1BMO A;  1IY5 A;  1OMU A;  2OVO A;  1UVF A;  4SGB I;  1H0Z A;  1Y1B A;  2N71 A;  1HDL A;  1HPT A;  2BUS A;  4GI3 C; 
#chains in the Genus database with same CATH topology
 3SGB I;  2SGF I;  3OVO A;  1P9G A;  4UXJ A;  3QAH A;  1MJB A;  1FYB A;  4MPI A;  2OZU A;  1X4S A;  2ENN A;  2UVO A;  3FSY A;  4UXI A;  5EX0 A;  2E5R A;  1K7V A;  1S20 A;  1RFH A;  2J9R A;  2JXD A;  1BUS A;  2GVI A;  1LR7 A;  1WKX A;  2WCY A;  2CWF A;  1AN1 I;  1CSO I;  2WVJ A;  4E1R A;  2ERW A;  2NU3 I;  2X52 A;  2KMR A;  2V53 A;  1TBQ R;  1SGD I;  2RIJ A;  3R5A A;  5J8F A;  1SGR I;  3TO9 A;  1SGE I;  1CT4 I;  1PTR A;  1XBT A;  3KY9 A;  3TO6 A;  1Z7K B;  2KCX A;  2XRC A;  2SGQ I;  3HH2 C;  3FC3 A;  1MT1 A;  1TGS I;  1V1I A;  2ELI A;  2V1C C;  2ODD A;  2PQ8 A;  1IW4 A;  2W0T A;  4HGU A;  1MJ9 A;  1DS2 I;  2CWH A;  2CJS C;  1SGN I;  2JW6 A;  3FSX A;  2ORV A;  1R0R I;  1PPF I;  3OXF A;  1HJA I;  2FNF X;  2WGC A;  3R5B A;  1SGP I;  4FKD A;  5HQ8 A;  1OYV I;  1W3S A;  3TOB A;  1MJA A;  1UVG A;  2ARP F;  2LEO A;  5J8C A;  1U5K A;  2SGE I;  1R79 A;  1KMA A;  1TBR R;  2NU2 I;  2OU2 A;  3VDP A;  1LR9 A;  1ULK A;  2B0U C;  3D00 A;  1M8C A;  1TBO A;  1W4R A;  1KBE A;  2B8T A;  1WGC A;  2KMQ A;  3PDN A;  1P9Z A;  1CGJ I;  3CXL A;  1YU6 C;  1CT2 I;  1FY7 A;  1WTJ A;  2UZ3 A;  2QQD A;  2ENZ A;  4L9M A;  4UXH A;  1Y8F A;  2LB7 A;  5DAE A;  3UEJ A;  2KMO A;  2N17 A;  5FUW A;  1TIH A;  1TUR A;  5E3R A;  1XX6 A;  3QTL D;  5E3P A;  1SGY I;  4WP4 A;  1TUS A;  2VRW B;  1NUB A;  2ROW A;  3BJI A;  5JHW C;  2NU0 I;  2A20 A;  1TOT A;  2GKR I;  1PJU A;  3E2I A;  3SEK C;  2JA1 A;  1VDD A;  2NU1 I;  1WGT A;  1XA6 A;  1FAQ A;  1K7U A;  3TOA A;  1HEV A;  1IY6 A;  2JZM A;  2QQ0 A;  5E3Q A;  2DKV A;  4A24 A;  1CE3 A;  3RU0 A;  2F3C I;  2J87 A;  1OVO A;  3SGQ I;  2E73 A;  1M8B A;  1Y1C A;  3UOE A;  3VE5 A;  3OL0 A;  7WGA A;  1YTP A;  2YUU A;  1N13 A;  1V1H A;  2CWG A;  4JCV E;  2P6A C;  3UGL A;  1SGQ I;  1PCE A;  2N52 A;  3VDU A;  2SGD I;  1K7T A;  2NU4 I;  3E59 A;  1CHO I;  2QQC A;  4AML A;  2JYY A;  2L8E A;  3UGD A;  3MEK A;  3QWP A;  2LUY A;  1FAR A;  2SGP I;  1NXU A;  3R5D A;  2KMP A;  3TO7 A;  1DS3 I;  2GKV A;  3UFF A;  2GIV A;  1CT0 I;  2DB6 A;  2M5X A;  2N1A B;  2V1C A;  2QQE A;  4B6D A;  5CCM A;  1LR8 A;  3UEY A;  1OMT A;  1ULM A;  3TJQ A;  3B4V C;  1ULN A;  1Z2I A;  5FUX A;  2DIP A;  5EX3 A;  4OVO A;  5HI7 A;  1UHA A;  1Q9B A;  1TBN A;  3UGI A;  1UUC A;  2GKT I;  1CGI I;  2QPO A;  5CCL A;  1PTQ A;  1BMO A;  3R5C A;  3GOX A;  1IY5 A;  2Y0M A;  1OMU A;  2RC4 A;  2YQP A;  9WGA A;  2ORW A;  2OVO A;  1X74 A;  3OXL A;  5FUV A;  1UVF A;  4E1P A;  2L7X A;  4SGB I;  1H0Z A;  1Y1B A;  2OD1 A;  2N71 A;  1HDL A;  1HPT A;  2K9H A;  1KBF A;  2X3T A;  2BUS A;  4DNC A;  3OXG A;  4GI3 C;  5FUY A; 
#chains in the Genus database with same CATH homology
 3SGB I;  2SGF I;  3OVO A;  4UXJ A;  1FYB A;  5HQ8 A;  1X4S A;  2ENN A;  4UXI A;  3UFF A;  5EX0 A;  2E5R A;  1BUS A;  1RFH A;  2J9R A;  2JXD A;  2GVI A;  1LR7 A;  2WCY A;  1AN1 I;  1CSO I;  2WVJ A;  4E1R A;  2ERW A;  2NU3 I;  2KMR A;  2V53 A;  1TBQ R;  1SGD I;  1SGR I;  1SGE I;  1CT4 I;  1PTR A;  1XBT A;  3KY9 A;  1Z7K B;  2KCX A;  2XRC A;  2SGQ I;  3HH2 C;  3FC3 A;  1MT1 A;  1TGS I;  1V1I A;  2ELI A;  2V1C C;  2ODD A;  1IW4 A;  2W0T A;  4HGU A;  1DS2 I;  2CJS C;  1SGN I;  2JW6 A;  2ORV A;  1R0R I;  1PPF I;  3OXF A;  1HJA I;  2FNF X;  1SGP I;  4FKD A;  1OYV I;  1W3S A;  2ARP F;  1UVG A;  2LEO A;  1U5K A;  2SGE I;  1R79 A;  1KMA A;  1TBR R;  2NU2 I;  3VDP A;  1LR9 A;  2B0U C;  3D00 A;  1M8C A;  1TBO A;  1W4R A;  1KBE A;  2B8T A;  2KMQ A;  3PDN A;  1CGJ I;  3CXL A;  1YU6 C;  1CT2 I;  2UZ3 A;  2QQD A;  2ENZ A;  4L9M A;  4UXH A;  1Y8F A;  5DAE A;  3UEJ A;  2KMO A;  2N17 A;  5FUW A;  1TIH A;  1TUR A;  1XX6 A;  3QTL D;  1SGY I;  1TUS A;  2VRW B;  1NUB A;  2ROW A;  3BJI A;  5JHW C;  2NU0 I;  2A20 A;  1TOT A;  2GKR I;  1PJU A;  3E2I A;  3SEK C;  2JA1 A;  1VDD A;  2NU1 I;  1XA6 A;  1FAQ A;  1IY6 A;  2JZM A;  2QQ0 A;  4A24 A;  1CE3 A;  3RU0 A;  2F3C I;  2J87 A;  1OVO A;  3SGQ I;  2E73 A;  1M8B A;  1Y1C A;  3VE5 A;  3OL0 A;  1YTP A;  2YUU A;  1N13 A;  1V1H A;  4JCV E;  3UGL A;  2P6A C;  3VDU A;  1SGQ I;  1PCE A;  2N52 A;  2SGD I;  2NU4 I;  3E59 A;  1CHO I;  2QQC A;  2JYY A;  2L8E A;  3UGD A;  3MEK A;  3QWP A;  2LUY A;  1FAR A;  2SGP I;  2KMP A;  1DS3 I;  2GKV A;  1CT0 I;  2DB6 A;  2M5X A;  2N1A B;  2V1C A;  2QQE A;  4B6D A;  5CCM A;  1LR8 A;  3UEY A;  1OMT A;  3TJQ A;  3B4V C;  5FUX A;  2DIP A;  5EX3 A;  4OVO A;  5HI7 A;  1TBN A;  3UGI A;  1UUC A;  2GKT I;  1CGI I;  2QPO A;  5CCL A;  1PTQ A;  1BMO A;  3GOX A;  1IY5 A;  1OMU A;  2YQP A;  2ORW A;  2OVO A;  1X74 A;  3OXL A;  5FUV A;  1UVF A;  4E1P A;  2L7X A;  4SGB I;  1H0Z A;  1Y1B A;  2OD1 A;  2N71 A;  1HDL A;  1HPT A;  2K9H A;  1KBF A;  2BUS A;  3OXG A;  4GI3 C;  5FUY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...