3UEJA

Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase cdelta
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
65
Chain Sequence
GSRRASVGSHRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Functional Characterization of an Anesthetic Binding Site in the Second Cysteine-Rich Domain of Protein Kinase Cdelta
pubmed doi rcsb
molecule keywords Protein kinase C delta type
molecule tags Metal binding protein
source organism Mus musculus
total genus 10
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3uejA01
2J9RA 4L9MA 1TBNA 2E73A 1KBEA 2WVJA 4UXIA 2QQ0A 2JA1A 1R79A 2B8TA 1XX6A 2UZ3A 3UEYA 4B6DA 2DB6A 4UXHA 5FUYA 1FARA 1RFHA 2ROWA 2ENNA 3E2IA 2YUUA 1PTRA 1KBFA 3KY9A 1TBOA 3UGIA 3UGDA 2QQEA 4FKDA 2GVIA 3CXLA 1W4RA 2ELIA 2ENZA 5FUWA 1XA6A 3BJIA 4UXJA 1XBTA 5FUXA 3UEJA 3UGLA 2VRWB 5FUVA 2QPOA 1PTQA 2J87A 1FAQA 1Y8FA 2ORWA 2ORVA 3UFFA 2FNFX
chains in the Genus database with same CATH superfamily
2Y0MA 3OVOA 1LR8A 2N1AB 2JA1A 1X4SA 1R79A 4UXHA 7WGAA 3OXGA 3R5DA 2GIVA 1IY5A 3RU0A 5CCMA 2PQ8A 2N17A 1TUSA 2ENNA 9WGAA 1DS2I 1CGII 1K7TA 1TOTA 2N52A 3KY9A 1MJ9A 1TBOA 2BUSA 2RIJA 2V53A 2CWGA 1WKXA 2CWFA 5EX3A 2ERWA 1U5KA 5EX0A 3UGDA 2WCYA 1SGPI 2CJSC 1W4RA 2DKVA 3OXFA 1CSOI 1XA6A 1XBTA 3QAHA 2JYYA 1OVOA 1UHAA 1LR9A 5FUVA 3VDUA 4GI3C 3HH2C 1Y8FA 2ORWA 2F3CI 2L8EA 3TO6A 2NU1I 4E1RA 1LR7A 5J8CA 2SGQI 2QQCA 3R5BA 4L9MA 1DS3I 1S20A 4UXIA 3FSXA 2B8TA 1XX6A 2UZ3A 4WP4A 5E3PA 2ODDA 2DB6A 5E3RA 1W3SA 5FUYA 1HDLA 1FARA 2GKTI 1ULKA 2LEOA 1CT2I 1WGTA 3PDNA 1WTJA 1CT0I 3OL0A 1IY6A 2YUUA 3TOBA 1KBFA 1X74A 3SEKC 1V1IA 1UUCA 2OU2A 3R5AA 1YTPA 2KCXA 5E3QA 1MT1A 2ELIA 1CT4I 1P9ZA 3QTLD 4OVOA 1OMTA 1SGRI 3BJIA 1HJAI 1MJBA 4SGBI 1OYVI 2KMQA 3UEJA 1FYBA 2DIPA 5JHWC 1FAQA 2V1CA 4MPIA 1PJUA 2ORVA 1VDDA 2NU4I 3UFFA 1FY7A 2XRCA 3VE5A 2KMPA 1WGCA 1H0ZA 3FSYA 1M8BA 2GKRI 2NU3I 2J9RA 2V1CC 4JCVE 1PPFI 2LUYA 1Z7KB 4DNCA 1V1HA 1YU6C 2SGFI 1BMOA 3B4VC 4E1PA 2JW6A 2NU0I 1KMAA 1TBRR 5HI7A 3D00A 1P9GA 3TOAA 3TO7A 2X52A 4HGUA 3UGIA 1TIHA 2WGCA 3FC3A 3UOEA 2UVOA 5DAEA 1Q9BA 2QQEA 1Y1CA 1R0RI 5HQ8A 1HPTA 3CXLA 3TO9A 1Z2IA 2A20A 2ENZA 5FUWA 4UXJA 1SGNI 1NUBA 2KMRA 2QPOA 2VRWB 2J87A 3SGBI 1IW4A 1SGYI 2K9HA 1SGDI 2QQDA 3SGQI 2ARPF 2GKVA 2W0TA 1AN1I 2JXDA 1K7UA 2JZMA 2OVOA 1CE3A 1ULNA 1MJAA 1TBNA 1OMUA 1KBEA 2E73A 2WVJA 2QQ0A 1UVGA 2M5XA 1BUSA 4AMLA 1SGEI 3UEYA 4B6DA 2X3TA 1HEVA 1RFHA 2ROWA 4A24A 2L7XA 1PCEA 1TGSI 1Y1BA 3E2IA 1PTRA 1TURA 2P6AC 1TBQR 5J8FA 5CCLA 3GOXA 2OD1A 4FKDA 1UVFA 1K7VA 2OZUA 1CHOI 2GVIA 2SGDI 1M8CA 2B0UC 3R5CA 1NXUA 5FUXA 1SGQI 3UGLA 2CWHA 3VDPA 3E59A 1PTQA 2SGPI 2E5RA 2N71A 2SGEI 1ULMA 2RC4A 2YQPA 2NU2I 3QWPA 2KMOA 3MEKA 3TJQA 1CGJI 3OXLA 2FNFX 1N13A 2LB7A
chains in the Genus database with same CATH topology
3OVOA 1LR8A 2N1AB 2JA1A 1X4SA 1R79A 4UXHA 1IY5A 3OXGA 3RU0A 5CCMA 2N17A 1TUSA 2ENNA 1DS2I 1CGII 1TOTA 2N52A 3KY9A 1TBOA 2BUSA 2V53A 5EX3A 3UGDA 2ERWA 1U5KA 5EX0A 2WCYA 1SGPI 2CJSC 1W4RA 3OXFA 1CSOI 1XA6A 1XBTA 2JYYA 1OVOA 5FUVA 1LR9A 3VDUA 4GI3C 3HH2C 1Y8FA 2ORWA 2F3CI 2L8EA 2NU1I 4E1RA 1LR7A 2SGQI 2QQCA 4L9MA 1DS3I 4UXIA 2B8TA 1XX6A 2UZ3A 2ODDA 2DB6A 1W3SA 5FUYA 1HDLA 1FARA 2GKTI 2LEOA 3PDNA 1CT2I 3OL0A 1CT0I 1IY6A 2YUUA 1KBFA 1X74A 3SEKC 1V1IA 1UUCA 1YTPA 2KCXA 1MT1A 2ELIA 1CT4I 3QTLD 4OVOA 1OMTA 1SGRI 3BJIA 1HJAI 3UEJA 4SGBI 1OYVI 2KMQA 1FYBA 2DIPA 5JHWC 1FAQA 2V1CA 1PJUA 2ORVA 1VDDA 2NU4I 3UFFA 2XRCA 3VE5A 2KMPA 1H0ZA 1M8BA 2GKRI 2NU3I 2J9RA 2V1CC 4JCVE 1PPFI 2LUYA 1Z7KB 1V1HA 1YU6C 2SGFI 1BMOA 3B4VC 4E1PA 2JW6A 2NU0I 1KMAA 1TBRR 5HI7A 3D00A 4HGUA 3UGIA 1TIHA 3FC3A 5DAEA 2QQEA 1Y1CA 1R0RI 5HQ8A 1HPTA 3CXLA 2A20A 2ENZA 5FUWA 4UXJA 1SGNI 1NUBA 2KMRA 2QPOA 2VRWB 2J87A 3SGBI 1IW4A 1SGYI 2K9HA 1SGDI 2QQDA 3SGQI 2ARPF 2GKVA 2W0TA 1AN1I 2JXDA 1CE3A 2JZMA 2OVOA 1TBNA 2E73A 1OMUA 1KBEA 2WVJA 2QQ0A 1UVGA 2M5XA 1BUSA 1SGEI 3UEYA 4B6DA 1RFHA 2ROWA 4A24A 2L7XA 1PCEA 1TGSI 1Y1BA 3E2IA 1PTRA 1TURA 2P6AC 1TBQR 5CCLA 3GOXA 2OD1A 4FKDA 1UVFA 1CHOI 2GVIA 2SGDI 1M8CA 2B0UC 5FUXA 1SGQI 3UGLA 3VDPA 3E59A 1PTQA 2SGPI 2E5RA 2N71A 2SGEI 2YQPA 2NU2I 3QWPA 2KMOA 3MEKA 3TJQA 1CGJI 3OXLA 2FNFX 1N13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J9R A;  4L9M A;  1TBN A;  2E73 A;  1KBE A;  2WVJ A;  4UXI A;  2QQ0 A;  2JA1 A;  1R79 A;  2B8T A;  1XX6 A;  2UZ3 A;  3UEY A;  4B6D A;  2DB6 A;  4UXH A;  5FUY A;  1FAR A;  1RFH A;  2ROW A;  2ENN A;  3E2I A;  2YUU A;  1PTR A;  1KBF A;  3KY9 A;  1TBO A;  3UGI A;  3UGD A;  2QQE A;  4FKD A;  2GVI A;  3CXL A;  1W4R A;  2ELI A;  2ENZ A;  5FUW A;  1XA6 A;  3BJI A;  4UXJ A;  1XBT A;  5FUX A;  3UEJ A;  3UGL A;  2VRW B;  5FUV A;  2QPO A;  1PTQ A;  2J87 A;  1FAQ A;  1Y8F A;  2ORW A;  2ORV A;  3UFF A;  2FNF X; 
#chains in the Genus database with same CATH topology
 2Y0M A;  3OVO A;  1LR8 A;  2N1A B;  2JA1 A;  1X4S A;  1R79 A;  4UXH A;  7WGA A;  3OXG A;  3R5D A;  2GIV A;  1IY5 A;  3RU0 A;  5CCM A;  2PQ8 A;  2N17 A;  1TUS A;  2ENN A;  9WGA A;  1DS2 I;  1CGI I;  1K7T A;  1TOT A;  2N52 A;  3KY9 A;  1MJ9 A;  1TBO A;  2BUS A;  2RIJ A;  2V53 A;  2CWG A;  1WKX A;  2CWF A;  5EX3 A;  2ERW A;  1U5K A;  5EX0 A;  3UGD A;  2WCY A;  1SGP I;  2CJS C;  1W4R A;  2DKV A;  3OXF A;  1CSO I;  1XA6 A;  1XBT A;  3QAH A;  2JYY A;  1OVO A;  1UHA A;  1LR9 A;  5FUV A;  3VDU A;  4GI3 C;  3HH2 C;  1Y8F A;  2ORW A;  2F3C I;  2L8E A;  3TO6 A;  2NU1 I;  4E1R A;  1LR7 A;  5J8C A;  2SGQ I;  2QQC A;  3R5B A;  4L9M A;  1DS3 I;  1S20 A;  4UXI A;  3FSX A;  2B8T A;  1XX6 A;  2UZ3 A;  4WP4 A;  5E3P A;  2ODD A;  2DB6 A;  5E3R A;  1W3S A;  5FUY A;  1HDL A;  1FAR A;  2GKT I;  1ULK A;  2LEO A;  1CT2 I;  1WGT A;  3PDN A;  1WTJ A;  1CT0 I;  3OL0 A;  1IY6 A;  2YUU A;  3TOB A;  1KBF A;  1X74 A;  3SEK C;  1V1I A;  1UUC A;  2OU2 A;  3R5A A;  1YTP A;  2KCX A;  5E3Q A;  1MT1 A;  2ELI A;  1CT4 I;  1P9Z A;  3QTL D;  4OVO A;  1OMT A;  1SGR I;  3BJI A;  1HJA I;  1MJB A;  4SGB I;  1OYV I;  2KMQ A;  3UEJ A;  1FYB A;  2DIP A;  5JHW C;  1FAQ A;  2V1C A;  4MPI A;  1PJU A;  2ORV A;  1VDD A;  2NU4 I;  3UFF A;  1FY7 A;  2XRC A;  3VE5 A;  2KMP A;  1WGC A;  1H0Z A;  3FSY A;  1M8B A;  2GKR I;  2NU3 I;  2J9R A;  2V1C C;  4JCV E;  1PPF I;  2LUY A;  1Z7K B;  4DNC A;  1V1H A;  1YU6 C;  2SGF I;  1BMO A;  3B4V C;  4E1P A;  2JW6 A;  2NU0 I;  1KMA A;  1TBR R;  5HI7 A;  3D00 A;  1P9G A;  3TOA A;  3TO7 A;  2X52 A;  4HGU A;  3UGI A;  1TIH A;  2WGC A;  3FC3 A;  3UOE A;  2UVO A;  5DAE A;  1Q9B A;  2QQE A;  1Y1C A;  1R0R I;  5HQ8 A;  1HPT A;  3CXL A;  3TO9 A;  1Z2I A;  2A20 A;  2ENZ A;  5FUW A;  4UXJ A;  1SGN I;  1NUB A;  2KMR A;  2QPO A;  2VRW B;  2J87 A;  3SGB I;  1IW4 A;  1SGY I;  2K9H A;  1SGD I;  2QQD A;  3SGQ I;  2ARP F;  2GKV A;  2W0T A;  1AN1 I;  2JXD A;  1K7U A;  2JZM A;  2OVO A;  1CE3 A;  1ULN A;  1MJA A;  1TBN A;  1OMU A;  1KBE A;  2E73 A;  2WVJ A;  2QQ0 A;  1UVG A;  2M5X A;  1BUS A;  4AML A;  1SGE I;  3UEY A;  4B6D A;  2X3T A;  1HEV A;  1RFH A;  2ROW A;  4A24 A;  2L7X A;  1PCE A;  1TGS I;  1Y1B A;  3E2I A;  1PTR A;  1TUR A;  2P6A C;  1TBQ R;  5J8F A;  5CCL A;  3GOX A;  2OD1 A;  4FKD A;  1UVF A;  1K7V A;  2OZU A;  1CHO I;  2GVI A;  2SGD I;  1M8C A;  2B0U C;  3R5C A;  1NXU A;  5FUX A;  1SGQ I;  3UGL A;  2CWH A;  3VDP A;  3E59 A;  1PTQ A;  2SGP I;  2E5R A;  2N71 A;  2SGE I;  1ULM A;  2RC4 A;  2YQP A;  2NU2 I;  3QWP A;  2KMO A;  3MEK A;  3TJQ A;  1CGJ I;  3OXL A;  2FNF X;  1N13 A;  2LB7 A; 
#chains in the Genus database with same CATH homology
 3OVO A;  1LR8 A;  2N1A B;  2JA1 A;  1X4S A;  1R79 A;  4UXH A;  1IY5 A;  3OXG A;  3RU0 A;  5CCM A;  2N17 A;  1TUS A;  2ENN A;  1DS2 I;  1CGI I;  1TOT A;  2N52 A;  3KY9 A;  1TBO A;  2BUS A;  2V53 A;  5EX3 A;  3UGD A;  2ERW A;  1U5K A;  5EX0 A;  2WCY A;  1SGP I;  2CJS C;  1W4R A;  3OXF A;  1CSO I;  1XA6 A;  1XBT A;  2JYY A;  1OVO A;  5FUV A;  1LR9 A;  3VDU A;  4GI3 C;  3HH2 C;  1Y8F A;  2ORW A;  2F3C I;  2L8E A;  2NU1 I;  4E1R A;  1LR7 A;  2SGQ I;  2QQC A;  4L9M A;  1DS3 I;  4UXI A;  2B8T A;  1XX6 A;  2UZ3 A;  2ODD A;  2DB6 A;  1W3S A;  5FUY A;  1HDL A;  1FAR A;  2GKT I;  2LEO A;  3PDN A;  1CT2 I;  3OL0 A;  1CT0 I;  1IY6 A;  2YUU A;  1KBF A;  1X74 A;  3SEK C;  1V1I A;  1UUC A;  1YTP A;  2KCX A;  1MT1 A;  2ELI A;  1CT4 I;  3QTL D;  4OVO A;  1OMT A;  1SGR I;  3BJI A;  1HJA I;  3UEJ A;  4SGB I;  1OYV I;  2KMQ A;  1FYB A;  2DIP A;  5JHW C;  1FAQ A;  2V1C A;  1PJU A;  2ORV A;  1VDD A;  2NU4 I;  3UFF A;  2XRC A;  3VE5 A;  2KMP A;  1H0Z A;  1M8B A;  2GKR I;  2NU3 I;  2J9R A;  2V1C C;  4JCV E;  1PPF I;  2LUY A;  1Z7K B;  1V1H A;  1YU6 C;  2SGF I;  1BMO A;  3B4V C;  4E1P A;  2JW6 A;  2NU0 I;  1KMA A;  1TBR R;  5HI7 A;  3D00 A;  4HGU A;  3UGI A;  1TIH A;  3FC3 A;  5DAE A;  2QQE A;  1Y1C A;  1R0R I;  5HQ8 A;  1HPT A;  3CXL A;  2A20 A;  2ENZ A;  5FUW A;  4UXJ A;  1SGN I;  1NUB A;  2KMR A;  2QPO A;  2VRW B;  2J87 A;  3SGB I;  1IW4 A;  1SGY I;  2K9H A;  1SGD I;  2QQD A;  3SGQ I;  2ARP F;  2GKV A;  2W0T A;  1AN1 I;  2JXD A;  1CE3 A;  2JZM A;  2OVO A;  1TBN A;  2E73 A;  1OMU A;  1KBE A;  2WVJ A;  2QQ0 A;  1UVG A;  2M5X A;  1BUS A;  1SGE I;  3UEY A;  4B6D A;  1RFH A;  2ROW A;  4A24 A;  2L7X A;  1PCE A;  1TGS I;  1Y1B A;  3E2I A;  1PTR A;  1TUR A;  2P6A C;  1TBQ R;  5CCL A;  3GOX A;  2OD1 A;  4FKD A;  1UVF A;  1CHO I;  2GVI A;  2SGD I;  1M8C A;  2B0U C;  5FUX A;  1SGQ I;  3UGL A;  3VDP A;  3E59 A;  1PTQ A;  2SGP I;  2E5R A;  2N71 A;  2SGE I;  2YQP A;  2NU2 I;  3QWP A;  2KMO A;  3MEK A;  3TJQ A;  1CGJ I;  3OXL A;  2FNF X;  1N13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...