3UGIA

Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase c delta
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
GSRRASVGSHRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Functional Characterization of an Anesthetic Binding Site in the Second Cysteine-Rich Domain of Protein Kinase Cdelta
pubmed doi rcsb
molecule keywords Protein kinase C delta type
molecule tags Metal binding protein
source organism Mus musculus
total genus 11
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3ugiA01
2ELIA 2FNFX 2VRWB 2UZ3A 1FAQA 3E2IA 3UGDA 1PTRA 2ROWA 1XA6A 3BJIA 1TBOA 4UXHA 3UGIA 1PTQA 2QPOA 1XBTA 2B8TA 4UXIA 3UGLA 5FUYA 2QQEA 4B6DA 4L9MA 1Y8FA 1KBEA 2ENZA 2ORVA 2QQ0A 2GVIA 1W4RA 5FUVA 3CXLA 1R79A 1KBFA 2E73A 2WVJA 1TBNA 5FUXA 3UEYA 1FARA 2YUUA 2J87A 3UEJA 1RFHA 2DB6A 3UFFA 2ENNA 2ORWA 3KY9A 4UXJA 2JA1A 2J9RA 4FKDA 5FUWA 1XX6A
chains in the Genus database with same CATH superfamily
2L8EA 1CGJI 1SGRI 2BUSA 2LEOA 1ULMA 2CWHA 2CJSC 1NUBA 2N17A 2N71A 3E2IA 5E3QA 3UGDA 1S20A 2NU4I 3MEKA 3UGIA 1V1HA 2XRCA 1Y1CA 1MJAA 1TUSA 2NU1I 3OL0A 1XBTA 2YQPA 2QQCA 3OXGA 5FUYA 3QTLD 3R5AA 2P6AC 2JXDA 4A24A 5EX0A 1CHOI 5HI7A 1R0RI 4L9MA 1KBEA 1Y8FA 2ENZA 5EX3A 1W4RA 3OVOA 5FUVA 7WGAA 1R79A 3OXFA 4MPIA 2E73A 5J8CA 2SGDI 2YUUA 3HH2C 1YTPA 1MT1A 2E5RA 1RFHA 3UEJA 1CE3A 1SGNI 1HEVA 2N52A 2K9HA 4UXJA 2OD1A 1SGQI 2JA1A 4E1RA 2NU2I 1K7UA 3E59A 1IY5A 2JW6A 1M8BA 1XX6A 1BUSA 2OVOA 1W3SA 2ELIA 2UVOA 9WGAA 2LUYA 2RIJA 5HQ8A 1OMTA 2SGQI 1AN1I 3TJQA 2NU0I 1WGCA 1X4SA 5E3RA 1PCEA 3BJIA 1SGYI 1TGSI 2M5XA 1TBQR 2B0UC 5DAEA 1P9GA 2B8TA 4SGBI 3GOXA 3FSYA 2PQ8A 1MJ9A 4GI3C 1K7TA 2ORVA 1ULNA 2ARPF 3CXLA 1CSOI 2KMRA 3RU0A 1IW4A 2DB6A 2SGPI 1PPFI 3SEKC 1CT2I 3VDPA 2ODDA 3KY9A 3PDNA 2KMQA 1NXUA 1LR7A 3SGQI 3FC3A 2OU2A 4FKDA 1SGPI 2DKVA 2L7XA 5FUWA 1PJUA 1CGII 1YU6C 2UZ3A 2VRWB 2GKTI 1HDLA 1TBRR 1UHAA 1WKXA 1CT4I 1PTRA 3FSXA 1XA6A 2V1CA 1FYBA 2GIVA 2Y0MA 5CCMA 1OMUA 1BMOA 4AMLA 4DNCA 1DS3I 1V1IA 5J8FA 2QQ0A 1U5KA 2GVIA 1Q9BA 4HGUA 1K7VA 1N13A 3VDUA 2W0TA 2V1CC 2SGFI 2WVJA 4WP4A 5E3PA 3TO6A 2JZMA 2KMOA 1H0ZA 3R5BA 2ENNA 2CWGA 1HJAI 1MJBA 2KCXA 2F3CI 2ORWA 1SGDI 3D00A 2J9RA 3OXLA 1SGEI 3SGBI 1TURA 2DIPA 2OZUA 2FNFX 1DS2I 2WCYA 2JYYA 2GKRI 1FAQA 4JCVE 1OYVI 1UVFA 1WGTA 1TBOA 1X74A 2ROWA 2LB7A 1PTQA 2GKVA 2QPOA 2QQDA 2N1AB 2X3TA 3TOBA 4UXIA 3UGLA 2QQEA 2X52A 3TO9A 1VDDA 1WTJA 4B6DA 1OVOA 2WGCA 1KMAA 2V53A 3R5CA 5CCLA 1UUCA 2CWFA 3TO7A 1LR8A 3B4VC 1KBFA 1Y1BA 4UXHA 1TBNA 1FY7A 2NU3I 5FUXA 3UEYA 1FARA 1TOTA 2J87A 4E1PA 5JHWC 2ERWA 1Z2IA 3R5DA 2SGEI 3TOAA 2KMPA 1HPTA 3UFFA 3UOEA 3QAHA 3VE5A 3QWPA 1Z7KB 2A20A 1TIHA 1P9ZA 1M8CA 1IY6A 1UVGA 1LR9A 1ULKA 4OVOA 2RC4A 1CT0I
chains in the Genus database with same CATH topology
2L8EA 1CGJI 1SGRI 2BUSA 2LEOA 2N17A 2CJSC 1NUBA 2N71A 3E2IA 3UGDA 2NU4I 3MEKA 3UGIA 1V1HA 2XRCA 1Y1CA 3OL0A 1TUSA 2NU1I 3OXGA 1XBTA 2YQPA 2QQCA 4UXHA 5FUYA 2P6AC 2JXDA 4A24A 5EX0A 1CHOI 5HI7A 1R0RI 4L9MA 1KBEA 1Y8FA 2ENZA 5EX3A 1W4RA 3OVOA 5FUVA 1R79A 3OXFA 2E73A 2SGDI 2YUUA 3HH2C 1YTPA 1MT1A 2E5RA 1RFHA 3UEJA 1CE3A 1SGNI 2N52A 2K9HA 4UXJA 2OD1A 1SGQI 2JA1A 4E1RA 2NU2I 3E59A 1IY5A 2JW6A 1XX6A 1M8BA 1BUSA 2OVOA 1W3SA 2ELIA 2LUYA 5HQ8A 1OMTA 2SGQI 1AN1I 3TJQA 2NU0I 1X4SA 1PCEA 3BJIA 1SGYI 1TGSI 2M5XA 1TBQR 2B0UC 5DAEA 2B8TA 4SGBI 3GOXA 4GI3C 2ORVA 2ARPF 3CXLA 1CSOI 2KMRA 3RU0A 1IW4A 2DB6A 2SGPI 1PPFI 3SEKC 1CT2I 3VDPA 2ODDA 3KY9A 3PDNA 2KMQA 1LR7A 3SGQI 3FC3A 4FKDA 1SGPI 5FUWA 2L7XA 1PJUA 1CGII 1YU6C 2UZ3A 2VRWB 2GKTI 1HDLA 1TBRR 1CT4I 1PTRA 1XA6A 2V1CA 1FYBA 5CCMA 1OMUA 1BMOA 1DS3I 1V1IA 2QQ0A 1U5KA 2GVIA 4HGUA 3VDUA 1N13A 2W0TA 2V1CC 2SGFI 2WVJA 1H0ZA 2JZMA 2KMOA 2ENNA 2KCXA 1HJAI 2ORWA 3D00A 2F3CI 3OXLA 1SGDI 3QTLD 2J9RA 3SGBI 1SGEI 1TURA 2DIPA 2FNFX 1DS2I 2WCYA 2JYYA 2GKRI 1FAQA 4JCVE 1OYVI 1UVFA 1X74A 1TBOA 2ROWA 1PTQA 2GKVA 2QPOA 2QQDA 2N1AB 4UXIA 3UGLA 2QQEA 1VDDA 4B6DA 1OVOA 1KMAA 2V53A 5CCLA 1UUCA 1LR8A 3B4VC 1KBFA 1Y1BA 1TBNA 2NU3I 5FUXA 3UEYA 4E1PA 1FARA 1TOTA 2J87A 5JHWC 2ERWA 2SGEI 3UFFA 2KMPA 1HPTA 3VE5A 3QWPA 2A20A 1Z7KB 1TIHA 1IY6A 1M8CA 1UVGA 1LR9A 4OVOA 1CT0I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ELI A;  2FNF X;  2VRW B;  2UZ3 A;  1FAQ A;  3E2I A;  3UGD A;  1PTR A;  2ROW A;  1XA6 A;  3BJI A;  1TBO A;  4UXH A;  3UGI A;  1PTQ A;  2QPO A;  1XBT A;  2B8T A;  4UXI A;  3UGL A;  5FUY A;  2QQE A;  4B6D A;  4L9M A;  1Y8F A;  1KBE A;  2ENZ A;  2ORV A;  2QQ0 A;  2GVI A;  1W4R A;  5FUV A;  3CXL A;  1R79 A;  1KBF A;  2E73 A;  2WVJ A;  1TBN A;  5FUX A;  3UEY A;  1FAR A;  2YUU A;  2J87 A;  3UEJ A;  1RFH A;  2DB6 A;  3UFF A;  2ENN A;  2ORW A;  3KY9 A;  4UXJ A;  2JA1 A;  2J9R A;  4FKD A;  5FUW A;  1XX6 A; 
#chains in the Genus database with same CATH topology
 2L8E A;  1CGJ I;  1SGR I;  2BUS A;  2LEO A;  1ULM A;  2CWH A;  2CJS C;  1NUB A;  2N17 A;  2N71 A;  3E2I A;  5E3Q A;  3UGD A;  1S20 A;  2NU4 I;  3MEK A;  3UGI A;  1V1H A;  2XRC A;  1Y1C A;  1MJA A;  1TUS A;  2NU1 I;  3OL0 A;  1XBT A;  2YQP A;  2QQC A;  3OXG A;  5FUY A;  3QTL D;  3R5A A;  2P6A C;  2JXD A;  4A24 A;  5EX0 A;  1CHO I;  5HI7 A;  1R0R I;  4L9M A;  1KBE A;  1Y8F A;  2ENZ A;  5EX3 A;  1W4R A;  3OVO A;  5FUV A;  7WGA A;  1R79 A;  3OXF A;  4MPI A;  2E73 A;  5J8C A;  2SGD I;  2YUU A;  3HH2 C;  1YTP A;  1MT1 A;  2E5R A;  1RFH A;  3UEJ A;  1CE3 A;  1SGN I;  1HEV A;  2N52 A;  2K9H A;  4UXJ A;  2OD1 A;  1SGQ I;  2JA1 A;  4E1R A;  2NU2 I;  1K7U A;  3E59 A;  1IY5 A;  2JW6 A;  1M8B A;  1XX6 A;  1BUS A;  2OVO A;  1W3S A;  2ELI A;  2UVO A;  9WGA A;  2LUY A;  2RIJ A;  5HQ8 A;  1OMT A;  2SGQ I;  1AN1 I;  3TJQ A;  2NU0 I;  1WGC A;  1X4S A;  5E3R A;  1PCE A;  3BJI A;  1SGY I;  1TGS I;  2M5X A;  1TBQ R;  2B0U C;  5DAE A;  1P9G A;  2B8T A;  4SGB I;  3GOX A;  3FSY A;  2PQ8 A;  1MJ9 A;  4GI3 C;  1K7T A;  2ORV A;  1ULN A;  2ARP F;  3CXL A;  1CSO I;  2KMR A;  3RU0 A;  1IW4 A;  2DB6 A;  2SGP I;  1PPF I;  3SEK C;  1CT2 I;  3VDP A;  2ODD A;  3KY9 A;  3PDN A;  2KMQ A;  1NXU A;  1LR7 A;  3SGQ I;  3FC3 A;  2OU2 A;  4FKD A;  1SGP I;  2DKV A;  2L7X A;  5FUW A;  1PJU A;  1CGI I;  1YU6 C;  2UZ3 A;  2VRW B;  2GKT I;  1HDL A;  1TBR R;  1UHA A;  1WKX A;  1CT4 I;  1PTR A;  3FSX A;  1XA6 A;  2V1C A;  1FYB A;  2GIV A;  2Y0M A;  5CCM A;  1OMU A;  1BMO A;  4AML A;  4DNC A;  1DS3 I;  1V1I A;  5J8F A;  2QQ0 A;  1U5K A;  2GVI A;  1Q9B A;  4HGU A;  1K7V A;  1N13 A;  3VDU A;  2W0T A;  2V1C C;  2SGF I;  2WVJ A;  4WP4 A;  5E3P A;  3TO6 A;  2JZM A;  2KMO A;  1H0Z A;  3R5B A;  2ENN A;  2CWG A;  1HJA I;  1MJB A;  2KCX A;  2F3C I;  2ORW A;  1SGD I;  3D00 A;  2J9R A;  3OXL A;  1SGE I;  3SGB I;  1TUR A;  2DIP A;  2OZU A;  2FNF X;  1DS2 I;  2WCY A;  2JYY A;  2GKR I;  1FAQ A;  4JCV E;  1OYV I;  1UVF A;  1WGT A;  1TBO A;  1X74 A;  2ROW A;  2LB7 A;  1PTQ A;  2GKV A;  2QPO A;  2QQD A;  2N1A B;  2X3T A;  3TOB A;  4UXI A;  3UGL A;  2QQE A;  2X52 A;  3TO9 A;  1VDD A;  1WTJ A;  4B6D A;  1OVO A;  2WGC A;  1KMA A;  2V53 A;  3R5C A;  5CCL A;  1UUC A;  2CWF A;  3TO7 A;  1LR8 A;  3B4V C;  1KBF A;  1Y1B A;  4UXH A;  1TBN A;  1FY7 A;  2NU3 I;  5FUX A;  3UEY A;  1FAR A;  1TOT A;  2J87 A;  4E1P A;  5JHW C;  2ERW A;  1Z2I A;  3R5D A;  2SGE I;  3TOA A;  2KMP A;  1HPT A;  3UFF A;  3UOE A;  3QAH A;  3VE5 A;  3QWP A;  1Z7K B;  2A20 A;  1TIH A;  1P9Z A;  1M8C A;  1IY6 A;  1UVG A;  1LR9 A;  1ULK A;  4OVO A;  2RC4 A;  1CT0 I; 
#chains in the Genus database with same CATH homology
 2L8E A;  1CGJ I;  1SGR I;  2BUS A;  2LEO A;  2N17 A;  2CJS C;  1NUB A;  2N71 A;  3E2I A;  3UGD A;  2NU4 I;  3MEK A;  3UGI A;  1V1H A;  2XRC A;  1Y1C A;  3OL0 A;  1TUS A;  2NU1 I;  3OXG A;  1XBT A;  2YQP A;  2QQC A;  4UXH A;  5FUY A;  2P6A C;  2JXD A;  4A24 A;  5EX0 A;  1CHO I;  5HI7 A;  1R0R I;  4L9M A;  1KBE A;  1Y8F A;  2ENZ A;  5EX3 A;  1W4R A;  3OVO A;  5FUV A;  1R79 A;  3OXF A;  2E73 A;  2SGD I;  2YUU A;  3HH2 C;  1YTP A;  1MT1 A;  2E5R A;  1RFH A;  3UEJ A;  1CE3 A;  1SGN I;  2N52 A;  2K9H A;  4UXJ A;  2OD1 A;  1SGQ I;  2JA1 A;  4E1R A;  2NU2 I;  3E59 A;  1IY5 A;  2JW6 A;  1XX6 A;  1M8B A;  1BUS A;  2OVO A;  1W3S A;  2ELI A;  2LUY A;  5HQ8 A;  1OMT A;  2SGQ I;  1AN1 I;  3TJQ A;  2NU0 I;  1X4S A;  1PCE A;  3BJI A;  1SGY I;  1TGS I;  2M5X A;  1TBQ R;  2B0U C;  5DAE A;  2B8T A;  4SGB I;  3GOX A;  4GI3 C;  2ORV A;  2ARP F;  3CXL A;  1CSO I;  2KMR A;  3RU0 A;  1IW4 A;  2DB6 A;  2SGP I;  1PPF I;  3SEK C;  1CT2 I;  3VDP A;  2ODD A;  3KY9 A;  3PDN A;  2KMQ A;  1LR7 A;  3SGQ I;  3FC3 A;  4FKD A;  1SGP I;  5FUW A;  2L7X A;  1PJU A;  1CGI I;  1YU6 C;  2UZ3 A;  2VRW B;  2GKT I;  1HDL A;  1TBR R;  1CT4 I;  1PTR A;  1XA6 A;  2V1C A;  1FYB A;  5CCM A;  1OMU A;  1BMO A;  1DS3 I;  1V1I A;  2QQ0 A;  1U5K A;  2GVI A;  4HGU A;  3VDU A;  1N13 A;  2W0T A;  2V1C C;  2SGF I;  2WVJ A;  1H0Z A;  2JZM A;  2KMO A;  2ENN A;  2KCX A;  1HJA I;  2ORW A;  3D00 A;  2F3C I;  3OXL A;  1SGD I;  3QTL D;  2J9R A;  3SGB I;  1SGE I;  1TUR A;  2DIP A;  2FNF X;  1DS2 I;  2WCY A;  2JYY A;  2GKR I;  1FAQ A;  4JCV E;  1OYV I;  1UVF A;  1X74 A;  1TBO A;  2ROW A;  1PTQ A;  2GKV A;  2QPO A;  2QQD A;  2N1A B;  4UXI A;  3UGL A;  2QQE A;  1VDD A;  4B6D A;  1OVO A;  1KMA A;  2V53 A;  5CCL A;  1UUC A;  1LR8 A;  3B4V C;  1KBF A;  1Y1B A;  1TBN A;  2NU3 I;  5FUX A;  3UEY A;  4E1P A;  1FAR A;  1TOT A;  2J87 A;  5JHW C;  2ERW A;  2SGE I;  3UFF A;  2KMP A;  1HPT A;  3VE5 A;  3QWP A;  2A20 A;  1Z7K B;  1TIH A;  1IY6 A;  1M8C A;  1UVG A;  1LR9 A;  4OVO A;  1CT0 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...