4B6DA

Structure of the atypical c1 domain of mgcracgap
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
60
structure length
60
Chain Sequence
GPLGSMRLHDFVSKTVIKPESCVPCGKRIKFGKLSLKCRDCRVVSHPECRDRCPLPCIPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Centralspindlin Links the Mitotic Spindle to the Plasma Membrane During Cytokinesis.
pubmed doi rcsb
molecule keywords RAC GTPASE-ACTIVATING PROTEIN 1
molecule tags Signaling protein
source organism Homo sapiens
total genus 10
structure length 60
sequence length 60
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4b6dA00
2ORVA 4FKDA 2ROWA 2QPOA 1KBFA 1KBEA 2UZ3A 5FUVA 4UXJA 3UGDA 4UXIA 2ENNA 1RFHA 1R79A 1TBNA 2J9RA 1FAQA 3KY9A 1XX6A 1Y8FA 1FARA 2ORWA 4L9MA 2ELIA 2J87A 2QQEA 3UFFA 3BJIA 2GVIA 5FUXA 4UXHA 1PTQA 2YUUA 1PTRA 3UGIA 1TBOA 3UGLA 2FNFX 4B6DA 1W4RA 2DB6A 2QQ0A 2VRWB 3E2IA 5FUWA 2E73A 1XBTA 2JA1A 3CXLA 3UEJA 1XA6A 3UEYA 2WVJA 2ENZA 5FUYA 2B8TA
chains in the Genus database with same CATH superfamily
1UHAA 1CSOI 1LR7A 2P6AC 2RC4A 2F3CI 3FSYA 3TO7A 5HQ8A 1KBEA 1K7VA 2QQDA 2RIJA 2KCXA 4UXJA 3UGDA 1TIHA 5E3RA 9WGAA 2CWFA 3MEKA 5HI7A 2J9RA 4SGBI 5JHWC 1XX6A 4E1RA 1NXUA 2N52A 4GI3C 3HH2C 1TBRR 2SGQI 2UVOA 1SGRI 1OVOA 2PQ8A 3GOXA 3B4VC 2YUUA 1PTRA 2V1CA 3OXGA 1IY5A 3UGLA 1UUCA 1SGDI 2DKVA 1W4RA 3R5AA 1WKXA 4B6DA 1ULKA 2N1AB 2V53A 2NU1I 2KMRA 2VRWB 5DAEA 3QAHA 1HPTA 2ARPF 3R5CA 3OL0A 1KMAA 7WGAA 1BMOA 2SGPI 2CWGA 1ULNA 3UEYA 3VDPA 3QWPA 2WVJA 3E59A 5EX3A 5FUYA 4A24A 4E1PA 3SGBI 4FKDA 2X3TA 3QTLD 5J8CA 2B0UC 2QPOA 3OXLA 2CWHA 2X52A 1Z7KB 1Q9BA 5E3PA 2ENNA 2ODDA 2JW6A 2WCYA 1HJAI 1FAQA 1LR8A 1P9ZA 3KY9A 1IW4A 1FARA 1BUSA 4L9MA 2QQEA 1TOTA 2LB7A 1X74A 3BJIA 1M8BA 3UFFA 3VDUA 1P9GA 1H0ZA 1OMUA 3PDNA 4UXHA 5CCLA 3OVOA 1YU6C 1TBOA 1SGEI 1PPFI 5E3QA 2GIVA 2L7XA 2N71A 3VE5A 2KMQA 2SGFI 1FY7A 3E2IA 1HEVA 2E73A 2A20A 1OMTA 2JA1A 3CXLA 5CCMA 1UVGA 2V1CC 4AMLA 1TURA 2ENZA 4WP4A 1IY6A 2B8TA 1LR9A 1Y1CA 1X4SA 2ROWA 2SGDI 4HGUA 4DNCA 2K9HA 1K7TA 2M5XA 5FUVA 1CT0I 1FYBA 4UXIA 1Z2IA 3R5DA 1R79A 3TOAA 1MJ9A 1CT2I 3R5BA 1PJUA 1S20A 1VDDA 1UVFA 3SEKC 2JZMA 2J87A 4OVOA 3TO9A 3UOEA 2NU0I 1V1HA 2GKRI 4MPIA 1TGSI 2W0TA 1DS2I 5FUXA 3TJQA 2CJSC 1PTQA 1W3SA 3OXFA 2E5RA 1AN1I 1DS3I 2FNFX 2KMOA 2NU2I 3FC3A 2KMPA 1MT1A 2GKVA 1SGYI 3TOBA 1ULMA 3TO6A 1OYVI 1MJBA 2L8EA 1M8CA 3UEJA 1MJAA 1R0RI 2NU3I 1NUBA 2GKTI 2OVOA 1HDLA 1KBFA 2DIPA 5EX0A 2ORVA 1Y1BA 2LUYA 2WGCA 2SGEI 3FSXA 2UZ3A 1CT4I 1RFHA 1TBNA 2OD1A 2YQPA 4JCVE 1CHOI 1Y8FA 2QQCA 2ORWA 1V1IA 1WGTA 2ELIA 1PCEA 1U5KA 2ERWA 1N13A 1SGQI 2LEOA 3RU0A 1TBQR 2GVIA 3D00A 1TUSA 5J8FA 2XRCA 2BUSA 3UGIA 2OZUA 2OU2A 1WGCA 1K7UA 2JXDA 1CE3A 1CGJI 2DB6A 3SGQI 1YTPA 2QQ0A 5FUWA 1XBTA 2N17A 2Y0MA 1CGII 1XA6A 1WTJA 2JYYA 2NU4I 1SGPI 1SGNI
chains in the Genus database with same CATH topology
1CSOI 1LR7A 2P6AC 2F3CI 5HQ8A 1KBEA 2QQDA 2KCXA 4UXJA 3UGDA 1TIHA 5HI7A 3MEKA 5JHWC 2J9RA 4SGBI 1XX6A 4E1RA 2N52A 4GI3C 3HH2C 1TBRR 2SGQI 3GOXA 1SGRI 1OVOA 3B4VC 2YUUA 1PTRA 2V1CA 3OXGA 1IY5A 3UGLA 1UUCA 1SGDI 4B6DA 1W4RA 2N1AB 2V53A 2NU1I 2KMRA 2VRWB 5DAEA 1HPTA 2ARPF 1KMAA 3OL0A 1BMOA 2SGPI 3VDPA 3UEYA 3QWPA 2WVJA 3E59A 5EX3A 5FUYA 4A24A 4E1PA 3SGBI 4FKDA 3QTLD 2B0UC 2QPOA 3OXLA 1Z7KB 2ENNA 2ODDA 2JW6A 2WCYA 1HJAI 1FAQA 1LR8A 3KY9A 1IW4A 1FARA 1BUSA 4L9MA 2QQEA 1TOTA 3UFFA 1X74A 3BJIA 1M8BA 3VDUA 1H0ZA 1OMUA 3PDNA 4UXHA 5CCLA 3OVOA 1YU6C 1TBOA 1SGEI 1PPFI 2L7XA 2N71A 3VE5A 2KMQA 2SGFI 3E2IA 2E73A 2A20A 1OMTA 2JA1A 3CXLA 5CCMA 1UVGA 2V1CC 1TURA 2ENZA 1IY6A 2B8TA 1Y1CA 1LR9A 1X4SA 2ROWA 2SGDI 4HGUA 2K9HA 2M5XA 5FUVA 1CT0I 1FYBA 4UXIA 1R79A 1CT2I 1PJUA 1VDDA 1UVFA 3SEKC 2JZMA 2J87A 4OVOA 2NU0I 1V1HA 2GKRI 1TGSI 2W0TA 1DS2I 5FUXA 3TJQA 2CJSC 1PTQA 1W3SA 3OXFA 2E5RA 1AN1I 1DS3I 2FNFX 2KMOA 2NU2I 3FC3A 2KMPA 1MT1A 2GKVA 1SGYI 1OYVI 2L8EA 1M8CA 3UEJA 1R0RI 2NU3I 1NUBA 2GKTI 2OVOA 1HDLA 1KBFA 2DIPA 5EX0A 2ORVA 1Y1BA 2LUYA 2SGEI 2UZ3A 1CT4I 1RFHA 1TBNA 2OD1A 2YQPA 4JCVE 1CHOI 1Y8FA 2QQCA 2ORWA 1V1IA 2ELIA 1PCEA 1U5KA 2ERWA 1N13A 1SGQI 2LEOA 3RU0A 1TBQR 2GVIA 3D00A 1TUSA 2XRCA 2BUSA 3UGIA 1CE3A 2JXDA 1CGJI 2DB6A 3SGQI 1YTPA 2QQ0A 5FUWA 1XBTA 2N17A 1CGII 1XA6A 2JYYA 2NU4I 1SGPI 1SGNI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ORV A;  4FKD A;  2ROW A;  2QPO A;  1KBF A;  1KBE A;  2UZ3 A;  5FUV A;  4UXJ A;  3UGD A;  4UXI A;  2ENN A;  1RFH A;  1R79 A;  1TBN A;  2J9R A;  1FAQ A;  3KY9 A;  1XX6 A;  1Y8F A;  1FAR A;  2ORW A;  4L9M A;  2ELI A;  2J87 A;  2QQE A;  3UFF A;  3BJI A;  2GVI A;  5FUX A;  4UXH A;  1PTQ A;  2YUU A;  1PTR A;  3UGI A;  1TBO A;  3UGL A;  2FNF X;  4B6D A;  1W4R A;  2DB6 A;  2QQ0 A;  2VRW B;  3E2I A;  5FUW A;  2E73 A;  1XBT A;  2JA1 A;  3CXL A;  3UEJ A;  1XA6 A;  3UEY A;  2WVJ A;  2ENZ A;  5FUY A;  2B8T A; 
#chains in the Genus database with same CATH topology
 1UHA A;  1CSO I;  1LR7 A;  2P6A C;  2RC4 A;  2F3C I;  3FSY A;  3TO7 A;  5HQ8 A;  1KBE A;  1K7V A;  2QQD A;  2RIJ A;  2KCX A;  4UXJ A;  3UGD A;  1TIH A;  5E3R A;  9WGA A;  2CWF A;  3MEK A;  5HI7 A;  2J9R A;  4SGB I;  5JHW C;  1XX6 A;  4E1R A;  1NXU A;  2N52 A;  4GI3 C;  3HH2 C;  1TBR R;  2SGQ I;  2UVO A;  1SGR I;  1OVO A;  2PQ8 A;  3GOX A;  3B4V C;  2YUU A;  1PTR A;  2V1C A;  3OXG A;  1IY5 A;  3UGL A;  1UUC A;  1SGD I;  2DKV A;  1W4R A;  3R5A A;  1WKX A;  4B6D A;  1ULK A;  2N1A B;  2V53 A;  2NU1 I;  2KMR A;  2VRW B;  5DAE A;  3QAH A;  1HPT A;  2ARP F;  3R5C A;  3OL0 A;  1KMA A;  7WGA A;  1BMO A;  2SGP I;  2CWG A;  1ULN A;  3UEY A;  3VDP A;  3QWP A;  2WVJ A;  3E59 A;  5EX3 A;  5FUY A;  4A24 A;  4E1P A;  3SGB I;  4FKD A;  2X3T A;  3QTL D;  5J8C A;  2B0U C;  2QPO A;  3OXL A;  2CWH A;  2X52 A;  1Z7K B;  1Q9B A;  5E3P A;  2ENN A;  2ODD A;  2JW6 A;  2WCY A;  1HJA I;  1FAQ A;  1LR8 A;  1P9Z A;  3KY9 A;  1IW4 A;  1FAR A;  1BUS A;  4L9M A;  2QQE A;  1TOT A;  2LB7 A;  1X74 A;  3BJI A;  1M8B A;  3UFF A;  3VDU A;  1P9G A;  1H0Z A;  1OMU A;  3PDN A;  4UXH A;  5CCL A;  3OVO A;  1YU6 C;  1TBO A;  1SGE I;  1PPF I;  5E3Q A;  2GIV A;  2L7X A;  2N71 A;  3VE5 A;  2KMQ A;  2SGF I;  1FY7 A;  3E2I A;  1HEV A;  2E73 A;  2A20 A;  1OMT A;  2JA1 A;  3CXL A;  5CCM A;  1UVG A;  2V1C C;  4AML A;  1TUR A;  2ENZ A;  4WP4 A;  1IY6 A;  2B8T A;  1LR9 A;  1Y1C A;  1X4S A;  2ROW A;  2SGD I;  4HGU A;  4DNC A;  2K9H A;  1K7T A;  2M5X A;  5FUV A;  1CT0 I;  1FYB A;  4UXI A;  1Z2I A;  3R5D A;  1R79 A;  3TOA A;  1MJ9 A;  1CT2 I;  3R5B A;  1PJU A;  1S20 A;  1VDD A;  1UVF A;  3SEK C;  2JZM A;  2J87 A;  4OVO A;  3TO9 A;  3UOE A;  2NU0 I;  1V1H A;  2GKR I;  4MPI A;  1TGS I;  2W0T A;  1DS2 I;  5FUX A;  3TJQ A;  2CJS C;  1PTQ A;  1W3S A;  3OXF A;  2E5R A;  1AN1 I;  1DS3 I;  2FNF X;  2KMO A;  2NU2 I;  3FC3 A;  2KMP A;  1MT1 A;  2GKV A;  1SGY I;  3TOB A;  1ULM A;  3TO6 A;  1OYV I;  1MJB A;  2L8E A;  1M8C A;  3UEJ A;  1MJA A;  1R0R I;  2NU3 I;  1NUB A;  2GKT I;  2OVO A;  1HDL A;  1KBF A;  2DIP A;  5EX0 A;  2ORV A;  1Y1B A;  2LUY A;  2WGC A;  2SGE I;  3FSX A;  2UZ3 A;  1CT4 I;  1RFH A;  1TBN A;  2OD1 A;  2YQP A;  4JCV E;  1CHO I;  1Y8F A;  2QQC A;  2ORW A;  1V1I A;  1WGT A;  2ELI A;  1PCE A;  1U5K A;  2ERW A;  1N13 A;  1SGQ I;  2LEO A;  3RU0 A;  1TBQ R;  2GVI A;  3D00 A;  1TUS A;  5J8F A;  2XRC A;  2BUS A;  3UGI A;  2OZU A;  2OU2 A;  1WGC A;  1K7U A;  2JXD A;  1CE3 A;  1CGJ I;  2DB6 A;  3SGQ I;  1YTP A;  2QQ0 A;  5FUW A;  1XBT A;  2N17 A;  2Y0M A;  1CGI I;  1XA6 A;  1WTJ A;  2JYY A;  2NU4 I;  1SGP I;  1SGN I; 
#chains in the Genus database with same CATH homology
 1CSO I;  1LR7 A;  2P6A C;  2F3C I;  5HQ8 A;  1KBE A;  2QQD A;  2KCX A;  4UXJ A;  3UGD A;  1TIH A;  5HI7 A;  3MEK A;  5JHW C;  2J9R A;  4SGB I;  1XX6 A;  4E1R A;  2N52 A;  4GI3 C;  3HH2 C;  1TBR R;  2SGQ I;  3GOX A;  1SGR I;  1OVO A;  3B4V C;  2YUU A;  1PTR A;  2V1C A;  3OXG A;  1IY5 A;  3UGL A;  1UUC A;  1SGD I;  4B6D A;  1W4R A;  2N1A B;  2V53 A;  2NU1 I;  2KMR A;  2VRW B;  5DAE A;  1HPT A;  2ARP F;  1KMA A;  3OL0 A;  1BMO A;  2SGP I;  3VDP A;  3UEY A;  3QWP A;  2WVJ A;  3E59 A;  5EX3 A;  5FUY A;  4A24 A;  4E1P A;  3SGB I;  4FKD A;  3QTL D;  2B0U C;  2QPO A;  3OXL A;  1Z7K B;  2ENN A;  2ODD A;  2JW6 A;  2WCY A;  1HJA I;  1FAQ A;  1LR8 A;  3KY9 A;  1IW4 A;  1FAR A;  1BUS A;  4L9M A;  2QQE A;  1TOT A;  3UFF A;  1X74 A;  3BJI A;  1M8B A;  3VDU A;  1H0Z A;  1OMU A;  3PDN A;  4UXH A;  5CCL A;  3OVO A;  1YU6 C;  1TBO A;  1SGE I;  1PPF I;  2L7X A;  2N71 A;  3VE5 A;  2KMQ A;  2SGF I;  3E2I A;  2E73 A;  2A20 A;  1OMT A;  2JA1 A;  3CXL A;  5CCM A;  1UVG A;  2V1C C;  1TUR A;  2ENZ A;  1IY6 A;  2B8T A;  1Y1C A;  1LR9 A;  1X4S A;  2ROW A;  2SGD I;  4HGU A;  2K9H A;  2M5X A;  5FUV A;  1CT0 I;  1FYB A;  4UXI A;  1R79 A;  1CT2 I;  1PJU A;  1VDD A;  1UVF A;  3SEK C;  2JZM A;  2J87 A;  4OVO A;  2NU0 I;  1V1H A;  2GKR I;  1TGS I;  2W0T A;  1DS2 I;  5FUX A;  3TJQ A;  2CJS C;  1PTQ A;  1W3S A;  3OXF A;  2E5R A;  1AN1 I;  1DS3 I;  2FNF X;  2KMO A;  2NU2 I;  3FC3 A;  2KMP A;  1MT1 A;  2GKV A;  1SGY I;  1OYV I;  2L8E A;  1M8C A;  3UEJ A;  1R0R I;  2NU3 I;  1NUB A;  2GKT I;  2OVO A;  1HDL A;  1KBF A;  2DIP A;  5EX0 A;  2ORV A;  1Y1B A;  2LUY A;  2SGE I;  2UZ3 A;  1CT4 I;  1RFH A;  1TBN A;  2OD1 A;  2YQP A;  4JCV E;  1CHO I;  1Y8F A;  2QQC A;  2ORW A;  1V1I A;  2ELI A;  1PCE A;  1U5K A;  2ERW A;  1N13 A;  1SGQ I;  2LEO A;  3RU0 A;  1TBQ R;  2GVI A;  3D00 A;  1TUS A;  2XRC A;  2BUS A;  3UGI A;  1CE3 A;  2JXD A;  1CGJ I;  2DB6 A;  3SGQ I;  1YTP A;  2QQ0 A;  5FUW A;  1XBT A;  2N17 A;  1CGI I;  1XA6 A;  2JYY A;  2NU4 I;  1SGP I;  1SGN I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...