1FUGA

S-adenosylmethionine synthetase
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
Knots found
sequence length
383
structure length
383
Chain Sequence
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Flexible loop in the structure of S-adenosylmethionine synthetase crystallized in the tetragonal modification.
pubmed rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords S-ADENOSYLMETHIONINE SYNTHETASE
total genus 90
structure length 383
sequence length 383
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 1996-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1fugA03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1fugA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1fugA01
4ODJA 5A19A 1XRAA 4KTVA 2YWCA 3RV2A 2YWBA 1QM4A 1O93A 3A4IA 2DPLA 4L4QA 2OBVA 4K0BA 5T8SA 5T8TA 1FUGA 1P7LA 5H9UA 4NDNA 1O9TA 5A1GA 3TDEA 1XRBA 3UOWA 1GPMA 1MXBA 1MXCA 3TQIA 1XRCA 4WS9A 5A1IA 2P02A 1RG9A 4L2ZA 3S82A 4HPVA 3SO4A 1MXAA 3IMLA 4LE5A 4KTTA 1O90A 4L7IA 1O92A
chains in the Genus database with same CATH superfamily
2JNVA 5BUQA 1USPA 4RM2A 4X65C 5H9UA 4DG9A 1XMOC 1M6XC 4WV3A 5FLXD 2WP0C 3IEVA 4AQYC 4D57A 4LF6C 3UEBA 2D7VA 4I9FA 1PU1A 3IMLA 1FJGC 3H2TA 4BCAA 4LFCC 4DG8A 3RV2A 4FUQA 4G36A 5T8TA 2PN2A 1O9TA 3FCEA 2Z51A 2E5LC 1I94C 1USPB 1WCJA 5IWAC 3UX3A 3CJEA 3B7WA 3DHVA 3NPDA 4LE5A 1PG4A 3OTOC 1XRAA 4G1IA 1LCIA 2Y4OA 4DV6C 4DCTA 2CXCA 2NCLA 3AY0A 1P7LA 2MMAB 2P2FA 4RMNA 1N34C 1MXBA 1UKKA 4MTNA 2P2QA 4WS9A 3PROC 2UUCC 4DCUA 2OO4A 2AYAA 4G37A 2ATWA 1LQLA 3K6RA 4JI7C 2OPLA 4BC9A 1VEHA 2D1RA 1MDFA 3EQ6A 1NY8A 5BSTA 1N32C 4EATA 1IBMC 4B3MC 1AMUA 4YY3C 2D1QA 4PUIA 1NYEA 1T5HX 3R9XA 5BSVA 2Y4NA 3IPLA 2UXDC 4DR2C 1V25A 5AE2A 4D4GA 4X62C 3A4IA 4X66C 4K0BA 5T8SA 4ISBA 2UUBC 3JAMD 5JRHA 2VQEC 1MD9A 3LNOA 2MCQA 4NXNC 4ZLPA 1ZB8A 2OPLB 2QVYX 2KZFA 2D28C 2ZZMA 4DV0C 2JMPA 4DV7C 1MXAA 1MKYA 4PUHA 4U5YD 3CQ1A 3KXWA 4OYCA 4XX2A 2DPLA 2E8CA 5K85A 3UZ0A 3IEUA 4DV3C 4LF5C 2E7GA 3TQIA 3PESA 3N2QA 1KKGA 4R1MA 1O90A 4L7IA 3GR0A 2CU6A 1P4EC 3J81D 2KZ0A 2M5OA 4LF9C 2CY1A 4B3RC 2ASBA 1HR0C 1XRBA 3A9UA 2VZEA 2WD9A 1EGAA 2D1SA 4LF8C 4DUYC 4DV5C 5A1IA 3T1HC 4JM1A 2ZM6C 2QVXX 4RVNA 4KTVA 2VSQA 4ZJZA 2DHMA 4DV4C 3GR1A 1M6XA 2HJGA 4LF4C 2UU9C 3O2EA 3G7SA 4DR3C 4JI3C 1HNXC 1V60A 5BSUA 4YHHC 4DR5C 3UOWA 3VNQA 2HHHC 4DV1C 4JYAC 1P4EA 3E7WA 3S82A 2M5HA 4DR7C 3AF5A 4NOZA 4KTTA 2BJOA 3R9WA 1QWIA 3NYRA 1IBKC 4LF7C 1HH2P 4RLFA 4D56A 2BH1X 1HNZC 4JV5C 5BSRA 5A1GA 3TDEA 3CW8X 3L8CA 4GKKC 1IBLC 3A25A 1GPMA 4FUTA 2P2BA 1HNWC 4B3SC 1XRCA 2Y27A 1N2FA 2ZZNA 4HPVA 1RY2A 1L2FA 3FCCA 4OXIA 4IZ6A 3CQ3A 2UXBC 5LMNC 3RG2A 2QVZX 1QM4A 1O93A 4JI0C 3C5EA 3L95X 1FUGA 1XMQC 3EERA 4JI8C 1PG3A 3DAYA 3CQ2A 1YJ7A 1MXCA 2MM9A 3A26A 4PUGA 5E7QA 2VQFC 2D27A 1V26A 1JOSA 5KYTA 4JI2C 1N33C 1XNQC 5KEIA 2F4VC 4KHPC 2OBVA 1XS3A 2KDNA 1ULTA 5IT9D 4NDNA 3TUFA 4LFAC 4PROC 4BC7A 3ETCA 4I9GA 2P20A 1VLAA 4IR7A 4GS5A 2XR1A 1O92A 3NYQA 5ADZA 4ODJA 1PA4A 5A19A 4JI6C 2YWBA 1UWDA 5AE1A 4L4QA 2QW0X 1MDBA 4DR1C 3GKUA 3CW9A 3TR3A 4GXRA 3I08A 4L2ZA 4DCVA 3R44A 3GPCA 2E0GA 2YWCA 1K0RA 4DUZC 1XNRC 2ONFA 4K0KC 5KYVA 5GTDA 5BUSA 4R0MA 5CZXA 2EGTA 5AE3A 3I07A 4FTFA 4X64C 4JI5C 5K8FA 5LCIA 3LAXA 4NXMC 4LFBC 2PT7G 2E8EA 4GKJC 5IFIA 5DV9A 1N36C 3NI2A 3LNVA 5CZVA 5BR8C 3ETOA 2V7BA 2D1TA 4RLQA 4B3TC 3N54B 4DCSA 4PHTA 1IB8A 4JI4C 3DLPX 2P2MA 3VNRA 4BSZA 4OX9C 4PZPA 1WF3A 3A9VA 3E7XA 4GXQA 5BSMA 2PROA 1T5DX 4JI1C 5LMUC 3PBKA 4BBYA 2P02A 5BSWA 1TH5A 3SO4A 2QL8A 5BURA 1FLOA 4DV2C 4D4IA 1XHJA 4RVOA 3VNSA 4DR4C 4R1LA 2P2JA 3AF6A 2DYJA 2UXCC 3UX2A 4MH4A 5A2QD 3LGXA 2YX1A 4DR6C 3LUSA 1ML8A 2E8FA 1BA3A 3T1YC 2UUAC 1J5EC 1WH9A 1RG9A 4TPSB 3J80D 4RM3A 1ZB9A 2YCBA
chains in the Genus database with same CATH topology
5BUQA 1USPA 4RM2A 4X65C 5H9UA 4DG9A 1XMOC 4WV3A 5FLXD 2WP0C 3IEVA 4AQYC 4D57A 4LF6C 2D7VA 4I9FA 3IMLA 1FJGC 3H2TA 4BCAA 4LFCC 4DG8A 3RV2A 4FUQA 4G36A 5T8TA 2PN2A 1O9TA 3FCEA 2E5LC 1I94C 1USPB 5IWAC 3CJEA 3B7WA 3DHVA 3NPDA 4LE5A 1PG4A 3OTOC 1XRAA 4G1IA 1LCIA 2Y4OA 4DV6C 4DCTA 2CXCA 1P7LA 2P2FA 4RMNA 1N34C 1MXBA 1UKKA 4MTNA 2UUCC 2P2QA 4WS9A 3PROC 4DCUA 2OO4A 2AYAA 4G37A 2ATWA 1LQLA 4JI7C 2OPLA 4BC9A 2D1RA 1MDFA 3EQ6A 5BSTA 1N32C 4EATA 1IBMC 4B3MC 1AMUA 4YY3C 2D1QA 1NYEA 1T5HX 3R9XA 5BSVA 2Y4NA 3IPLA 2UXDC 4DR2C 1V25A 5AE2A 4D4GA 4X62C 3A4IA 4X66C 4K0BA 5T8SA 4ISBA 2UUBC 3JAMD 5JRHA 2VQEC 1MD9A 4NXNC 4ZLPA 1ZB8A 2OPLB 2QVYX 2KZFA 2D28C 4DV0C 2JMPA 4DV7C 1MXAA 1MKYA 4U5YD 3KXWA 4OYCA 4XX2A 2DPLA 2E8CA 5K85A 3UZ0A 3IEUA 4DV3C 4LF5C 2E7GA 3TQIA 3PESA 3N2QA 1KKGA 4R1MA 1O90A 4L7IA 3GR0A 3J81D 4LF9C 2CY1A 4B3RC 2ASBA 1HR0C 1XRBA 3A9UA 2VZEA 2WD9A 1EGAA 2D1SA 4LF8C 4DUYC 4DV5C 5A1IA 3T1HC 4JM1A 2QVXX 2ZM6C 4RVNA 4KTVA 2VSQA 4ZJZA 4DV4C 3GR1A 2HJGA 4LF4C 2UU9C 3G7SA 4DR3C 4JI3C 1HNXC 4YHHC 5BSUA 4DR5C 3UOWA 3VNQA 2HHHC 4DV1C 4JYAC 3E7WA 3S82A 4DR7C 3AF5A 4NOZA 4KTTA 2BJOA 3R9WA 1QWIA 3NYRA 1IBKC 4LF7C 1HH2P 4RLFA 4D56A 2BH1X 1HNZC 4JV5C 5BSRA 5A1GA 3TDEA 3CW8X 3L8CA 4GKKC 1IBLC 1GPMA 4FUTA 2P2BA 1HNWC 4B3SC 1XRCA 2Y27A 1N2FA 4HPVA 1RY2A 1L2FA 3FCCA 4OXIA 4IZ6A 2UXBC 5LMNC 3RG2A 2QVZX 1QM4A 1O93A 4JI0C 3C5EA 3L95X 1FUGA 1XMQC 3EERA 4JI8C 1PG3A 3DAYA 1YJ7A 1MXCA 5E7QA 2VQFC 2D27A 1V26A 1JOSA 5KYTA 4JI2C 1N33C 1XNQC 5KEIA 2F4VC 4KHPC 2OBVA 1ULTA 5IT9D 4NDNA 3TUFA 4LFAC 4PROC 4BC7A 3ETCA 4I9GA 2P20A 1VLAA 4IR7A 4GS5A 2XR1A 1O92A 3NYQA 5ADZA 4ODJA 1PA4A 5A19A 4JI6C 2YWBA 5AE1A 4L4QA 2QW0X 1MDBA 4DR1C 3GKUA 3CW9A 4GXRA 3I08A 4L2ZA 4DCVA 3R44A 3GPCA 2E0GA 2YWCA 1K0RA 4DUZC 1XNRC 2ONFA 4K0KC 5KYVA 5GTDA 5BUSA 4R0MA 5CZXA 2EGTA 5AE3A 3I07A 4FTFA 4X64C 4JI5C 5K8FA 3LAXA 4NXMC 4LFBC 2PT7G 2E8EA 4GKJC 5IFIA 5DV9A 1N36C 3NI2A 3LNVA 5CZVA 5BR8C 3ETOA 2V7BA 2D1TA 4RLQA 4B3TC 3N54B 4DCSA 4PHTA 4JI4C 3DLPX 2P2MA 3VNRA 4BSZA 4OX9C 4PZPA 1WF3A 3A9VA 3E7XA 4GXQA 5BSMA 2PROA 1T5DX 4JI1C 5LMUC 3PBKA 4BBYA 2P02A 5BSWA 3SO4A 2QL8A 5BURA 4DV2C 4D4IA 4RVOA 3VNSA 4DR4C 4R1LA 2P2JA 3AF6A 2DYJA 2UXCC 4MH4A 5A2QD 3LGXA 4DR6C 3LUSA 1ML8A 2E8FA 1BA3A 3T1YC 2UUAC 1J5EC 1WH9A 1RG9A 4TPSB 3J80D 4RM3A 1ZB9A 2YCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ODJ A;  5A19 A;  1XRA A;  4KTV A;  2YWC A;  3RV2 A;  2YWB A;  1QM4 A;  1O93 A;  3A4I A;  2DPL A;  4L4Q A;  2OBV A;  4K0B A;  5T8S A;  5T8T A;  1FUG A;  1P7L A;  5H9U A;  4NDN A;  1O9T A;  5A1G A;  3TDE A;  1XRB A;  3UOW A;  1GPM A;  1MXB A;  1MXC A;  3TQI A;  1XRC A;  4WS9 A;  5A1I A;  2P02 A;  1RG9 A;  4L2Z A;  3S82 A;  4HPV A;  3SO4 A;  1MXA A;  3IML A;  4LE5 A;  4KTT A;  1O90 A;  4L7I A;  1O92 A; 
#chains in the Genus database with same CATH topology
 2JNV A;  5BUQ A;  1USP A;  4RM2 A;  4X65 C;  5H9U A;  4DG9 A;  1XMO C;  1M6X C;  4WV3 A;  5FLX D;  2WP0 C;  3IEV A;  4AQY C;  4D57 A;  4LF6 C;  3UEB A;  2D7V A;  4I9F A;  1PU1 A;  3IML A;  1FJG C;  3H2T A;  4BCA A;  4LFC C;  4DG8 A;  3RV2 A;  4FUQ A;  4G36 A;  5T8T A;  2PN2 A;  1O9T A;  3FCE A;  2Z51 A;  2E5L C;  1I94 C;  1USP B;  1WCJ A;  5IWA C;  3UX3 A;  3CJE A;  3B7W A;  3DHV A;  3NPD A;  4LE5 A;  1PG4 A;  3OTO C;  1XRA A;  4G1I A;  1LCI A;  2Y4O A;  4DV6 C;  4DCT A;  2CXC A;  2NCL A;  3AY0 A;  1P7L A;  2MMA B;  2P2F A;  4RMN A;  1N34 C;  1MXB A;  1UKK A;  4MTN A;  2P2Q A;  4WS9 A;  3PRO C;  2UUC C;  4DCU A;  2OO4 A;  2AYA A;  4G37 A;  2ATW A;  1LQL A;  3K6R A;  4JI7 C;  2OPL A;  4BC9 A;  1VEH A;  2D1R A;  1MDF A;  3EQ6 A;  1NY8 A;  5BST A;  1N32 C;  4EAT A;  1IBM C;  4B3M C;  1AMU A;  4YY3 C;  2D1Q A;  4PUI A;  1NYE A;  1T5H X;  3R9X A;  5BSV A;  2Y4N A;  3IPL A;  2UXD C;  4DR2 C;  1V25 A;  5AE2 A;  4D4G A;  4X62 C;  3A4I A;  4X66 C;  4K0B A;  5T8S A;  4ISB A;  2UUB C;  3JAM D;  5JRH A;  2VQE C;  1MD9 A;  3LNO A;  2MCQ A;  4NXN C;  4ZLP A;  1ZB8 A;  2OPL B;  2QVY X;  2KZF A;  2D28 C;  2ZZM A;  4DV0 C;  2JMP A;  4DV7 C;  1MXA A;  1MKY A;  4PUH A;  4U5Y D;  3CQ1 A;  3KXW A;  4OYC A;  4XX2 A;  2DPL A;  2E8C A;  5K85 A;  3UZ0 A;  3IEU A;  4DV3 C;  4LF5 C;  2E7G A;  3TQI A;  3PES A;  3N2Q A;  1KKG A;  4R1M A;  1O90 A;  4L7I A;  3GR0 A;  2CU6 A;  1P4E C;  3J81 D;  2KZ0 A;  2M5O A;  4LF9 C;  2CY1 A;  4B3R C;  2ASB A;  1HR0 C;  1XRB A;  3A9U A;  2VZE A;  2WD9 A;  1EGA A;  2D1S A;  4LF8 C;  4DUY C;  4DV5 C;  5A1I A;  3T1H C;  4JM1 A;  2ZM6 C;  2QVX X;  4RVN A;  4KTV A;  2VSQ A;  4ZJZ A;  2DHM A;  4DV4 C;  3GR1 A;  1M6X A;  2HJG A;  4LF4 C;  2UU9 C;  3O2E A;  3G7S A;  4DR3 C;  4JI3 C;  1HNX C;  1V60 A;  5BSU A;  4YHH C;  4DR5 C;  3UOW A;  3VNQ A;  2HHH C;  4DV1 C;  4JYA C;  1P4E A;  3E7W A;  3S82 A;  2M5H A;  4DR7 C;  3AF5 A;  4NOZ A;  4KTT A;  2BJO A;  3R9W A;  1QWI A;  3NYR A;  1IBK C;  4LF7 C;  1HH2 P;  4RLF A;  4D56 A;  2BH1 X;  1HNZ C;  4JV5 C;  5BSR A;  5A1G A;  3TDE A;  3CW8 X;  3L8C A;  4GKK C;  1IBL C;  3A25 A;  1GPM A;  4FUT A;  2P2B A;  1HNW C;  4B3S C;  1XRC A;  2Y27 A;  1N2F A;  2ZZN A;  4HPV A;  1RY2 A;  1L2F A;  3FCC A;  4OXI A;  4IZ6 A;  3CQ3 A;  2UXB C;  5LMN C;  3RG2 A;  2QVZ X;  1QM4 A;  1O93 A;  4JI0 C;  3C5E A;  3L95 X;  1FUG A;  1XMQ C;  3EER A;  4JI8 C;  1PG3 A;  3DAY A;  3CQ2 A;  1YJ7 A;  1MXC A;  2MM9 A;  3A26 A;  4PUG A;  5E7Q A;  2VQF C;  2D27 A;  1V26 A;  1JOS A;  5KYT A;  4JI2 C;  1N33 C;  1XNQ C;  5KEI A;  2F4V C;  4KHP C;  2OBV A;  1XS3 A;  2KDN A;  1ULT A;  5IT9 D;  4NDN A;  3TUF A;  4LFA C;  4PRO C;  4BC7 A;  3ETC A;  4I9G A;  2P20 A;  1VLA A;  4IR7 A;  4GS5 A;  2XR1 A;  1O92 A;  3NYQ A;  5ADZ A;  4ODJ A;  1PA4 A;  5A19 A;  4JI6 C;  2YWB A;  1UWD A;  5AE1 A;  4L4Q A;  2QW0 X;  1MDB A;  4DR1 C;  3GKU A;  3CW9 A;  3TR3 A;  4GXR A;  3I08 A;  4L2Z A;  4DCV A;  3R44 A;  3GPC A;  2E0G A;  2YWC A;  1K0R A;  4DUZ C;  1XNR C;  2ONF A;  4K0K C;  5KYV A;  5GTD A;  5BUS A;  4R0M A;  5CZX A;  2EGT A;  5AE3 A;  3I07 A;  4FTF A;  4X64 C;  4JI5 C;  5K8F A;  5LCI A;  3LAX A;  4NXM C;  4LFB C;  2PT7 G;  2E8E A;  4GKJ C;  5IFI A;  5DV9 A;  1N36 C;  3NI2 A;  3LNV A;  5CZV A;  5BR8 C;  3ETO A;  2V7B A;  2D1T A;  4RLQ A;  4B3T C;  3N54 B;  4DCS A;  4PHT A;  1IB8 A;  4JI4 C;  3DLP X;  2P2M A;  3VNR A;  4BSZ A;  4OX9 C;  4PZP A;  1WF3 A;  3A9V A;  3E7X A;  4GXQ A;  5BSM A;  2PRO A;  1T5D X;  4JI1 C;  5LMU C;  3PBK A;  4BBY A;  2P02 A;  5BSW A;  1TH5 A;  3SO4 A;  2QL8 A;  5BUR A;  1FLO A;  4DV2 C;  4D4I A;  1XHJ A;  4RVO A;  3VNS A;  4DR4 C;  4R1L A;  2P2J A;  3AF6 A;  2DYJ A;  2UXC C;  3UX2 A;  4MH4 A;  5A2Q D;  3LGX A;  2YX1 A;  4DR6 C;  3LUS A;  1ML8 A;  2E8F A;  1BA3 A;  3T1Y C;  2UUA C;  1J5E C;  1WH9 A;  1RG9 A;  4TPS B;  3J80 D;  4RM3 A;  1ZB9 A;  2YCB A; 
#chains in the Genus database with same CATH homology
 5BUQ A;  1USP A;  4RM2 A;  4X65 C;  5H9U A;  4DG9 A;  1XMO C;  4WV3 A;  5FLX D;  2WP0 C;  3IEV A;  4AQY C;  4D57 A;  4LF6 C;  2D7V A;  4I9F A;  3IML A;  1FJG C;  3H2T A;  4BCA A;  4LFC C;  4DG8 A;  3RV2 A;  4FUQ A;  4G36 A;  5T8T A;  2PN2 A;  1O9T A;  3FCE A;  2E5L C;  1I94 C;  1USP B;  5IWA C;  3CJE A;  3B7W A;  3DHV A;  3NPD A;  4LE5 A;  1PG4 A;  3OTO C;  1XRA A;  4G1I A;  1LCI A;  2Y4O A;  4DV6 C;  4DCT A;  2CXC A;  1P7L A;  2P2F A;  4RMN A;  1N34 C;  1MXB A;  1UKK A;  4MTN A;  2UUC C;  2P2Q A;  4WS9 A;  3PRO C;  4DCU A;  2OO4 A;  2AYA A;  4G37 A;  2ATW A;  1LQL A;  4JI7 C;  2OPL A;  4BC9 A;  2D1R A;  1MDF A;  3EQ6 A;  5BST A;  1N32 C;  4EAT A;  1IBM C;  4B3M C;  1AMU A;  4YY3 C;  2D1Q A;  1NYE A;  1T5H X;  3R9X A;  5BSV A;  2Y4N A;  3IPL A;  2UXD C;  4DR2 C;  1V25 A;  5AE2 A;  4D4G A;  4X62 C;  3A4I A;  4X66 C;  4K0B A;  5T8S A;  4ISB A;  2UUB C;  3JAM D;  5JRH A;  2VQE C;  1MD9 A;  4NXN C;  4ZLP A;  1ZB8 A;  2OPL B;  2QVY X;  2KZF A;  2D28 C;  4DV0 C;  2JMP A;  4DV7 C;  1MXA A;  1MKY A;  4U5Y D;  3KXW A;  4OYC A;  4XX2 A;  2DPL A;  2E8C A;  5K85 A;  3UZ0 A;  3IEU A;  4DV3 C;  4LF5 C;  2E7G A;  3TQI A;  3PES A;  3N2Q A;  1KKG A;  4R1M A;  1O90 A;  4L7I A;  3GR0 A;  3J81 D;  4LF9 C;  2CY1 A;  4B3R C;  2ASB A;  1HR0 C;  1XRB A;  3A9U A;  2VZE A;  2WD9 A;  1EGA A;  2D1S A;  4LF8 C;  4DUY C;  4DV5 C;  5A1I A;  3T1H C;  4JM1 A;  2QVX X;  2ZM6 C;  4RVN A;  4KTV A;  2VSQ A;  4ZJZ A;  4DV4 C;  3GR1 A;  2HJG A;  4LF4 C;  2UU9 C;  3G7S A;  4DR3 C;  4JI3 C;  1HNX C;  4YHH C;  5BSU A;  4DR5 C;  3UOW A;  3VNQ A;  2HHH C;  4DV1 C;  4JYA C;  3E7W A;  3S82 A;  4DR7 C;  3AF5 A;  4NOZ A;  4KTT A;  2BJO A;  3R9W A;  1QWI A;  3NYR A;  1IBK C;  4LF7 C;  1HH2 P;  4RLF A;  4D56 A;  2BH1 X;  1HNZ C;  4JV5 C;  5BSR A;  5A1G A;  3TDE A;  3CW8 X;  3L8C A;  4GKK C;  1IBL C;  1GPM A;  4FUT A;  2P2B A;  1HNW C;  4B3S C;  1XRC A;  2Y27 A;  1N2F A;  4HPV A;  1RY2 A;  1L2F A;  3FCC A;  4OXI A;  4IZ6 A;  2UXB C;  5LMN C;  3RG2 A;  2QVZ X;  1QM4 A;  1O93 A;  4JI0 C;  3C5E A;  3L95 X;  1FUG A;  1XMQ C;  3EER A;  4JI8 C;  1PG3 A;  3DAY A;  1YJ7 A;  1MXC A;  5E7Q A;  2VQF C;  2D27 A;  1V26 A;  1JOS A;  5KYT A;  4JI2 C;  1N33 C;  1XNQ C;  5KEI A;  2F4V C;  4KHP C;  2OBV A;  1ULT A;  5IT9 D;  4NDN A;  3TUF A;  4LFA C;  4PRO C;  4BC7 A;  3ETC A;  4I9G A;  2P20 A;  1VLA A;  4IR7 A;  4GS5 A;  2XR1 A;  1O92 A;  3NYQ A;  5ADZ A;  4ODJ A;  1PA4 A;  5A19 A;  4JI6 C;  2YWB A;  5AE1 A;  4L4Q A;  2QW0 X;  1MDB A;  4DR1 C;  3GKU A;  3CW9 A;  4GXR A;  3I08 A;  4L2Z A;  4DCV A;  3R44 A;  3GPC A;  2E0G A;  2YWC A;  1K0R A;  4DUZ C;  1XNR C;  2ONF A;  4K0K C;  5KYV A;  5GTD A;  5BUS A;  4R0M A;  5CZX A;  2EGT A;  5AE3 A;  3I07 A;  4FTF A;  4X64 C;  4JI5 C;  5K8F A;  3LAX A;  4NXM C;  4LFB C;  2PT7 G;  2E8E A;  4GKJ C;  5IFI A;  5DV9 A;  1N36 C;  3NI2 A;  3LNV A;  5CZV A;  5BR8 C;  3ETO A;  2V7B A;  2D1T A;  4RLQ A;  4B3T C;  3N54 B;  4DCS A;  4PHT A;  4JI4 C;  3DLP X;  2P2M A;  3VNR A;  4BSZ A;  4OX9 C;  4PZP A;  1WF3 A;  3A9V A;  3E7X A;  4GXQ A;  5BSM A;  2PRO A;  1T5D X;  4JI1 C;  5LMU C;  3PBK A;  4BBY A;  2P02 A;  5BSW A;  3SO4 A;  2QL8 A;  5BUR A;  4DV2 C;  4D4I A;  4RVO A;  3VNS A;  4DR4 C;  4R1L A;  2P2J A;  3AF6 A;  2DYJ A;  2UXC C;  4MH4 A;  5A2Q D;  3LGX A;  4DR6 C;  3LUS A;  1ML8 A;  2E8F A;  1BA3 A;  3T1Y C;  2UUA C;  1J5E C;  1WH9 A;  1RG9 A;  4TPS B;  3J80 D;  4RM3 A;  1ZB9 A;  2YCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...