1FUGA

S-adenosylmethionine synthetase
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
Knots found
sequence length
383
structure length
383
Chain Sequence
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords S-ADENOSYLMETHIONINE SYNTHETASE
publication title Flexible loop in the structure of S-adenosylmethionine synthetase crystallized in the tetragonal modification.
pubmed rcsb
source organism Escherichia coli
total genus 90
structure length 383
sequence length 383
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 1996-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1fugA03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1fugA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1fugA01
1FUGA 3S82A 4L2ZA 4KTVA 4ODJA 3A4IA 1O9TA 1XRCA 1GPMA 4K0BA 1O92A 1XRBA 5T8TA 4KTTA 1QM4A 5H9UA 3RV2A 3UOWA 2DPLA 4HPVA 4NDNA 5A1IA 2P02A 3TDEA 5A1GA 1MXBA 4WS9A 1MXCA 2YWBA 2OBVA 1O93A 1O90A 3IMLA 1RG9A 3SO4A 1XRAA 1MXAA 4L4QA 1P7LA 4LE5A 5T8SA 4L7IA 2YWCA 3TQIA 5A19A
chains in the Genus database with same CATH superfamily
4D57A 1FUGA 2D1TA 4B3SC 4GKJC 4DV4C 4EATA 1I94C 3OTOC 4JI7C 1USPB 3KXWA 1ML8A 4DG8A 4B3TC 1FLOA 1ZB9A 4XX2A 1O90A 3IMLA 4OXIA 3UX3A 1WH9A 1HH2P 4R1MA 3A25A 4DR4C 2JNVA 1XNRC 3NPDA 5BSWA 2QL8A 4DCSA 4B3RC 3AY0A 4PUIA 2OPLA 1N32C 1PU1A 1M6XC 3LNOA 4FTFA 4RM3A 4PHTA 4X66C 4LF9C 3VNSA 1PG4A 2VSQA 3A26A 4LF4C 5AE1A 3J80D 1L2FA 4G37A 4G1IA 1XHJA 3CJEA 2E0GA 1XRCA 1V60A 4OX9C 1AMUA 3UOWA 1P4EC 4IR7A 3PBKA 3IPLA 2QVYX 1M6XA 5LCIA 2DYJA 2VZEA 4DCUA 2EGTA 4DV6C 1ULTA 5FLXD 5A19A 4K0KC 5KYVA 4DV2C 3ETCA 1N2FA 4JI0C 3LAXA 4BBYA 4DR3C 4JM1A 4PROC 2P20A 4LF6C 4PUHA 3L95X 4DV7C 4X62C 2KZFA 1HR0C 5AE2A 5BSTA 2Y27A 4X64C 3PROC 3C5EA 1MD9A 2UXBC 2KDNA 2BJOA 1V25A 3E7WA 4AQYC 1T5DX 2DHMA 1XNQC 2UXCC 5BUSA 4RMNA 4DUYC 4DV0C 5H9UA 3ETOA 2V7BA 2P2FA 2YCBA 4JI1C 3FCCA 1MXBA 4JI2C 4GS5A 2D1QA 1TH5A 1UKKA 4DR1C 3CQ2A 3PESA 3FCEA 1P7LA 4YHHC 2E7GA 5BURA 3R9XA 4DV1C 3NI2A 3H2TA 2CU6A 1YJ7A 4WS9A 4LF5C 4R1LA 3VNQA 5BR8C 1FJGC 2XR1A 3LGXA 2Y4NA 1NYEA 1XRAA 1KKGA 2Z51A 4L7IA 2UXDC 1HNWC 5GTDA 5LMNC 2UUCC 2UUBC 2M5HA 4KHPC 4YY3C 5ADZA 1QM4A 3RV2A 4JI4C 3AF6A 4NDNA 2PT7G 4DV3C 4WV3A 1VLAA 2F4VC 4DG9A 4JYAC 4JV5C 1VEHA 2YWBA 2D1RA 4DV5C 2HHHC 1WCJA 4LFAC 2ZM6C 1MXAA 5K8FA 1IB8A 5DV9A 2WD9A 1ZB8A 5KYTA 2MM9A 1K0RA 4RLFA 3TR3A 2E5LC 3AF5A 3NYRA 4NOZA 1IBMC 4KTTA 1NY8A 4OYCA 4DCTA 5BSUA 4ZJZA 2VQEC 4LF8C 2ZZNA 2E8CA 3GKUA 2YX1A 5IFIA 2M5OA 3DLPX 5BSMA 1O93A 2QW0X 3JAMD 3R44A 4L4QA 4ZLPA 3IEVA 4R0MA 1PG3A 5K85A 2CY1A 4I9GA 2QVZX 4LFCC 4JI6C 1JOSA 3J81D 1P4EA 4MH4A 4BCAA 2P2JA 1USPA 1EGAA 1RY2A 4G36A 1UWDA 1RG9A 4DR2C 5BUQA 3TQIA 1J5EC 2VQFC 5BSRA 4PUGA 3K6RA 2OPLB 2NCLA 1PA4A 4DCVA 2ZZMA 2OO4A 2P2MA 3UEBA 5A2QD 4GKKC 4I9FA 3SO4A 3GR0A 5AE3A 2AYAA 1IBLC 2D28C 2JMPA 3S82A 1GPMA 3G7SA 2WP0C 1QWIA 2MMAB 3B7WA 2P2QA 2DPLA 3IEUA 2P2BA 5A1IA 4D4GA 5IWAC 3UZ0A 2PROA 4U5YD 3GR1A 1LCIA 3VNRA 2UU9C 4LF7C 2D1SA 4GXRA 3DHVA 4RVOA 4LE5A 5LMUC 4NXMC 4ISBA 3A9VA 3TUFA 3L8CA 4NXNC 4FUQA 2E8EA 2P02A 4JI8C 4B3MC 3N2QA 3GPCA 1MXCA 3R9WA 1XS3A 1WF3A 4LFBC 2QVXX 3EERA 4D4IA 1IBKC 2D7VA 3EQ6A 4ODJA 3I08A 4TPSB 1XRBA 5T8TA 2D27A 3TDEA 1HNZC 4IZ6A 2CXCA 1V26A 2E8FA 3LUSA 3CQ3A 4JI3C 3NYQA 1MDFA 4RVNA 4DR6C 3CW9A 4DUZC 4X65C 1XMQC 2YWCA 5CZXA 4L2ZA 3UX2A 3A4IA 1O92A 4BC7A 3CQ1A 2HJGA 2ONFA 1N34C 4BSZA 2BH1X 2Y4OA 5CZVA 4BC9A 5JRHA 4RLQA 5BSVA 5T8SA 3T1YC 2UUAC 1MDBA 1O9TA 4JI5C 3T1HC 5E7QA 3O2EA 1BA3A 4PZPA 4D56A 3LNVA 5A1GA 1N33C 3N54B 1N36C 4DR5C 1XMOC 4FUTA 2ASBA 5IT9D 1HNXC 3CW8X 4KTVA 2MCQA 3RG2A 4K0BA 3I07A 4HPVA 1T5HX 2ATWA 4RM2A 3DAYA 3A9UA 2KZ0A 4DR7C 4MTNA 2PN2A 2OBVA 4GXQA 3E7XA 1MKYA 5KEIA 1LQLA
chains in the Genus database with same CATH topology
4D57A 1FUGA 2D1TA 4B3SC 4GKJC 4DV4C 4EATA 1I94C 3OTOC 4JI7C 1USPB 3KXWA 1ML8A 4DG8A 4B3TC 1ZB9A 4XX2A 1O90A 3IMLA 4OXIA 1WH9A 1HH2P 4R1MA 4DR4C 1XNRC 3NPDA 5BSWA 2QL8A 4DCSA 4B3RC 2OPLA 1N32C 4FTFA 4RM3A 4PHTA 4X66C 4LF9C 3VNSA 1PG4A 2VSQA 4LF4C 5AE1A 3J80D 1L2FA 4G37A 4G1IA 3CJEA 2E0GA 1XRCA 4OX9C 1AMUA 3UOWA 4IR7A 3PBKA 3IPLA 2QVYX 2DYJA 2VZEA 4DCUA 2EGTA 4DV6C 1ULTA 5FLXD 5A19A 4K0KC 5KYVA 4DV2C 3ETCA 1N2FA 4JI0C 3LAXA 4BBYA 4DR3C 4JM1A 4PROC 2P20A 4LF6C 3L95X 4DV7C 4X62C 2KZFA 1HR0C 5AE2A 5BSTA 2Y27A 4X64C 3PROC 3C5EA 1MD9A 2UXBC 2BJOA 1V25A 3E7WA 4AQYC 1T5DX 1XNQC 2UXCC 5BUSA 4RMNA 4DUYC 4DV0C 5H9UA 3ETOA 2V7BA 2P2FA 2YCBA 4JI1C 3FCCA 1MXBA 4JI2C 4GS5A 2D1QA 1UKKA 4DR1C 3PESA 3FCEA 1P7LA 4YHHC 2E7GA 5BURA 3R9XA 4DV1C 3NI2A 3H2TA 1YJ7A 4WS9A 4LF5C 4R1LA 3VNQA 5BR8C 1FJGC 2XR1A 3LGXA 2Y4NA 1NYEA 1XRAA 1KKGA 4L7IA 2UXDC 1HNWC 5GTDA 5LMNC 2UUCC 2UUBC 4KHPC 4YY3C 5ADZA 1QM4A 3RV2A 3AF6A 4JI4C 4NDNA 2PT7G 4DV3C 4WV3A 1VLAA 2F4VC 4DG9A 4JYAC 4JV5C 2YWBA 2D1RA 4DV5C 2HHHC 4LFAC 2ZM6C 1MXAA 5K8FA 5DV9A 2WD9A 1ZB8A 5KYTA 1K0RA 4RLFA 2E5LC 3AF5A 3NYRA 4NOZA 1IBMC 4KTTA 4OYCA 4DCTA 5BSUA 4ZJZA 2VQEC 4LF8C 2E8CA 3GKUA 5IFIA 3DLPX 5BSMA 1O93A 2QW0X 3JAMD 3R44A 4L4QA 4ZLPA 3IEVA 4R0MA 1PG3A 5K85A 2CY1A 4I9GA 2QVZX 4LFCC 4JI6C 1JOSA 3J81D 4MH4A 4BCAA 2P2JA 1USPA 1EGAA 1RY2A 4G36A 1RG9A 4DR2C 5BUQA 3TQIA 1J5EC 2VQFC 5BSRA 2OPLB 1PA4A 4DCVA 2OO4A 2P2MA 5A2QD 4GKKC 4I9FA 3SO4A 3GR0A 5AE3A 2AYAA 1IBLC 2D28C 2JMPA 3S82A 1GPMA 3G7SA 2WP0C 1QWIA 3B7WA 2P2QA 2DPLA 3IEUA 2P2BA 5A1IA 4D4GA 5IWAC 3UZ0A 2PROA 4U5YD 3GR1A 1LCIA 3VNRA 2UU9C 4LF7C 2D1SA 4GXRA 3DHVA 4RVOA 4LE5A 5LMUC 4NXMC 4ISBA 3A9VA 3TUFA 3L8CA 4NXNC 4FUQA 2E8EA 2P02A 4JI8C 4B3MC 3N2QA 3GPCA 1MXCA 3R9WA 1WF3A 4LFBC 2QVXX 3EERA 4D4IA 1IBKC 2D7VA 3EQ6A 4ODJA 3I08A 4TPSB 1XRBA 5T8TA 2D27A 3TDEA 1HNZC 4IZ6A 2CXCA 1V26A 2E8FA 3LUSA 4JI3C 3NYQA 1MDFA 4RVNA 4DR6C 3CW9A 4DUZC 4X65C 1XMQC 2YWCA 5CZXA 4L2ZA 3A4IA 1O92A 4BC7A 2HJGA 2ONFA 1N34C 4BSZA 2BH1X 2Y4OA 5CZVA 4BC9A 5JRHA 4RLQA 5BSVA 5T8SA 3T1YC 2UUAC 1MDBA 1O9TA 4JI5C 3T1HC 5E7QA 1BA3A 4PZPA 4D56A 3LNVA 5A1GA 1N33C 3N54B 1N36C 4DR5C 1XMOC 4FUTA 2ASBA 5IT9D 1HNXC 3CW8X 4KTVA 3RG2A 4K0BA 3I07A 4HPVA 1T5HX 2ATWA 4RM2A 3DAYA 3A9UA 4DR7C 4MTNA 2PN2A 2OBVA 4GXQA 3E7XA 1MKYA 5KEIA 1LQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FUG A;  3S82 A;  4L2Z A;  4KTV A;  4ODJ A;  3A4I A;  1O9T A;  1XRC A;  1GPM A;  4K0B A;  1O92 A;  1XRB A;  5T8T A;  4KTT A;  1QM4 A;  5H9U A;  3RV2 A;  3UOW A;  2DPL A;  4HPV A;  4NDN A;  5A1I A;  2P02 A;  3TDE A;  5A1G A;  1MXB A;  4WS9 A;  1MXC A;  2YWB A;  2OBV A;  1O93 A;  1O90 A;  3IML A;  1RG9 A;  3SO4 A;  1XRA A;  1MXA A;  4L4Q A;  1P7L A;  4LE5 A;  5T8S A;  4L7I A;  2YWC A;  3TQI A;  5A19 A; 
#chains in the Genus database with same CATH topology
 4D57 A;  1FUG A;  2D1T A;  4B3S C;  4GKJ C;  4DV4 C;  4EAT A;  1I94 C;  3OTO C;  4JI7 C;  1USP B;  3KXW A;  1ML8 A;  4DG8 A;  4B3T C;  1FLO A;  1ZB9 A;  4XX2 A;  1O90 A;  3IML A;  4OXI A;  3UX3 A;  1WH9 A;  1HH2 P;  4R1M A;  3A25 A;  4DR4 C;  2JNV A;  1XNR C;  3NPD A;  5BSW A;  2QL8 A;  4DCS A;  4B3R C;  3AY0 A;  4PUI A;  2OPL A;  1N32 C;  1PU1 A;  1M6X C;  3LNO A;  4FTF A;  4RM3 A;  4PHT A;  4X66 C;  4LF9 C;  3VNS A;  1PG4 A;  2VSQ A;  3A26 A;  4LF4 C;  5AE1 A;  3J80 D;  1L2F A;  4G37 A;  4G1I A;  1XHJ A;  3CJE A;  2E0G A;  1XRC A;  1V60 A;  4OX9 C;  1AMU A;  3UOW A;  1P4E C;  4IR7 A;  3PBK A;  3IPL A;  2QVY X;  1M6X A;  5LCI A;  2DYJ A;  2VZE A;  4DCU A;  2EGT A;  4DV6 C;  1ULT A;  5FLX D;  5A19 A;  4K0K C;  5KYV A;  4DV2 C;  3ETC A;  1N2F A;  4JI0 C;  3LAX A;  4BBY A;  4DR3 C;  4JM1 A;  4PRO C;  2P20 A;  4LF6 C;  4PUH A;  3L95 X;  4DV7 C;  4X62 C;  2KZF A;  1HR0 C;  5AE2 A;  5BST A;  2Y27 A;  4X64 C;  3PRO C;  3C5E A;  1MD9 A;  2UXB C;  2KDN A;  2BJO A;  1V25 A;  3E7W A;  4AQY C;  1T5D X;  2DHM A;  1XNQ C;  2UXC C;  5BUS A;  4RMN A;  4DUY C;  4DV0 C;  5H9U A;  3ETO A;  2V7B A;  2P2F A;  2YCB A;  4JI1 C;  3FCC A;  1MXB A;  4JI2 C;  4GS5 A;  2D1Q A;  1TH5 A;  1UKK A;  4DR1 C;  3CQ2 A;  3PES A;  3FCE A;  1P7L A;  4YHH C;  2E7G A;  5BUR A;  3R9X A;  4DV1 C;  3NI2 A;  3H2T A;  2CU6 A;  1YJ7 A;  4WS9 A;  4LF5 C;  4R1L A;  3VNQ A;  5BR8 C;  1FJG C;  2XR1 A;  3LGX A;  2Y4N A;  1NYE A;  1XRA A;  1KKG A;  2Z51 A;  4L7I A;  2UXD C;  1HNW C;  5GTD A;  5LMN C;  2UUC C;  2UUB C;  2M5H A;  4KHP C;  4YY3 C;  5ADZ A;  1QM4 A;  3RV2 A;  4JI4 C;  3AF6 A;  4NDN A;  2PT7 G;  4DV3 C;  4WV3 A;  1VLA A;  2F4V C;  4DG9 A;  4JYA C;  4JV5 C;  1VEH A;  2YWB A;  2D1R A;  4DV5 C;  2HHH C;  1WCJ A;  4LFA C;  2ZM6 C;  1MXA A;  5K8F A;  1IB8 A;  5DV9 A;  2WD9 A;  1ZB8 A;  5KYT A;  2MM9 A;  1K0R A;  4RLF A;  3TR3 A;  2E5L C;  3AF5 A;  3NYR A;  4NOZ A;  1IBM C;  4KTT A;  1NY8 A;  4OYC A;  4DCT A;  5BSU A;  4ZJZ A;  2VQE C;  4LF8 C;  2ZZN A;  2E8C A;  3GKU A;  2YX1 A;  5IFI A;  2M5O A;  3DLP X;  5BSM A;  1O93 A;  2QW0 X;  3JAM D;  3R44 A;  4L4Q A;  4ZLP A;  3IEV A;  4R0M A;  1PG3 A;  5K85 A;  2CY1 A;  4I9G A;  2QVZ X;  4LFC C;  4JI6 C;  1JOS A;  3J81 D;  1P4E A;  4MH4 A;  4BCA A;  2P2J A;  1USP A;  1EGA A;  1RY2 A;  4G36 A;  1UWD A;  1RG9 A;  4DR2 C;  5BUQ A;  3TQI A;  1J5E C;  2VQF C;  5BSR A;  4PUG A;  3K6R A;  2OPL B;  2NCL A;  1PA4 A;  4DCV A;  2ZZM A;  2OO4 A;  2P2M A;  3UEB A;  5A2Q D;  4GKK C;  4I9F A;  3SO4 A;  3GR0 A;  5AE3 A;  2AYA A;  1IBL C;  2D28 C;  2JMP A;  3S82 A;  1GPM A;  3G7S A;  2WP0 C;  1QWI A;  2MMA B;  3B7W A;  2P2Q A;  2DPL A;  3IEU A;  2P2B A;  5A1I A;  4D4G A;  5IWA C;  3UZ0 A;  2PRO A;  4U5Y D;  3GR1 A;  1LCI A;  3VNR A;  2UU9 C;  4LF7 C;  2D1S A;  4GXR A;  3DHV A;  4RVO A;  4LE5 A;  5LMU C;  4NXM C;  4ISB A;  3A9V A;  3TUF A;  3L8C A;  4NXN C;  4FUQ A;  2E8E A;  2P02 A;  4JI8 C;  4B3M C;  3N2Q A;  3GPC A;  1MXC A;  3R9W A;  1XS3 A;  1WF3 A;  4LFB C;  2QVX X;  3EER A;  4D4I A;  1IBK C;  2D7V A;  3EQ6 A;  4ODJ A;  3I08 A;  4TPS B;  1XRB A;  5T8T A;  2D27 A;  3TDE A;  1HNZ C;  4IZ6 A;  2CXC A;  1V26 A;  2E8F A;  3LUS A;  3CQ3 A;  4JI3 C;  3NYQ A;  1MDF A;  4RVN A;  4DR6 C;  3CW9 A;  4DUZ C;  4X65 C;  1XMQ C;  2YWC A;  5CZX A;  4L2Z A;  3UX2 A;  3A4I A;  1O92 A;  4BC7 A;  3CQ1 A;  2HJG A;  2ONF A;  1N34 C;  4BSZ A;  2BH1 X;  2Y4O A;  5CZV A;  4BC9 A;  5JRH A;  4RLQ A;  5BSV A;  5T8S A;  3T1Y C;  2UUA C;  1MDB A;  1O9T A;  4JI5 C;  3T1H C;  5E7Q A;  3O2E A;  1BA3 A;  4PZP A;  4D56 A;  3LNV A;  5A1G A;  1N33 C;  3N54 B;  1N36 C;  4DR5 C;  1XMO C;  4FUT A;  2ASB A;  5IT9 D;  1HNX C;  3CW8 X;  4KTV A;  2MCQ A;  3RG2 A;  4K0B A;  3I07 A;  4HPV A;  1T5H X;  2ATW A;  4RM2 A;  3DAY A;  3A9U A;  2KZ0 A;  4DR7 C;  4MTN A;  2PN2 A;  2OBV A;  4GXQ A;  3E7X A;  1MKY A;  5KEI A;  1LQL A; 
#chains in the Genus database with same CATH homology
 4D57 A;  1FUG A;  2D1T A;  4B3S C;  4GKJ C;  4DV4 C;  4EAT A;  1I94 C;  3OTO C;  4JI7 C;  1USP B;  3KXW A;  1ML8 A;  4DG8 A;  4B3T C;  1ZB9 A;  4XX2 A;  1O90 A;  3IML A;  4OXI A;  1WH9 A;  1HH2 P;  4R1M A;  4DR4 C;  1XNR C;  3NPD A;  5BSW A;  2QL8 A;  4DCS A;  4B3R C;  2OPL A;  1N32 C;  4FTF A;  4RM3 A;  4PHT A;  4X66 C;  4LF9 C;  3VNS A;  1PG4 A;  2VSQ A;  4LF4 C;  5AE1 A;  3J80 D;  1L2F A;  4G37 A;  4G1I A;  3CJE A;  2E0G A;  1XRC A;  4OX9 C;  1AMU A;  3UOW A;  4IR7 A;  3PBK A;  3IPL A;  2QVY X;  2DYJ A;  2VZE A;  4DCU A;  2EGT A;  4DV6 C;  1ULT A;  5FLX D;  5A19 A;  4K0K C;  5KYV A;  4DV2 C;  3ETC A;  1N2F A;  4JI0 C;  3LAX A;  4BBY A;  4DR3 C;  4JM1 A;  4PRO C;  2P20 A;  4LF6 C;  3L95 X;  4DV7 C;  4X62 C;  2KZF A;  1HR0 C;  5AE2 A;  5BST A;  2Y27 A;  4X64 C;  3PRO C;  3C5E A;  1MD9 A;  2UXB C;  2BJO A;  1V25 A;  3E7W A;  4AQY C;  1T5D X;  1XNQ C;  2UXC C;  5BUS A;  4RMN A;  4DUY C;  4DV0 C;  5H9U A;  3ETO A;  2V7B A;  2P2F A;  2YCB A;  4JI1 C;  3FCC A;  1MXB A;  4JI2 C;  4GS5 A;  2D1Q A;  1UKK A;  4DR1 C;  3PES A;  3FCE A;  1P7L A;  4YHH C;  2E7G A;  5BUR A;  3R9X A;  4DV1 C;  3NI2 A;  3H2T A;  1YJ7 A;  4WS9 A;  4LF5 C;  4R1L A;  3VNQ A;  5BR8 C;  1FJG C;  2XR1 A;  3LGX A;  2Y4N A;  1NYE A;  1XRA A;  1KKG A;  4L7I A;  2UXD C;  1HNW C;  5GTD A;  5LMN C;  2UUC C;  2UUB C;  4KHP C;  4YY3 C;  5ADZ A;  1QM4 A;  3RV2 A;  3AF6 A;  4JI4 C;  4NDN A;  2PT7 G;  4DV3 C;  4WV3 A;  1VLA A;  2F4V C;  4DG9 A;  4JYA C;  4JV5 C;  2YWB A;  2D1R A;  4DV5 C;  2HHH C;  4LFA C;  2ZM6 C;  1MXA A;  5K8F A;  5DV9 A;  2WD9 A;  1ZB8 A;  5KYT A;  1K0R A;  4RLF A;  2E5L C;  3AF5 A;  3NYR A;  4NOZ A;  1IBM C;  4KTT A;  4OYC A;  4DCT A;  5BSU A;  4ZJZ A;  2VQE C;  4LF8 C;  2E8C A;  3GKU A;  5IFI A;  3DLP X;  5BSM A;  1O93 A;  2QW0 X;  3JAM D;  3R44 A;  4L4Q A;  4ZLP A;  3IEV A;  4R0M A;  1PG3 A;  5K85 A;  2CY1 A;  4I9G A;  2QVZ X;  4LFC C;  4JI6 C;  1JOS A;  3J81 D;  4MH4 A;  4BCA A;  2P2J A;  1USP A;  1EGA A;  1RY2 A;  4G36 A;  1RG9 A;  4DR2 C;  5BUQ A;  3TQI A;  1J5E C;  2VQF C;  5BSR A;  2OPL B;  1PA4 A;  4DCV A;  2OO4 A;  2P2M A;  5A2Q D;  4GKK C;  4I9F A;  3SO4 A;  3GR0 A;  5AE3 A;  2AYA A;  1IBL C;  2D28 C;  2JMP A;  3S82 A;  1GPM A;  3G7S A;  2WP0 C;  1QWI A;  3B7W A;  2P2Q A;  2DPL A;  3IEU A;  2P2B A;  5A1I A;  4D4G A;  5IWA C;  3UZ0 A;  2PRO A;  4U5Y D;  3GR1 A;  1LCI A;  3VNR A;  2UU9 C;  4LF7 C;  2D1S A;  4GXR A;  3DHV A;  4RVO A;  4LE5 A;  5LMU C;  4NXM C;  4ISB A;  3A9V A;  3TUF A;  3L8C A;  4NXN C;  4FUQ A;  2E8E A;  2P02 A;  4JI8 C;  4B3M C;  3N2Q A;  3GPC A;  1MXC A;  3R9W A;  1WF3 A;  4LFB C;  2QVX X;  3EER A;  4D4I A;  1IBK C;  2D7V A;  3EQ6 A;  4ODJ A;  3I08 A;  4TPS B;  1XRB A;  5T8T A;  2D27 A;  3TDE A;  1HNZ C;  4IZ6 A;  2CXC A;  1V26 A;  2E8F A;  3LUS A;  4JI3 C;  3NYQ A;  1MDF A;  4RVN A;  4DR6 C;  3CW9 A;  4DUZ C;  4X65 C;  1XMQ C;  2YWC A;  5CZX A;  4L2Z A;  3A4I A;  1O92 A;  4BC7 A;  2HJG A;  2ONF A;  1N34 C;  4BSZ A;  2BH1 X;  2Y4O A;  5CZV A;  4BC9 A;  5JRH A;  4RLQ A;  5BSV A;  5T8S A;  3T1Y C;  2UUA C;  1MDB A;  1O9T A;  4JI5 C;  3T1H C;  5E7Q A;  1BA3 A;  4PZP A;  4D56 A;  3LNV A;  5A1G A;  1N33 C;  3N54 B;  1N36 C;  4DR5 C;  1XMO C;  4FUT A;  2ASB A;  5IT9 D;  1HNX C;  3CW8 X;  4KTV A;  3RG2 A;  4K0B A;  3I07 A;  4HPV A;  1T5H X;  2ATW A;  4RM2 A;  3DAY A;  3A9U A;  4DR7 C;  4MTN A;  2PN2 A;  2OBV A;  4GXQ A;  3E7X A;  1MKY A;  5KEI A;  1LQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...