1FUGA

S-adenosylmethionine synthetase
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
Knots found
sequence length
383
structure length
383
Chain Sequence
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-ADENOSYLMETHIONINE SYNTHETASE
publication title Flexible loop in the structure of S-adenosylmethionine synthetase crystallized in the tetragonal modification.
pubmed rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 90
structure length 383
sequence length 383
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 1996-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1fugA03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1fugA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1fugA01
1P7LA 4L7IA 4KTVA 3RV2A 1O9TA 1XRCA 4LE5A 3TQIA 1O93A 2DPLA 4WS9A 3SO4A 1MXCA 1XRAA 1O92A 1MXAA 1FUGA 4L4QA 3IMLA 4KTTA 5T8SA 2YWCA 1GPMA 5A1IA 1MXBA 2OBVA 3UOWA 4L2ZA 4ODJA 3S82A 5A1GA 3TDEA 5H9UA 1XRBA 1RG9A 1QM4A 3A4IA 5T8TA 4HPVA 4K0BA 2P02A 1O90A 5A19A 2YWBA 4NDNA
chains in the Genus database with same CATH superfamily
1HR0C 3PESA 1JOSA 1MXAA 4KTTA 1NY8A 2YWCA 2YX1A 4R1LA 3ETOA 2VZEA 5BSUA 1V26A 3G7SA 4LF4C 3LGXA 4PUGA 5A19A 4B3MC 2M5OA 1EGAA 3LAXA 1ZB9A 2ASBA 1MD9A 2UUCC 2P2BA 1IB8A 1FUGA 2Z51A 3NYQA 2XR1A 1ZB8A 4DR1C 2Y27A 4RVOA 4JI7C 1N34C 2OPLA 5KYVA 2OO4A 1WCJA 3IPLA 4L7IA 3RV2A 2F4VC 4R0MA 4JV5C 2P20A 1P4EA 2D28C 1MXCA 1XHJA 3T1YC 1PG4A 5A1IA 4FUQA 5CZXA 4GXRA 2CY1A 4LF6C 1KKGA 4IZ6A 1USPA 1V25A 3TDEA 3CQ3A 1FJGC 3RG2A 2YCBA 2CU6A 5GTDA 2UUBC 4R1MA 5K8FA 1QWIA 4JI4C 4I9FA 2WP0C 4DCSA 4WS9A 1N36C 3IEVA 2QL8A 4DV0C 1PU1A 3T1HC 3S82A 4DCUA 4DV7C 5BUSA 2KDNA 3H2TA 5E7QA 2ZZNA 1VLAA 5T8TA 4RVNA 4LFAC 3LNOA 4JI0C 5AE2A 4G1IA 1V60A 2VSQA 4D4IA 5CZVA 4DG8A 5KYTA 3R44A 1XS3A 2E0GA 4KHPC 4PZPA 3DAYA 3B7WA 1UKKA 5KEIA 3E7WA 3L8CA 4RM2A 2OPLB 4NDNA 1M6XC 2E8FA 3DLPX 4D56A 4MTNA 2D1QA 2P2QA 4L4QA 4PROC 4AQYC 1J5EC 1USPB 1RG9A 1MDFA 4RLFA 4FTFA 4DV3C 1O90A 2MM9A 3TUFA 3CJEA 3N54B 5BSTA 3TQIA 2JNVA 3A9UA 5LMUC 1XMQC 4OYCA 1MXBA 4X62C 4L2ZA 3GKUA 3PROC 2PT7G 1ML8A 2M5HA 3CW9A 1WF3A 2AYAA 5IWAC 2HHHC 1XRBA 3UZ0A 4LF5C 3A9VA 3FCCA 5AE3A 4DR3C 2UUAC 4XX2A 2VQFC 5IFIA 4EATA 5LMNC 2DPLA 2Y4OA 3A25A 4GKJC 2KZ0A 2NCLA 4JI2C 3IMLA 4B3RC 5LCIA 2OBVA 2Y4NA 3CQ2A 1L2FA 3IEUA 4DV1C 2UXBC 4LFBC 3LNVA 5ADZA 5H9UA 1T5HX 4DUYC 3UEBA 4BSZA 3R9WA 2YWBA 2UU9C 3EERA 5FLXD 1XRCA 4JI1C 4FUTA 2JMPA 3I07A 4JI3C 2BH1X 1GPMA 2P2FA 4G36A 4DV2C 3VNSA 1HNZC 5A2QD 5JRHA 5A1GA 4GXQA 3N2QA 4ZLPA 3ETCA 4RLQA 4TPSB 3AY0A 3VNQA 1P4EC 2P02A 4LFCC 1O9TA 1HH2P 4G37A 2WD9A 3SO4A 2UXCC 4B3TC 3UX2A 2QVYX 4DR6C 4WV3A 2D1TA 2QVZX 4LF8C 4MH4A 4ODJA 2E8CA 4YHHC 5BURA 2D7VA 1NYEA 4HPVA 4K0BA 4D4GA 1HNXC 5BR8C 4DR2C 1O93A 3GPCA 5BUQA 1AMUA 4BBYA 1LCIA 3AF5A 2CXCA 4JI5C 3AF6A 4JYAC 4X64C 1I94C 3C5EA 4IR7A 1UWDA 4BCAA 4NXMC 1FLOA 4PHTA 2BJOA 3GR1A 4RMNA 1VEHA 3NPDA 1IBMC 4GS5A 1XMOC 4DV4C 1MKYA 1TH5A 2D27A 2HJGA 5K85A 2P2JA 5BSMA 4JI8C 4U5YD 4JI6C 3J80D 2P2MA 1P7LA 4DCVA 5AE1A 4D57A 3FCEA 4DR7C 1ULTA 3OTOC 3R9XA 2EGTA 2ONFA 4ISBA 3GR0A 2D1SA 3UX3A 5BSVA 3L95X 4RM3A 2V7BA 1N2FA 1K0RA 4I9GA 2E8EA 4DG9A 4DR5C 2MCQA 3NI2A 1IBLC 3J81D 2E7GA 4BC7A 4GKKC 3JAMD 4KTVA 4DCTA 3O2EA 2ATWA 1LQLA 5IT9D 1N33C 1XRAA 1O92A 3E7XA 5BSRA 4OX9C 4JM1A 3VNRA 1XNRC 4YY3C 2D1RA 5DV9A 2KZFA 4X65C 1N32C 2DHMA 4NXNC 1YJ7A 2QW0X 4X66C 4ZJZA 1T5DX 2QVXX 2E5LC 1HNWC 4LE5A 4BC9A 4LF9C 4LF7C 3NYRA 3CQ1A 1PA4A 3DHVA 2ZZMA 3LUSA 1M6XA 3UOWA 1BA3A 3I08A 3K6RA 2PN2A 4DUZC 1WH9A 1MDBA 1IBKC 1QM4A 3A4IA 3EQ6A 4PUIA 3KXWA 3TR3A 2ZM6C 5BSWA 3CW8X 1RY2A 4DV5C 2DYJA 5T8SA 4PUHA 2MMAB 2VQEC 4K0KC 4DR4C 4OXIA 2UXDC 2PROA 4NOZA 1XNQC 1PG3A 4DV6C 4B3SC 3PBKA 3A26A
chains in the Genus database with same CATH topology
1HR0C 3PESA 1JOSA 1MXAA 4KTTA 2YWCA 4R1LA 3ETOA 2VZEA 5BSUA 1V26A 3G7SA 4LF4C 3LGXA 5A19A 4B3MC 1EGAA 3LAXA 1ZB9A 2ASBA 1MD9A 2UUCC 2P2BA 1FUGA 3NYQA 2XR1A 1ZB8A 4DR1C 2Y27A 4RVOA 4JI7C 1N34C 2OPLA 5KYVA 2OO4A 3IPLA 4L7IA 3RV2A 2F4VC 4R0MA 4JV5C 2P20A 2D28C 1MXCA 3T1YC 1PG4A 5A1IA 4FUQA 5CZXA 4GXRA 2CY1A 4LF6C 1KKGA 4IZ6A 1USPA 1V25A 3TDEA 1FJGC 3RG2A 2YCBA 5GTDA 2UUBC 4R1MA 5K8FA 1QWIA 4JI4C 4I9FA 2WP0C 4DCSA 4WS9A 1N36C 3IEVA 2QL8A 4DV0C 3T1HC 3S82A 4DCUA 4DV7C 5BUSA 5E7QA 3H2TA 1VLAA 5T8TA 4RVNA 4LFAC 4JI0C 5AE2A 4G1IA 2VSQA 4D4IA 5CZVA 4DG8A 5KYTA 3R44A 2E0GA 4KHPC 4PZPA 3DAYA 3B7WA 1UKKA 5KEIA 3E7WA 3L8CA 4RM2A 2OPLB 4NDNA 2E8FA 3DLPX 4D56A 4MTNA 2D1QA 2P2QA 4L4QA 4PROC 4AQYC 1J5EC 1USPB 1RG9A 1MDFA 4RLFA 4FTFA 4DV3C 1O90A 3TUFA 3CJEA 3N54B 5BSTA 3TQIA 5LMUC 3A9UA 1XMQC 4OYCA 1MXBA 4X62C 4L2ZA 3GKUA 3PROC 2PT7G 1ML8A 3CW9A 1WF3A 2AYAA 5IWAC 2HHHC 1XRBA 3UZ0A 4LF5C 3A9VA 3FCCA 5AE3A 4DR3C 2UUAC 4XX2A 2VQFC 5IFIA 4EATA 5LMNC 2DPLA 2Y4OA 4GKJC 4JI2C 3IMLA 4B3RC 2OBVA 2Y4NA 1L2FA 3IEUA 4DV1C 2UXBC 4LFBC 3LNVA 5ADZA 5H9UA 1T5HX 4DUYC 4BSZA 3R9WA 2YWBA 2UU9C 3EERA 5FLXD 1XRCA 4JI1C 4FUTA 2JMPA 3I07A 4JI3C 2BH1X 1GPMA 2P2FA 4G36A 4DV2C 3VNSA 1HNZC 5A2QD 5JRHA 5A1GA 4GXQA 3N2QA 4ZLPA 3ETCA 4RLQA 4TPSB 3VNQA 2P02A 4LFCC 1O9TA 1HH2P 4G37A 2WD9A 3SO4A 2UXCC 4B3TC 2QVYX 4DR6C 4WV3A 2D1TA 2QVZX 4LF8C 4MH4A 4ODJA 2E8CA 4YHHC 5BURA 2D7VA 1NYEA 4HPVA 4K0BA 4D4GA 1HNXC 5BR8C 4DR2C 1O93A 3GPCA 5BUQA 1AMUA 4BBYA 1LCIA 3AF5A 2CXCA 4JI5C 3AF6A 4JYAC 4X64C 1I94C 3C5EA 4IR7A 4BCAA 4NXMC 4PHTA 2BJOA 3GR1A 4RMNA 3NPDA 1IBMC 4GS5A 1XMOC 4DV4C 1MKYA 2HJGA 2D27A 5K85A 2P2JA 5BSMA 4JI8C 4U5YD 4JI6C 3J80D 2P2MA 1P7LA 4DCVA 5AE1A 4D57A 3FCEA 4DR7C 1ULTA 3OTOC 3R9XA 2EGTA 2ONFA 4ISBA 3GR0A 2D1SA 5BSVA 3L95X 4RM3A 2V7BA 1N2FA 1K0RA 4I9GA 2E8EA 4DG9A 4DR5C 3NI2A 1IBLC 3J81D 2E7GA 4BC7A 4GKKC 3JAMD 4KTVA 4DCTA 2ATWA 1LQLA 5IT9D 1N33C 1XRAA 1O92A 3E7XA 5BSRA 4OX9C 4JM1A 3VNRA 1XNRC 4YY3C 2D1RA 5DV9A 2KZFA 4X65C 1N32C 4NXNC 1YJ7A 2QW0X 4X66C 4ZJZA 1T5DX 2QVXX 2E5LC 1HNWC 4LE5A 4BC9A 4LF9C 4LF7C 3NYRA 1PA4A 3DHVA 3LUSA 3UOWA 1BA3A 3I08A 2PN2A 4DUZC 1WH9A 1MDBA 1IBKC 1QM4A 3A4IA 3EQ6A 3KXWA 2ZM6C 5BSWA 3CW8X 1RY2A 4DV5C 2DYJA 5T8SA 2VQEC 4K0KC 4DR4C 4OXIA 2UXDC 2PROA 4NOZA 1XNQC 1PG3A 4DV6C 4B3SC 3PBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P7L A;  4L7I A;  4KTV A;  3RV2 A;  1O9T A;  1XRC A;  4LE5 A;  3TQI A;  1O93 A;  2DPL A;  4WS9 A;  3SO4 A;  1MXC A;  1XRA A;  1O92 A;  1MXA A;  1FUG A;  4L4Q A;  3IML A;  4KTT A;  5T8S A;  2YWC A;  1GPM A;  5A1I A;  1MXB A;  2OBV A;  3UOW A;  4L2Z A;  4ODJ A;  3S82 A;  5A1G A;  3TDE A;  5H9U A;  1XRB A;  1RG9 A;  1QM4 A;  3A4I A;  5T8T A;  4HPV A;  4K0B A;  2P02 A;  1O90 A;  5A19 A;  2YWB A;  4NDN A; 
#chains in the Genus database with same CATH topology
 1HR0 C;  3PES A;  1JOS A;  1MXA A;  4KTT A;  1NY8 A;  2YWC A;  2YX1 A;  4R1L A;  3ETO A;  2VZE A;  5BSU A;  1V26 A;  3G7S A;  4LF4 C;  3LGX A;  4PUG A;  5A19 A;  4B3M C;  2M5O A;  1EGA A;  3LAX A;  1ZB9 A;  2ASB A;  1MD9 A;  2UUC C;  2P2B A;  1IB8 A;  1FUG A;  2Z51 A;  3NYQ A;  2XR1 A;  1ZB8 A;  4DR1 C;  2Y27 A;  4RVO A;  4JI7 C;  1N34 C;  2OPL A;  5KYV A;  2OO4 A;  1WCJ A;  3IPL A;  4L7I A;  3RV2 A;  2F4V C;  4R0M A;  4JV5 C;  2P20 A;  1P4E A;  2D28 C;  1MXC A;  1XHJ A;  3T1Y C;  1PG4 A;  5A1I A;  4FUQ A;  5CZX A;  4GXR A;  2CY1 A;  4LF6 C;  1KKG A;  4IZ6 A;  1USP A;  1V25 A;  3TDE A;  3CQ3 A;  1FJG C;  3RG2 A;  2YCB A;  2CU6 A;  5GTD A;  2UUB C;  4R1M A;  5K8F A;  1QWI A;  4JI4 C;  4I9F A;  2WP0 C;  4DCS A;  4WS9 A;  1N36 C;  3IEV A;  2QL8 A;  4DV0 C;  1PU1 A;  3T1H C;  3S82 A;  4DCU A;  4DV7 C;  5BUS A;  2KDN A;  3H2T A;  5E7Q A;  2ZZN A;  1VLA A;  5T8T A;  4RVN A;  4LFA C;  3LNO A;  4JI0 C;  5AE2 A;  4G1I A;  1V60 A;  2VSQ A;  4D4I A;  5CZV A;  4DG8 A;  5KYT A;  3R44 A;  1XS3 A;  2E0G A;  4KHP C;  4PZP A;  3DAY A;  3B7W A;  1UKK A;  5KEI A;  3E7W A;  3L8C A;  4RM2 A;  2OPL B;  4NDN A;  1M6X C;  2E8F A;  3DLP X;  4D56 A;  4MTN A;  2D1Q A;  2P2Q A;  4L4Q A;  4PRO C;  4AQY C;  1J5E C;  1USP B;  1RG9 A;  1MDF A;  4RLF A;  4FTF A;  4DV3 C;  1O90 A;  2MM9 A;  3TUF A;  3CJE A;  3N54 B;  5BST A;  3TQI A;  2JNV A;  3A9U A;  5LMU C;  1XMQ C;  4OYC A;  1MXB A;  4X62 C;  4L2Z A;  3GKU A;  3PRO C;  2PT7 G;  1ML8 A;  2M5H A;  3CW9 A;  1WF3 A;  2AYA A;  5IWA C;  2HHH C;  1XRB A;  3UZ0 A;  4LF5 C;  3A9V A;  3FCC A;  5AE3 A;  4DR3 C;  2UUA C;  4XX2 A;  2VQF C;  5IFI A;  4EAT A;  5LMN C;  2DPL A;  2Y4O A;  3A25 A;  4GKJ C;  2KZ0 A;  2NCL A;  4JI2 C;  3IML A;  4B3R C;  5LCI A;  2OBV A;  2Y4N A;  3CQ2 A;  1L2F A;  3IEU A;  4DV1 C;  2UXB C;  4LFB C;  3LNV A;  5ADZ A;  5H9U A;  1T5H X;  4DUY C;  3UEB A;  4BSZ A;  3R9W A;  2YWB A;  2UU9 C;  3EER A;  5FLX D;  1XRC A;  4JI1 C;  4FUT A;  2JMP A;  3I07 A;  4JI3 C;  2BH1 X;  1GPM A;  2P2F A;  4G36 A;  4DV2 C;  3VNS A;  1HNZ C;  5A2Q D;  5JRH A;  5A1G A;  4GXQ A;  3N2Q A;  4ZLP A;  3ETC A;  4RLQ A;  4TPS B;  3AY0 A;  3VNQ A;  1P4E C;  2P02 A;  4LFC C;  1O9T A;  1HH2 P;  4G37 A;  2WD9 A;  3SO4 A;  2UXC C;  4B3T C;  3UX2 A;  2QVY X;  4DR6 C;  4WV3 A;  2D1T A;  2QVZ X;  4LF8 C;  4MH4 A;  4ODJ A;  2E8C A;  4YHH C;  5BUR A;  2D7V A;  1NYE A;  4HPV A;  4K0B A;  4D4G A;  1HNX C;  5BR8 C;  4DR2 C;  1O93 A;  3GPC A;  5BUQ A;  1AMU A;  4BBY A;  1LCI A;  3AF5 A;  2CXC A;  4JI5 C;  3AF6 A;  4JYA C;  4X64 C;  1I94 C;  3C5E A;  4IR7 A;  1UWD A;  4BCA A;  4NXM C;  1FLO A;  4PHT A;  2BJO A;  3GR1 A;  4RMN A;  1VEH A;  3NPD A;  1IBM C;  4GS5 A;  1XMO C;  4DV4 C;  1MKY A;  1TH5 A;  2D27 A;  2HJG A;  5K85 A;  2P2J A;  5BSM A;  4JI8 C;  4U5Y D;  4JI6 C;  3J80 D;  2P2M A;  1P7L A;  4DCV A;  5AE1 A;  4D57 A;  3FCE A;  4DR7 C;  1ULT A;  3OTO C;  3R9X A;  2EGT A;  2ONF A;  4ISB A;  3GR0 A;  2D1S A;  3UX3 A;  5BSV A;  3L95 X;  4RM3 A;  2V7B A;  1N2F A;  1K0R A;  4I9G A;  2E8E A;  4DG9 A;  4DR5 C;  2MCQ A;  3NI2 A;  1IBL C;  3J81 D;  2E7G A;  4BC7 A;  4GKK C;  3JAM D;  4KTV A;  4DCT A;  3O2E A;  2ATW A;  1LQL A;  5IT9 D;  1N33 C;  1XRA A;  1O92 A;  3E7X A;  5BSR A;  4OX9 C;  4JM1 A;  3VNR A;  1XNR C;  4YY3 C;  2D1R A;  5DV9 A;  2KZF A;  4X65 C;  1N32 C;  2DHM A;  4NXN C;  1YJ7 A;  2QW0 X;  4X66 C;  4ZJZ A;  1T5D X;  2QVX X;  2E5L C;  1HNW C;  4LE5 A;  4BC9 A;  4LF9 C;  4LF7 C;  3NYR A;  3CQ1 A;  1PA4 A;  3DHV A;  2ZZM A;  3LUS A;  1M6X A;  3UOW A;  1BA3 A;  3I08 A;  3K6R A;  2PN2 A;  4DUZ C;  1WH9 A;  1MDB A;  1IBK C;  1QM4 A;  3A4I A;  3EQ6 A;  4PUI A;  3KXW A;  3TR3 A;  2ZM6 C;  5BSW A;  3CW8 X;  1RY2 A;  4DV5 C;  2DYJ A;  5T8S A;  4PUH A;  2MMA B;  2VQE C;  4K0K C;  4DR4 C;  4OXI A;  2UXD C;  2PRO A;  4NOZ A;  1XNQ C;  1PG3 A;  4DV6 C;  4B3S C;  3PBK A;  3A26 A; 
#chains in the Genus database with same CATH homology
 1HR0 C;  3PES A;  1JOS A;  1MXA A;  4KTT A;  2YWC A;  4R1L A;  3ETO A;  2VZE A;  5BSU A;  1V26 A;  3G7S A;  4LF4 C;  3LGX A;  5A19 A;  4B3M C;  1EGA A;  3LAX A;  1ZB9 A;  2ASB A;  1MD9 A;  2UUC C;  2P2B A;  1FUG A;  3NYQ A;  2XR1 A;  1ZB8 A;  4DR1 C;  2Y27 A;  4RVO A;  4JI7 C;  1N34 C;  2OPL A;  5KYV A;  2OO4 A;  3IPL A;  4L7I A;  3RV2 A;  2F4V C;  4R0M A;  4JV5 C;  2P20 A;  2D28 C;  1MXC A;  3T1Y C;  1PG4 A;  5A1I A;  4FUQ A;  5CZX A;  4GXR A;  2CY1 A;  4LF6 C;  1KKG A;  4IZ6 A;  1USP A;  1V25 A;  3TDE A;  1FJG C;  3RG2 A;  2YCB A;  5GTD A;  2UUB C;  4R1M A;  5K8F A;  1QWI A;  4JI4 C;  4I9F A;  2WP0 C;  4DCS A;  4WS9 A;  1N36 C;  3IEV A;  2QL8 A;  4DV0 C;  3T1H C;  3S82 A;  4DCU A;  4DV7 C;  5BUS A;  5E7Q A;  3H2T A;  1VLA A;  5T8T A;  4RVN A;  4LFA C;  4JI0 C;  5AE2 A;  4G1I A;  2VSQ A;  4D4I A;  5CZV A;  4DG8 A;  5KYT A;  3R44 A;  2E0G A;  4KHP C;  4PZP A;  3DAY A;  3B7W A;  1UKK A;  5KEI A;  3E7W A;  3L8C A;  4RM2 A;  2OPL B;  4NDN A;  2E8F A;  3DLP X;  4D56 A;  4MTN A;  2D1Q A;  2P2Q A;  4L4Q A;  4PRO C;  4AQY C;  1J5E C;  1USP B;  1RG9 A;  1MDF A;  4RLF A;  4FTF A;  4DV3 C;  1O90 A;  3TUF A;  3CJE A;  3N54 B;  5BST A;  3TQI A;  5LMU C;  3A9U A;  1XMQ C;  4OYC A;  1MXB A;  4X62 C;  4L2Z A;  3GKU A;  3PRO C;  2PT7 G;  1ML8 A;  3CW9 A;  1WF3 A;  2AYA A;  5IWA C;  2HHH C;  1XRB A;  3UZ0 A;  4LF5 C;  3A9V A;  3FCC A;  5AE3 A;  4DR3 C;  2UUA C;  4XX2 A;  2VQF C;  5IFI A;  4EAT A;  5LMN C;  2DPL A;  2Y4O A;  4GKJ C;  4JI2 C;  3IML A;  4B3R C;  2OBV A;  2Y4N A;  1L2F A;  3IEU A;  4DV1 C;  2UXB C;  4LFB C;  3LNV A;  5ADZ A;  5H9U A;  1T5H X;  4DUY C;  4BSZ A;  3R9W A;  2YWB A;  2UU9 C;  3EER A;  5FLX D;  1XRC A;  4JI1 C;  4FUT A;  2JMP A;  3I07 A;  4JI3 C;  2BH1 X;  1GPM A;  2P2F A;  4G36 A;  4DV2 C;  3VNS A;  1HNZ C;  5A2Q D;  5JRH A;  5A1G A;  4GXQ A;  3N2Q A;  4ZLP A;  3ETC A;  4RLQ A;  4TPS B;  3VNQ A;  2P02 A;  4LFC C;  1O9T A;  1HH2 P;  4G37 A;  2WD9 A;  3SO4 A;  2UXC C;  4B3T C;  2QVY X;  4DR6 C;  4WV3 A;  2D1T A;  2QVZ X;  4LF8 C;  4MH4 A;  4ODJ A;  2E8C A;  4YHH C;  5BUR A;  2D7V A;  1NYE A;  4HPV A;  4K0B A;  4D4G A;  1HNX C;  5BR8 C;  4DR2 C;  1O93 A;  3GPC A;  5BUQ A;  1AMU A;  4BBY A;  1LCI A;  3AF5 A;  2CXC A;  4JI5 C;  3AF6 A;  4JYA C;  4X64 C;  1I94 C;  3C5E A;  4IR7 A;  4BCA A;  4NXM C;  4PHT A;  2BJO A;  3GR1 A;  4RMN A;  3NPD A;  1IBM C;  4GS5 A;  1XMO C;  4DV4 C;  1MKY A;  2HJG A;  2D27 A;  5K85 A;  2P2J A;  5BSM A;  4JI8 C;  4U5Y D;  4JI6 C;  3J80 D;  2P2M A;  1P7L A;  4DCV A;  5AE1 A;  4D57 A;  3FCE A;  4DR7 C;  1ULT A;  3OTO C;  3R9X A;  2EGT A;  2ONF A;  4ISB A;  3GR0 A;  2D1S A;  5BSV A;  3L95 X;  4RM3 A;  2V7B A;  1N2F A;  1K0R A;  4I9G A;  2E8E A;  4DG9 A;  4DR5 C;  3NI2 A;  1IBL C;  3J81 D;  2E7G A;  4BC7 A;  4GKK C;  3JAM D;  4KTV A;  4DCT A;  2ATW A;  1LQL A;  5IT9 D;  1N33 C;  1XRA A;  1O92 A;  3E7X A;  5BSR A;  4OX9 C;  4JM1 A;  3VNR A;  1XNR C;  4YY3 C;  2D1R A;  5DV9 A;  2KZF A;  4X65 C;  1N32 C;  4NXN C;  1YJ7 A;  2QW0 X;  4X66 C;  4ZJZ A;  1T5D X;  2QVX X;  2E5L C;  1HNW C;  4LE5 A;  4BC9 A;  4LF9 C;  4LF7 C;  3NYR A;  1PA4 A;  3DHV A;  3LUS A;  3UOW A;  1BA3 A;  3I08 A;  2PN2 A;  4DUZ C;  1WH9 A;  1MDB A;  1IBK C;  1QM4 A;  3A4I A;  3EQ6 A;  3KXW A;  2ZM6 C;  5BSW A;  3CW8 X;  1RY2 A;  4DV5 C;  2DYJ A;  5T8S A;  2VQE C;  4K0K C;  4DR4 C;  4OXI A;  2UXD C;  2PRO A;  4NOZ A;  1XNQ C;  1PG3 A;  4DV6 C;  4B3S C;  3PBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...