1FUGA

S-adenosylmethionine synthetase
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
Knots found
sequence length
383
structure length
383
Chain Sequence
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Flexible loop in the structure of S-adenosylmethionine synthetase crystallized in the tetragonal modification.
pubmed rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords S-ADENOSYLMETHIONINE SYNTHETASE
total genus 90
structure length 383
sequence length 383
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 1996-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1fugA03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1fugA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1fugA01
4L2ZA 3TQIA 1XRBA 4NDNA 3A4IA 4L7IA 3TDEA 4ODJA 5A1GA 4K0BA 1RG9A 4HPVA 5A1IA 4WS9A 1MXCA 1GPMA 1MXAA 1XRCA 2OBVA 1O92A 5A19A 3SO4A 2P02A 4KTVA 2YWBA 5T8TA 5T8SA 1MXBA 4LE5A 3S82A 2DPLA 3RV2A 3IMLA 2YWCA 1O9TA 4KTTA 4L4QA 3UOWA 1FUGA 1O90A 1QM4A 1XRAA 5H9UA 1O93A 1P7LA
chains in the Genus database with same CATH superfamily
4B3SC 4PZPA 3CW9A 4JI6C 1J5EC 1N36C 3I08A 3SO4A 4R1MA 2WD9A 4BC9A 1PG3A 2VZEA 4LE5A 5JRHA 5IT9D 5KYTA 4I9GA 3R9XA 2MM9A 1XHJA 3PBKA 5LMNC 4X65C 1MDFA 4L7IA 2V7BA 4DR5C 4DV5C 4HPVA 4RM2A 5A1IA 2OO4A 4RLQA 1XS3A 3LNVA 4X64C 4RM3A 3NYQA 4LF7C 4DCUA 1PG4A 3S82A 1QWIA 2E5LC 4DR3C 4IZ6A 5BSWA 4G36A 5LCIA 2E8EA 3FCEA 5DV9A 3K6RA 1V25A 2BJOA 3O2EA 4ZJZA 5T8SA 5KYVA 1NY8A 3G7SA 3KXWA 1I94C 3DAYA 5GTDA 5BUSA 4DV2C 1T5DX 3IEVA 3T1YC 3AY0A 3TUFA 2WP0C 1LCIA 1GPMA 2VSQA 1YJ7A 3L95X 2P2QA 4YY3C 1IBKC 5BSVA 4MTNA 3FCCA 1TH5A 3PROC 2XR1A 4DCSA 1M6XC 2ASBA 2ZZMA 1XNRC 1MD9A 1MDBA 3R44A 2MMAB 4JM1A 4JI2C 2BH1X 5BSMA 4DCVA 4PUIA 3E7XA 2UUAC 4DR4C 4ISBA 3UX2A 2DYJA 1MKYA 2OBVA 4MH4A 3GKUA 1O92A 4NOZA 4B3RC 2ONFA 1HNWC 2JNVA 1L2FA 4GKJC 4U5YD 4IR7A 3T1HC 4D4GA 4DR1C 3AF5A 3ETCA 2OPLA 1WH9A 4GXQA 4RVNA 1HNXC 3H2TA 2QVYX 1MXCA 3LAXA 3NYRA 5BUQA 2M5HA 2YWBA 2E7GA 1JOSA 1USPA 2P2FA 5BSRA 2JMPA 1N34C 5H9UA 4X66C 2P2BA 2QVZX 4L2ZA 4RVOA 2CY1A 1VLAA 4NDNA 4DV6C 4JI7C 2F4VC 5AE2A 2PN2A 3C5EA 1USPB 4WS9A 4R0MA 4X62C 2VQEC 2P02A 5AE1A 3GPCA 2CXCA 3UEBA 3RV2A 4JI8C 5K85A 5BURA 4WV3A 5AE3A 5IFIA 4G37A 1FLOA 5E7QA 2QW0X 2D27A 2Z51A 2D7VA 1HR0C 2OPLB 2EGTA 3TDEA 3CQ1A 2ATWA 4I9FA 5A1GA 1IB8A 1ZB9A 4K0BA 4BCAA 3A25A 3A9VA 1XMQC 2PT7G 1FJGC 4DR7C 2Y27A 5IWAC 3CJEA 3LNOA 2E0GA 3VNSA 2D1SA 3EERA 3DHVA 3DLPX 1IBMC 5CZXA 4DV7C 4GKKC 3OTOC 2NCLA 3L8CA 1ULTA 4DG8A 4D57A 3IPLA 2UXBC 5KEIA 4LF4C 1NYEA 1T5HX 1XMOC 4DUZC 1N2FA 1V60A 2D28C 5LMUC 1O93A 4LF9C 4K0KC 3E7WA 4KHPC 3CQ3A 4PHTA 4JI4C 4BSZA 2UXDC 4JYAC 1UKKA 2UXCC 1MXAA 1XRCA 4BC7A 2Y4NA 2KDNA 2DPLA 4GS5A 4LF8C 1QM4A 5BSTA 1P7LA 4NXMC 4LFBC 4JI1C 4ZLPA 4B3TC 4DUYC 1HH2P 4LF5C 3LUSA 3PESA 3GR0A 3CQ2A 5A19A 4JI3C 1UWDA 1XNQC 1ZB8A 4FUQA 2MCQA 4D4IA 3N54B 3RG2A 3EQ6A 4FUTA 3AF6A 1XRBA 1K0RA 2D1QA 1PA4A 1BA3A 1VEHA 3ETOA 1M6XA 2KZ0A 4R1LA 4PUGA 3JAMD 2QL8A 5FLXD 2E8FA 2ZZNA 3CW8X 4DCTA 1HNZC 4JI0C 2ZM6C 1RY2A 5K8FA 4TPSB 4BBYA 3I07A 3GR1A 2QVXX 4XX2A 2UUBC 1RG9A 2YX1A 2P20A 4FTFA 1ML8A 4DR2C 2HHHC 3UZ0A 1PU1A 4YHHC 5CZVA 3UOWA 1P4EC 2UUCC 4OXIA 3A4IA 2P2JA 4ODJA 3TR3A 4DV4C 1N33C 1N32C 3VNQA 4DG9A 3LGXA 4OX9C 1WF3A 2AYAA 2PROA 1LQLA 5BSUA 4KTVA 5T8TA 2YCBA 4RLFA 1MXBA 3IMLA 2YWCA 2HJGA 2P2MA 2Y4OA 1O90A 1XRAA 2E8CA 1V26A 4GXRA 1WCJA 3J80D 4LF6C 2VQFC 4DR6C 4PUHA 5A2QD 4JI5C 2M5OA 3N2QA 3R9WA 3J81D 4DV0C 2UU9C 4DV1C 2D1RA 3IEUA 4NXNC 3NPDA 4RMNA 4LFCC 4L4QA 5BR8C 2DHMA 4DV3C 5ADZA 4OYCA 3A26A 3VNRA 1EGAA 3TQIA 1AMUA 3A9UA 2KZFA 3B7WA 2D1TA 4AQYC 4PROC 4B3MC 3NI2A 1KKGA 4G1IA 4JV5C 4LFAC 1O9TA 4KTTA 4EATA 2CU6A 1FUGA 1IBLC 3UX3A 1P4EA 4D56A
chains in the Genus database with same CATH topology
4B3SC 4PZPA 3CW9A 4JI6C 1J5EC 1N36C 3I08A 3SO4A 4R1MA 2WD9A 4BC9A 1PG3A 2VZEA 4LE5A 5JRHA 5IT9D 5KYTA 4I9GA 3R9XA 3PBKA 5LMNC 4X65C 1MDFA 4L7IA 2V7BA 4DR5C 4DV5C 4HPVA 4RM2A 5A1IA 2OO4A 4RLQA 3LNVA 4X64C 4RM3A 3NYQA 4LF7C 4DCUA 1PG4A 3S82A 1QWIA 2E5LC 4DR3C 4IZ6A 5BSWA 4G36A 2E8EA 3FCEA 5DV9A 1V25A 2BJOA 4ZJZA 5T8SA 5KYVA 3G7SA 3KXWA 1I94C 3DAYA 5GTDA 5BUSA 4DV2C 1T5DX 3IEVA 3T1YC 3TUFA 2WP0C 1LCIA 1GPMA 2VSQA 1YJ7A 3L95X 2P2QA 4YY3C 1IBKC 5BSVA 4MTNA 3FCCA 3PROC 2XR1A 4DCSA 2ASBA 1XNRC 1MD9A 1MDBA 3R44A 4JM1A 4JI2C 2BH1X 5BSMA 4DCVA 3E7XA 2UUAC 4DR4C 4ISBA 2DYJA 1MKYA 2OBVA 4MH4A 3GKUA 1O92A 4NOZA 4B3RC 2ONFA 1HNWC 1L2FA 4GKJC 4U5YD 4IR7A 3T1HC 4D4GA 4DR1C 3AF5A 3ETCA 2OPLA 1WH9A 4GXQA 4RVNA 1HNXC 3H2TA 2QVYX 1MXCA 3LAXA 3NYRA 5BUQA 2YWBA 2E7GA 1JOSA 1USPA 2P2FA 5BSRA 2JMPA 1N34C 5H9UA 4X66C 2P2BA 2QVZX 4L2ZA 4RVOA 2CY1A 1VLAA 4NDNA 4DV6C 4JI7C 2F4VC 5AE2A 2PN2A 3C5EA 1USPB 4WS9A 4R0MA 4X62C 2VQEC 2P02A 5AE1A 3GPCA 2CXCA 3RV2A 4JI8C 5K85A 5BURA 4WV3A 5AE3A 5IFIA 4G37A 5E7QA 2QW0X 2D27A 2D7VA 1HR0C 2OPLB 2EGTA 3TDEA 2ATWA 4I9FA 5A1GA 1ZB9A 4K0BA 4BCAA 3A9VA 1XMQC 2PT7G 1FJGC 4DR7C 2Y27A 5IWAC 3CJEA 2E0GA 3VNSA 2D1SA 3EERA 3DHVA 3DLPX 1IBMC 5CZXA 4DV7C 4GKKC 3OTOC 3L8CA 1ULTA 4DG8A 4D57A 3IPLA 2UXBC 5KEIA 4LF4C 1NYEA 1T5HX 1XMOC 4DUZC 1N2FA 2D28C 5LMUC 1O93A 4LF9C 4K0KC 3E7WA 4KHPC 4PHTA 4JI4C 4BSZA 2UXDC 4JYAC 1UKKA 2UXCC 1MXAA 1XRCA 4BC7A 2Y4NA 2DPLA 4GS5A 4LF8C 1QM4A 5BSTA 1P7LA 4NXMC 4LFBC 4JI1C 4ZLPA 4B3TC 4DUYC 1HH2P 4LF5C 3LUSA 3PESA 3GR0A 5A19A 4JI3C 1XNQC 1ZB8A 4FUQA 4D4IA 3N54B 3RG2A 3EQ6A 4FUTA 3AF6A 1XRBA 1K0RA 2D1QA 1PA4A 1BA3A 3ETOA 4R1LA 3JAMD 2QL8A 5FLXD 2E8FA 3CW8X 4DCTA 1HNZC 4JI0C 2ZM6C 1RY2A 5K8FA 4TPSB 4BBYA 3I07A 3GR1A 2QVXX 4XX2A 2UUBC 1RG9A 2P20A 4FTFA 1ML8A 4DR2C 2HHHC 3UZ0A 4YHHC 5CZVA 3UOWA 2UUCC 4OXIA 3A4IA 2P2JA 4ODJA 4DV4C 1N33C 1N32C 3VNQA 4DG9A 3LGXA 4OX9C 1WF3A 2AYAA 2PROA 1LQLA 5BSUA 4KTVA 5T8TA 2YCBA 4RLFA 1MXBA 3IMLA 2YWCA 2HJGA 2P2MA 2Y4OA 1O90A 1XRAA 2E8CA 1V26A 4GXRA 3J80D 4LF6C 2VQFC 4DR6C 5A2QD 4JI5C 3N2QA 3R9WA 3J81D 4DV0C 2UU9C 4DV1C 2D1RA 3IEUA 4NXNC 3NPDA 4RMNA 4LFCC 4L4QA 5BR8C 4DV3C 5ADZA 4OYCA 3VNRA 1EGAA 3TQIA 1AMUA 3A9UA 2KZFA 3B7WA 2D1TA 4AQYC 4PROC 4B3MC 3NI2A 1KKGA 4G1IA 4JV5C 4LFAC 1O9TA 4KTTA 4EATA 1FUGA 1IBLC 4D56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L2Z A;  3TQI A;  1XRB A;  4NDN A;  3A4I A;  4L7I A;  3TDE A;  4ODJ A;  5A1G A;  4K0B A;  1RG9 A;  4HPV A;  5A1I A;  4WS9 A;  1MXC A;  1GPM A;  1MXA A;  1XRC A;  2OBV A;  1O92 A;  5A19 A;  3SO4 A;  2P02 A;  4KTV A;  2YWB A;  5T8T A;  5T8S A;  1MXB A;  4LE5 A;  3S82 A;  2DPL A;  3RV2 A;  3IML A;  2YWC A;  1O9T A;  4KTT A;  4L4Q A;  3UOW A;  1FUG A;  1O90 A;  1QM4 A;  1XRA A;  5H9U A;  1O93 A;  1P7L A; 
#chains in the Genus database with same CATH topology
 4B3S C;  4PZP A;  3CW9 A;  4JI6 C;  1J5E C;  1N36 C;  3I08 A;  3SO4 A;  4R1M A;  2WD9 A;  4BC9 A;  1PG3 A;  2VZE A;  4LE5 A;  5JRH A;  5IT9 D;  5KYT A;  4I9G A;  3R9X A;  2MM9 A;  1XHJ A;  3PBK A;  5LMN C;  4X65 C;  1MDF A;  4L7I A;  2V7B A;  4DR5 C;  4DV5 C;  4HPV A;  4RM2 A;  5A1I A;  2OO4 A;  4RLQ A;  1XS3 A;  3LNV A;  4X64 C;  4RM3 A;  3NYQ A;  4LF7 C;  4DCU A;  1PG4 A;  3S82 A;  1QWI A;  2E5L C;  4DR3 C;  4IZ6 A;  5BSW A;  4G36 A;  5LCI A;  2E8E A;  3FCE A;  5DV9 A;  3K6R A;  1V25 A;  2BJO A;  3O2E A;  4ZJZ A;  5T8S A;  5KYV A;  1NY8 A;  3G7S A;  3KXW A;  1I94 C;  3DAY A;  5GTD A;  5BUS A;  4DV2 C;  1T5D X;  3IEV A;  3T1Y C;  3AY0 A;  3TUF A;  2WP0 C;  1LCI A;  1GPM A;  2VSQ A;  1YJ7 A;  3L95 X;  2P2Q A;  4YY3 C;  1IBK C;  5BSV A;  4MTN A;  3FCC A;  1TH5 A;  3PRO C;  2XR1 A;  4DCS A;  1M6X C;  2ASB A;  2ZZM A;  1XNR C;  1MD9 A;  1MDB A;  3R44 A;  2MMA B;  4JM1 A;  4JI2 C;  2BH1 X;  5BSM A;  4DCV A;  4PUI A;  3E7X A;  2UUA C;  4DR4 C;  4ISB A;  3UX2 A;  2DYJ A;  1MKY A;  2OBV A;  4MH4 A;  3GKU A;  1O92 A;  4NOZ A;  4B3R C;  2ONF A;  1HNW C;  2JNV A;  1L2F A;  4GKJ C;  4U5Y D;  4IR7 A;  3T1H C;  4D4G A;  4DR1 C;  3AF5 A;  3ETC A;  2OPL A;  1WH9 A;  4GXQ A;  4RVN A;  1HNX C;  3H2T A;  2QVY X;  1MXC A;  3LAX A;  3NYR A;  5BUQ A;  2M5H A;  2YWB A;  2E7G A;  1JOS A;  1USP A;  2P2F A;  5BSR A;  2JMP A;  1N34 C;  5H9U A;  4X66 C;  2P2B A;  2QVZ X;  4L2Z A;  4RVO A;  2CY1 A;  1VLA A;  4NDN A;  4DV6 C;  4JI7 C;  2F4V C;  5AE2 A;  2PN2 A;  3C5E A;  1USP B;  4WS9 A;  4R0M A;  4X62 C;  2VQE C;  2P02 A;  5AE1 A;  3GPC A;  2CXC A;  3UEB A;  3RV2 A;  4JI8 C;  5K85 A;  5BUR A;  4WV3 A;  5AE3 A;  5IFI A;  4G37 A;  1FLO A;  5E7Q A;  2QW0 X;  2D27 A;  2Z51 A;  2D7V A;  1HR0 C;  2OPL B;  2EGT A;  3TDE A;  3CQ1 A;  2ATW A;  4I9F A;  5A1G A;  1IB8 A;  1ZB9 A;  4K0B A;  4BCA A;  3A25 A;  3A9V A;  1XMQ C;  2PT7 G;  1FJG C;  4DR7 C;  2Y27 A;  5IWA C;  3CJE A;  3LNO A;  2E0G A;  3VNS A;  2D1S A;  3EER A;  3DHV A;  3DLP X;  1IBM C;  5CZX A;  4DV7 C;  4GKK C;  3OTO C;  2NCL A;  3L8C A;  1ULT A;  4DG8 A;  4D57 A;  3IPL A;  2UXB C;  5KEI A;  4LF4 C;  1NYE A;  1T5H X;  1XMO C;  4DUZ C;  1N2F A;  1V60 A;  2D28 C;  5LMU C;  1O93 A;  4LF9 C;  4K0K C;  3E7W A;  4KHP C;  3CQ3 A;  4PHT A;  4JI4 C;  4BSZ A;  2UXD C;  4JYA C;  1UKK A;  2UXC C;  1MXA A;  1XRC A;  4BC7 A;  2Y4N A;  2KDN A;  2DPL A;  4GS5 A;  4LF8 C;  1QM4 A;  5BST A;  1P7L A;  4NXM C;  4LFB C;  4JI1 C;  4ZLP A;  4B3T C;  4DUY C;  1HH2 P;  4LF5 C;  3LUS A;  3PES A;  3GR0 A;  3CQ2 A;  5A19 A;  4JI3 C;  1UWD A;  1XNQ C;  1ZB8 A;  4FUQ A;  2MCQ A;  4D4I A;  3N54 B;  3RG2 A;  3EQ6 A;  4FUT A;  3AF6 A;  1XRB A;  1K0R A;  2D1Q A;  1PA4 A;  1BA3 A;  1VEH A;  3ETO A;  1M6X A;  2KZ0 A;  4R1L A;  4PUG A;  3JAM D;  2QL8 A;  5FLX D;  2E8F A;  2ZZN A;  3CW8 X;  4DCT A;  1HNZ C;  4JI0 C;  2ZM6 C;  1RY2 A;  5K8F A;  4TPS B;  4BBY A;  3I07 A;  3GR1 A;  2QVX X;  4XX2 A;  2UUB C;  1RG9 A;  2YX1 A;  2P20 A;  4FTF A;  1ML8 A;  4DR2 C;  2HHH C;  3UZ0 A;  1PU1 A;  4YHH C;  5CZV A;  3UOW A;  1P4E C;  2UUC C;  4OXI A;  3A4I A;  2P2J A;  4ODJ A;  3TR3 A;  4DV4 C;  1N33 C;  1N32 C;  3VNQ A;  4DG9 A;  3LGX A;  4OX9 C;  1WF3 A;  2AYA A;  2PRO A;  1LQL A;  5BSU A;  4KTV A;  5T8T A;  2YCB A;  4RLF A;  1MXB A;  3IML A;  2YWC A;  2HJG A;  2P2M A;  2Y4O A;  1O90 A;  1XRA A;  2E8C A;  1V26 A;  4GXR A;  1WCJ A;  3J80 D;  4LF6 C;  2VQF C;  4DR6 C;  4PUH A;  5A2Q D;  4JI5 C;  2M5O A;  3N2Q A;  3R9W A;  3J81 D;  4DV0 C;  2UU9 C;  4DV1 C;  2D1R A;  3IEU A;  4NXN C;  3NPD A;  4RMN A;  4LFC C;  4L4Q A;  5BR8 C;  2DHM A;  4DV3 C;  5ADZ A;  4OYC A;  3A26 A;  3VNR A;  1EGA A;  3TQI A;  1AMU A;  3A9U A;  2KZF A;  3B7W A;  2D1T A;  4AQY C;  4PRO C;  4B3M C;  3NI2 A;  1KKG A;  4G1I A;  4JV5 C;  4LFA C;  1O9T A;  4KTT A;  4EAT A;  2CU6 A;  1FUG A;  1IBL C;  3UX3 A;  1P4E A;  4D56 A; 
#chains in the Genus database with same CATH homology
 4B3S C;  4PZP A;  3CW9 A;  4JI6 C;  1J5E C;  1N36 C;  3I08 A;  3SO4 A;  4R1M A;  2WD9 A;  4BC9 A;  1PG3 A;  2VZE A;  4LE5 A;  5JRH A;  5IT9 D;  5KYT A;  4I9G A;  3R9X A;  3PBK A;  5LMN C;  4X65 C;  1MDF A;  4L7I A;  2V7B A;  4DR5 C;  4DV5 C;  4HPV A;  4RM2 A;  5A1I A;  2OO4 A;  4RLQ A;  3LNV A;  4X64 C;  4RM3 A;  3NYQ A;  4LF7 C;  4DCU A;  1PG4 A;  3S82 A;  1QWI A;  2E5L C;  4DR3 C;  4IZ6 A;  5BSW A;  4G36 A;  2E8E A;  3FCE A;  5DV9 A;  1V25 A;  2BJO A;  4ZJZ A;  5T8S A;  5KYV A;  3G7S A;  3KXW A;  1I94 C;  3DAY A;  5GTD A;  5BUS A;  4DV2 C;  1T5D X;  3IEV A;  3T1Y C;  3TUF A;  2WP0 C;  1LCI A;  1GPM A;  2VSQ A;  1YJ7 A;  3L95 X;  2P2Q A;  4YY3 C;  1IBK C;  5BSV A;  4MTN A;  3FCC A;  3PRO C;  2XR1 A;  4DCS A;  2ASB A;  1XNR C;  1MD9 A;  1MDB A;  3R44 A;  4JM1 A;  4JI2 C;  2BH1 X;  5BSM A;  4DCV A;  3E7X A;  2UUA C;  4DR4 C;  4ISB A;  2DYJ A;  1MKY A;  2OBV A;  4MH4 A;  3GKU A;  1O92 A;  4NOZ A;  4B3R C;  2ONF A;  1HNW C;  1L2F A;  4GKJ C;  4U5Y D;  4IR7 A;  3T1H C;  4D4G A;  4DR1 C;  3AF5 A;  3ETC A;  2OPL A;  1WH9 A;  4GXQ A;  4RVN A;  1HNX C;  3H2T A;  2QVY X;  1MXC A;  3LAX A;  3NYR A;  5BUQ A;  2YWB A;  2E7G A;  1JOS A;  1USP A;  2P2F A;  5BSR A;  2JMP A;  1N34 C;  5H9U A;  4X66 C;  2P2B A;  2QVZ X;  4L2Z A;  4RVO A;  2CY1 A;  1VLA A;  4NDN A;  4DV6 C;  4JI7 C;  2F4V C;  5AE2 A;  2PN2 A;  3C5E A;  1USP B;  4WS9 A;  4R0M A;  4X62 C;  2VQE C;  2P02 A;  5AE1 A;  3GPC A;  2CXC A;  3RV2 A;  4JI8 C;  5K85 A;  5BUR A;  4WV3 A;  5AE3 A;  5IFI A;  4G37 A;  5E7Q A;  2QW0 X;  2D27 A;  2D7V A;  1HR0 C;  2OPL B;  2EGT A;  3TDE A;  2ATW A;  4I9F A;  5A1G A;  1ZB9 A;  4K0B A;  4BCA A;  3A9V A;  1XMQ C;  2PT7 G;  1FJG C;  4DR7 C;  2Y27 A;  5IWA C;  3CJE A;  2E0G A;  3VNS A;  2D1S A;  3EER A;  3DHV A;  3DLP X;  1IBM C;  5CZX A;  4DV7 C;  4GKK C;  3OTO C;  3L8C A;  1ULT A;  4DG8 A;  4D57 A;  3IPL A;  2UXB C;  5KEI A;  4LF4 C;  1NYE A;  1T5H X;  1XMO C;  4DUZ C;  1N2F A;  2D28 C;  5LMU C;  1O93 A;  4LF9 C;  4K0K C;  3E7W A;  4KHP C;  4PHT A;  4JI4 C;  4BSZ A;  2UXD C;  4JYA C;  1UKK A;  2UXC C;  1MXA A;  1XRC A;  4BC7 A;  2Y4N A;  2DPL A;  4GS5 A;  4LF8 C;  1QM4 A;  5BST A;  1P7L A;  4NXM C;  4LFB C;  4JI1 C;  4ZLP A;  4B3T C;  4DUY C;  1HH2 P;  4LF5 C;  3LUS A;  3PES A;  3GR0 A;  5A19 A;  4JI3 C;  1XNQ C;  1ZB8 A;  4FUQ A;  4D4I A;  3N54 B;  3RG2 A;  3EQ6 A;  4FUT A;  3AF6 A;  1XRB A;  1K0R A;  2D1Q A;  1PA4 A;  1BA3 A;  3ETO A;  4R1L A;  3JAM D;  2QL8 A;  5FLX D;  2E8F A;  3CW8 X;  4DCT A;  1HNZ C;  4JI0 C;  2ZM6 C;  1RY2 A;  5K8F A;  4TPS B;  4BBY A;  3I07 A;  3GR1 A;  2QVX X;  4XX2 A;  2UUB C;  1RG9 A;  2P20 A;  4FTF A;  1ML8 A;  4DR2 C;  2HHH C;  3UZ0 A;  4YHH C;  5CZV A;  3UOW A;  2UUC C;  4OXI A;  3A4I A;  2P2J A;  4ODJ A;  4DV4 C;  1N33 C;  1N32 C;  3VNQ A;  4DG9 A;  3LGX A;  4OX9 C;  1WF3 A;  2AYA A;  2PRO A;  1LQL A;  5BSU A;  4KTV A;  5T8T A;  2YCB A;  4RLF A;  1MXB A;  3IML A;  2YWC A;  2HJG A;  2P2M A;  2Y4O A;  1O90 A;  1XRA A;  2E8C A;  1V26 A;  4GXR A;  3J80 D;  4LF6 C;  2VQF C;  4DR6 C;  5A2Q D;  4JI5 C;  3N2Q A;  3R9W A;  3J81 D;  4DV0 C;  2UU9 C;  4DV1 C;  2D1R A;  3IEU A;  4NXN C;  3NPD A;  4RMN A;  4LFC C;  4L4Q A;  5BR8 C;  4DV3 C;  5ADZ A;  4OYC A;  3VNR A;  1EGA A;  3TQI A;  1AMU A;  3A9U A;  2KZF A;  3B7W A;  2D1T A;  4AQY C;  4PRO C;  4B3M C;  3NI2 A;  1KKG A;  4G1I A;  4JV5 C;  4LFA C;  1O9T A;  4KTT A;  4EAT A;  1FUG A;  1IBL C;  4D56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...