1V60A

Solution structure of bola1 protein from mus musculus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
123
structure length
123
Chain Sequence
GSSGSSGMATRSCVSRGSAGSAAAGPVEAAIRAKLEQALSPEVLELRNESGGHAVPAGSETHFRVAVVSSRFEGMSPLQRHRLVHEALSEELAGPVHALAIQAKTPAQWRENPQLDISPPCLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIKEN cDNA 1810037G04
publication title Solution structure of BolA1 protein from Mus musculus
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 14
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2003-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 1v60A01
3TR3A 2MCQA 2KDNA 4PUIA 2KZ0A 2MM9A 5LCIA 2NCLA 3O2EA 2MMAB 2DHMA 1V60A 1XS3A 4PUGA 1NY8A 4PUHA
chains in the Genus database with same CATH superfamily
1MD9A 3UX3A 4X62C 5BR8C 2ZZMA 1NY8A 3GR0A 4D57A 4B3MC 1P4EC 4DCVA 2P2JA 4JI0C 1J5EC 4DV1C 3FCEA 2M5HA 5BUQA 1O92A 3EQ6A 2QVXX 1T5DX 3AF5A 3JAMD 2V7BA 5KYVA 2Z51A 3LNVA 4LF6C 4D56A 4JI3C 4JM1A 3VNSA 2VQEC 3DLPX 4DV7C 3E7XA 2VQFC 3J80D 4DR2C 3A9UA 2MMAB 4DUYC 5BURA 3TQIA 5BUSA 4KHPC 4R0MA 4PUIA 3UZ0A 2CXCA 4NDNA 4LF8C 1USPA 4JI6C 4B3SC 5AE1A 2UUBC 2P2BA 4LFBC 4JI4C 1YJ7A 4R1MA 4YY3C 4G1IA 5CZXA 3LAXA 1XRBA 3IMLA 5DV9A 4KTVA 3TUFA 3A26A 1HR0C 1ZB8A 1VEHA 3A25A 1VLAA 5IFIA 4DCTA 2P2QA 2CY1A 4ODJA 4JI1C 5AE3A 3I07A 4DG8A 4DV6C 4BSZA 2ONFA 4FUQA 4G36A 2UUCC 1PG3A 5E7QA 3SO4A 5LMNC 4LF5C 3DHVA 2E5LC 1O93A 3OTOC 2BH1X 2WP0C 2CU6A 4R1LA 3B7WA 3T1HC 5H9UA 2M5OA 5A2QD 1V60A 1N34C 1HH2P 2KDNA 4IZ6A 2UU9C 4JI7C 2MCQA 4B3RC 4TPSB 2YCBA 1N32C 3PBKA 4LF4C 2HHHC 5LMUC 3AY0A 3KXWA 1IB8A 2P02A 4BC7A 2E8CA 4DCSA 4DV0C 3NYRA 4L2ZA 1LQLA 1MDFA 4B3TC 1RG9A 4WV3A 4MH4A 4OX9C 4DR5C 4D4IA 3PESA 4HPVA 2QVYX 2DPLA 3LNOA 3L95X 1IBMC 2PT7G 4AQYC 2MM9A 1QWIA 1UWDA 2ZM6C 2D1RA 2KZFA 4XX2A 2P20A 4DCUA 4BBYA 4GKJC 2ATWA 2Y4OA 4ZLPA 2UUAC 4OXIA 4EATA 1PA4A 1WCJA 4BC9A 4YHHC 3IEUA 3C5EA 3A4IA 2D1TA 4OYCA 1O9TA 1N2FA 3O2EA 4DR7C 4GKKC 2WD9A 1HNXC 2YWBA 4X65C 5FLXD 3R9XA 2UXDC 3CQ2A 3TR3A 2QL8A 3VNRA 4JYAC 3I08A 4RLQA 5CZVA 2VSQA 1K0RA 4DV3C 1NYEA 1M6XA 5KYTA 4JI2C 4RM3A 3R9WA 1MKYA 4D4GA 4RVNA 2P2FA 3K6RA 1XS3A 2P2MA 1XNQC 4LE5A 4RMNA 5BSWA 4GS5A 1ZB9A 1N36C 4DG9A 3DAYA 1FJGC 3N2QA 1XMOC 3H2TA 2QW0X 5BSVA 1T5HX 1MXAA 3S82A 2JNVA 2OPLB 5BSTA 5T8SA 2PN2A 5LCIA 1I94C 5BSMA 2QVZX 4LFAC 4DR3C 2YWCA 4FTFA 1JOSA 2OO4A 1PU1A 4NXMC 4DV2C 4DV4C 1V26A 4K0KC 1PG4A 3NYQA 5BSUA 4X64C 1QM4A 2D27A 2NCLA 4FUTA 2D1SA 1BA3A 2D1QA 5K8FA 3E7WA 2E8FA 5K85A 1GPMA 3UX2A 3IEVA 3ETCA 1WH9A 3UOWA 1IBLC 3G7SA 2E0GA 4WS9A 3VNQA 2Y4NA 3NI2A 2XR1A 3ETOA 4GXRA 2OPLA 5ADZA 2E8EA 4NXNC 1MDBA 3R44A 1V25A 3GPCA 1IBKC 3FCCA 4ISBA 1KKGA 1USPB 4PUHA 3T1YC 1MXBA 3AF6A 4K0BA 1M6XC 4NOZA 2D7VA 5A1GA 3IPLA 4DR1C 1ULTA 4DR6C 2DHMA 1O90A 4DR4C 2YX1A 3GKUA 4ZJZA 3GR1A 3CQ3A 2UXCC 3RG2A 3CW9A 4U5YD 2JMPA 2ZZNA 4G37A 5IT9D 1XNRC 1P4EA 5A1IA 4RM2A 4JV5C 2EGTA 2HJGA 2E7GA 2VZEA 3PROC 1AMUA 1XHJA 3RV2A 5BSRA 3CW8X 3TDEA 5IWAC 1TH5A 1XRCA 4L4QA 4X66C 1FUGA 5GTDA 2DYJA 2PROA 5KEIA 3N54B 1XMQC 2Y27A 4GXQA 3UEBA 4L7IA 4RVOA 4PUGA 5T8TA 4BCAA 4LFCC 1HNWC 4PROC 3J81D 4I9GA 5JRHA 1L2FA 4LF9C 4IR7A 2ASBA 1EGAA 1ML8A 4DV5C 1MXCA 4JI5C 3NPDA 1FLOA 4DUZC 4JI8C 4KTTA 4I9FA 3A9VA 3LGXA 4MTNA 5A19A 3CQ1A 2KZ0A 2AYAA 2OBVA 2BJOA 3L8CA 4PHTA 3LUSA 2D28C 4PZPA 5AE2A 1WF3A 3EERA 1HNZC 4LF7C 1XRAA 1P7LA 1RY2A 1UKKA 4RLFA 2F4VC 2UXBC 1LCIA 3CJEA 1N33C
chains in the Genus database with same CATH topology
3TR3A 2MCQA 2KDNA 4PUIA 2KZ0A 2MM9A 5LCIA 2NCLA 3O2EA 2MMAB 2DHMA 1V60A 1XS3A 4PUGA 1NY8A 4PUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TR3 A;  2MCQ A;  2KDN A;  4PUI A;  2KZ0 A;  2MM9 A;  5LCI A;  2NCL A;  3O2E A;  2MMA B;  2DHM A;  1V60 A;  1XS3 A;  4PUG A;  1NY8 A;  4PUH A; 
#chains in the Genus database with same CATH topology
 1MD9 A;  3UX3 A;  4X62 C;  5BR8 C;  2ZZM A;  1NY8 A;  3GR0 A;  4D57 A;  4B3M C;  1P4E C;  4DCV A;  2P2J A;  4JI0 C;  1J5E C;  4DV1 C;  3FCE A;  2M5H A;  5BUQ A;  1O92 A;  3EQ6 A;  2QVX X;  1T5D X;  3AF5 A;  3JAM D;  2V7B A;  5KYV A;  2Z51 A;  3LNV A;  4LF6 C;  4D56 A;  4JI3 C;  4JM1 A;  3VNS A;  2VQE C;  3DLP X;  4DV7 C;  3E7X A;  2VQF C;  3J80 D;  4DR2 C;  3A9U A;  2MMA B;  4DUY C;  5BUR A;  3TQI A;  5BUS A;  4KHP C;  4R0M A;  4PUI A;  3UZ0 A;  2CXC A;  4NDN A;  4LF8 C;  1USP A;  4JI6 C;  4B3S C;  5AE1 A;  2UUB C;  2P2B A;  4LFB C;  4JI4 C;  1YJ7 A;  4R1M A;  4YY3 C;  4G1I A;  5CZX A;  3LAX A;  1XRB A;  3IML A;  5DV9 A;  4KTV A;  3TUF A;  3A26 A;  1HR0 C;  1ZB8 A;  1VEH A;  3A25 A;  1VLA A;  5IFI A;  4DCT A;  2P2Q A;  2CY1 A;  4ODJ A;  4JI1 C;  5AE3 A;  3I07 A;  4DG8 A;  4DV6 C;  4BSZ A;  2ONF A;  4FUQ A;  4G36 A;  2UUC C;  1PG3 A;  5E7Q A;  3SO4 A;  5LMN C;  4LF5 C;  3DHV A;  2E5L C;  1O93 A;  3OTO C;  2BH1 X;  2WP0 C;  2CU6 A;  4R1L A;  3B7W A;  3T1H C;  5H9U A;  2M5O A;  5A2Q D;  1V60 A;  1N34 C;  1HH2 P;  2KDN A;  4IZ6 A;  2UU9 C;  4JI7 C;  2MCQ A;  4B3R C;  4TPS B;  2YCB A;  1N32 C;  3PBK A;  4LF4 C;  2HHH C;  5LMU C;  3AY0 A;  3KXW A;  1IB8 A;  2P02 A;  4BC7 A;  2E8C A;  4DCS A;  4DV0 C;  3NYR A;  4L2Z A;  1LQL A;  1MDF A;  4B3T C;  1RG9 A;  4WV3 A;  4MH4 A;  4OX9 C;  4DR5 C;  4D4I A;  3PES A;  4HPV A;  2QVY X;  2DPL A;  3LNO A;  3L95 X;  1IBM C;  2PT7 G;  4AQY C;  2MM9 A;  1QWI A;  1UWD A;  2ZM6 C;  2D1R A;  2KZF A;  4XX2 A;  2P20 A;  4DCU A;  4BBY A;  4GKJ C;  2ATW A;  2Y4O A;  4ZLP A;  2UUA C;  4OXI A;  4EAT A;  1PA4 A;  1WCJ A;  4BC9 A;  4YHH C;  3IEU A;  3C5E A;  3A4I A;  2D1T A;  4OYC A;  1O9T A;  1N2F A;  3O2E A;  4DR7 C;  4GKK C;  2WD9 A;  1HNX C;  2YWB A;  4X65 C;  5FLX D;  3R9X A;  2UXD C;  3CQ2 A;  3TR3 A;  2QL8 A;  3VNR A;  4JYA C;  3I08 A;  4RLQ A;  5CZV A;  2VSQ A;  1K0R A;  4DV3 C;  1NYE A;  1M6X A;  5KYT A;  4JI2 C;  4RM3 A;  3R9W A;  1MKY A;  4D4G A;  4RVN A;  2P2F A;  3K6R A;  1XS3 A;  2P2M A;  1XNQ C;  4LE5 A;  4RMN A;  5BSW A;  4GS5 A;  1ZB9 A;  1N36 C;  4DG9 A;  3DAY A;  1FJG C;  3N2Q A;  1XMO C;  3H2T A;  2QW0 X;  5BSV A;  1T5H X;  1MXA A;  3S82 A;  2JNV A;  2OPL B;  5BST A;  5T8S A;  2PN2 A;  5LCI A;  1I94 C;  5BSM A;  2QVZ X;  4LFA C;  4DR3 C;  2YWC A;  4FTF A;  1JOS A;  2OO4 A;  1PU1 A;  4NXM C;  4DV2 C;  4DV4 C;  1V26 A;  4K0K C;  1PG4 A;  3NYQ A;  5BSU A;  4X64 C;  1QM4 A;  2D27 A;  2NCL A;  4FUT A;  2D1S A;  1BA3 A;  2D1Q A;  5K8F A;  3E7W A;  2E8F A;  5K85 A;  1GPM A;  3UX2 A;  3IEV A;  3ETC A;  1WH9 A;  3UOW A;  1IBL C;  3G7S A;  2E0G A;  4WS9 A;  3VNQ A;  2Y4N A;  3NI2 A;  2XR1 A;  3ETO A;  4GXR A;  2OPL A;  5ADZ A;  2E8E A;  4NXN C;  1MDB A;  3R44 A;  1V25 A;  3GPC A;  1IBK C;  3FCC A;  4ISB A;  1KKG A;  1USP B;  4PUH A;  3T1Y C;  1MXB A;  3AF6 A;  4K0B A;  1M6X C;  4NOZ A;  2D7V A;  5A1G A;  3IPL A;  4DR1 C;  1ULT A;  4DR6 C;  2DHM A;  1O90 A;  4DR4 C;  2YX1 A;  3GKU A;  4ZJZ A;  3GR1 A;  3CQ3 A;  2UXC C;  3RG2 A;  3CW9 A;  4U5Y D;  2JMP A;  2ZZN A;  4G37 A;  5IT9 D;  1XNR C;  1P4E A;  5A1I A;  4RM2 A;  4JV5 C;  2EGT A;  2HJG A;  2E7G A;  2VZE A;  3PRO C;  1AMU A;  1XHJ A;  3RV2 A;  5BSR A;  3CW8 X;  3TDE A;  5IWA C;  1TH5 A;  1XRC A;  4L4Q A;  4X66 C;  1FUG A;  5GTD A;  2DYJ A;  2PRO A;  5KEI A;  3N54 B;  1XMQ C;  2Y27 A;  4GXQ A;  3UEB A;  4L7I A;  4RVO A;  4PUG A;  5T8T A;  4BCA A;  4LFC C;  1HNW C;  4PRO C;  3J81 D;  4I9G A;  5JRH A;  1L2F A;  4LF9 C;  4IR7 A;  2ASB A;  1EGA A;  1ML8 A;  4DV5 C;  1MXC A;  4JI5 C;  3NPD A;  1FLO A;  4DUZ C;  4JI8 C;  4KTT A;  4I9F A;  3A9V A;  3LGX A;  4MTN A;  5A19 A;  3CQ1 A;  2KZ0 A;  2AYA A;  2OBV A;  2BJO A;  3L8C A;  4PHT A;  3LUS A;  2D28 C;  4PZP A;  5AE2 A;  1WF3 A;  3EER A;  1HNZ C;  4LF7 C;  1XRA A;  1P7L A;  1RY2 A;  1UKK A;  4RLF A;  2F4V C;  2UXB C;  1LCI A;  3CJE A;  1N33 C; 
#chains in the Genus database with same CATH homology
 3TR3 A;  2MCQ A;  2KDN A;  4PUI A;  2KZ0 A;  2MM9 A;  5LCI A;  2NCL A;  3O2E A;  2MMA B;  2DHM A;  1V60 A;  1XS3 A;  4PUG A;  1NY8 A;  4PUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...