1V60A

Solution structure of bola1 protein from mus musculus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
123
structure length
123
Chain Sequence
GSSGSSGMATRSCVSRGSAGSAAAGPVEAAIRAKLEQALSPEVLELRNESGGHAVPAGSETHFRVAVVSSRFEGMSPLQRHRLVHEALSEELAGPVHALAIQAKTPAQWRENPQLDISPPCLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of BolA1 protein from Mus musculus
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords RIKEN cDNA 1810037G04
total genus 14
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2003-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 1v60A01
5LCIA 2MMAB 1V60A 2KDNA 3TR3A 2KZ0A 2MM9A 2DHMA 4PUIA 4PUGA 4PUHA 2MCQA 1NY8A 3O2EA 2NCLA 1XS3A
chains in the Genus database with same CATH superfamily
4RLQA 1IBLC 5K8FA 4G37A 4FTFA 5GTDA 3A25A 4GXRA 1HR0C 1O93A 4RM2A 5BR8C 3A26A 1AMUA 1XMQC 4B3RC 3TUFA 3A9VA 4PHTA 2E5LC 4D56A 2NCLA 3DHVA 3RG2A 1NYEA 5BSUA 3DLPX 3AF6A 3LNOA 4DCSA 2P2BA 1MDFA 2P2QA 1XS3A 3UX2A 4LF5C 1N34C 2MCQA 4RLFA 1XRCA 4U5YD 5CZXA 4BSZA 1YJ7A 5LMUC 2VSQA 2VZEA 2HHHC 1USPA 1WCJA 1VEHA 4WV3A 4LF4C 5BSMA 2BJOA 3K6RA 4FUTA 3CQ2A 2UXCC 4ODJA 3R44A 3A4IA 2PT7G 2HJGA 1HNWC 4LF6C 3UEBA 5CZVA 1IB8A 4JM1A 4MH4A 3CJEA 4PUHA 5AE3A 3O2EA 1LQLA 4MTNA 2Y4OA 1RG9A 4IR7A 1QWIA 1HNXC 4LFAC 1PA4A 3GKUA 2ZZMA 3G7SA 4DCTA 4ZLPA 3CW8X 4DUYC 1PG4A 5KYTA 1MKYA 1WH9A 2D1QA 4JI0C 4DG9A 2E8FA 4JYAC 1PG3A 1KKGA 4LE5A 4NXMC 2YX1A 3ETCA 4YHHC 4DV2C 2E0GA 3R9WA 1MXCA 4AQYC 2XR1A 3T1YC 4DUZC 4PROC 4OYCA 1IBKC 5DV9A 4KTVA 4KTTA 4BC7A 4PUGA 4ZJZA 1NY8A 2P2JA 2E8CA 5BSTA 3J81D 4WS9A 1XNRC 4DV4C 4RVOA 1P7LA 4DV1C 5T8TA 4D57A 4DV0C 4NXNC 3T1HC 2DPLA 3LAXA 5KEIA 5A19A 4L7IA 1V25A 3A9UA 5LCIA 2JNVA 3EQ6A 2OPLB 4DR4C 5KYVA 4D4GA 3KXWA 4GKKC 3R9XA 3UZ0A 5BSWA 1USPB 1EGAA 3VNSA 1BA3A 2D27A 3I08A 1RY2A 2JMPA 2D1RA 5H9UA 2P2FA 3L8CA 1PU1A 2E7GA 1FUGA 3B7WA 3LGXA 4GS5A 2ASBA 2DHMA 1M6XA 4LF8C 3DAYA 4JI3C 4B3TC 3C5EA 2D7VA 3GR1A 2OBVA 4XX2A 1V60A 5AE2A 4D4IA 5IWAC 3UOWA 4DCVA 3VNQA 4GXQA 2DYJA 4TPSB 4L4QA 5BUQA 3H2TA 3E7XA 1UWDA 2D1SA 4IZ6A 4DCUA 1HH2P 4DV6C 3IEUA 4JI8C 2MM9A 4JI6C 4B3SC 3RV2A 4HPVA 3SO4A 1FLOA 1MDBA 5IFIA 3AF5A 2AYAA 2YWBA 5ADZA 3TDEA 2Z51A 4DR6C 4PZPA 2KZFA 4X64C 3CW9A 3VNRA 2UUCC 4PUIA 5BURA 2P20A 1J5EC 4K0BA 2BH1X 1P4EC 1WF3A 3PROC 3FCCA 3S82A 1MXBA 2M5OA 1ZB9A 1FJGC 2EGTA 3FCEA 4K0KC 2ONFA 2QW0X 1XHJA 1V26A 1O9TA 2V7BA 3IEVA 5A2QD 2UU9C 4GKJC 3TR3A 4EATA 5LMNC 1MD9A 2UXDC 1QM4A 2KZ0A 2ZM6C 3NYQA 2OO4A 3ETOA 3TQIA 4R0MA 1XNQC 2YCBA 1M6XC 2QVZX 3NYRA 2P02A 4LF7C 2Y4NA 2QVYX 1ML8A 4JI5C 2F4VC 4LF9C 1MXAA 4RMNA 4B3MC 1P4EA 3CQ3A 3PESA 4DR2C 5AE1A 2CXCA 4LFCC 2PROA 2WD9A 4X62C 4I9FA 4G36A 5E7QA 3CQ1A 3UX3A 1N33C 3L95X 4BBYA 4RM3A 1VLAA 5BUSA 4R1MA 1XMOC 4BC9A 1IBMC 3GR0A 3AY0A 4OX9C 4DR1C 1L2FA 2P2MA 3IPLA 3NI2A 2E8EA 1N32C 3LNVA 2D28C 1I94C 4DV7C 4R1LA 5K85A 4DR3C 4X66C 4NDNA 5A1GA 2VQEC 3N2QA 5FLXD 1O92A 4FUQA 3NPDA 3IMLA 1XRBA 1ZB8A 5JRHA 1T5HX 1HNZC 2D1TA 4OXIA 2MMAB 1TH5A 1JOSA 3I07A 4JI7C 1N36C 3EERA 3JAMD 4LFBC 2UUAC 4YY3C 2QVXX 2YWCA 2KDNA 5A1IA 1UKKA 3PBKA 2ZZNA 5BSVA 1XRAA 2VQFC 2UXBC 4JI4C 3J80D 4I9GA 4NOZA 5T8SA 4DR7C 4JV5C 4G1IA 1K0RA 2CY1A 1N2FA 4JI2C 4ISBA 2QL8A 3GPCA 1ULTA 1T5DX 2CU6A 2WP0C 4DG8A 2M5HA 4BCAA 3N54B 3E7WA 1LCIA 3LUSA 4L2ZA 2UUBC 4X65C 4KHPC 1O90A 4DR5C 2Y27A 4JI1C 2OPLA 3OTOC 4DV3C 2PN2A 4DV5C 1GPMA 5IT9D 2ATWA 4RVNA 5BSRA
chains in the Genus database with same CATH topology
5LCIA 2MMAB 1V60A 2KDNA 3TR3A 2KZ0A 2MM9A 2DHMA 4PUIA 4PUGA 4PUHA 2MCQA 1NY8A 3O2EA 2NCLA 1XS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LCI A;  2MMA B;  1V60 A;  2KDN A;  3TR3 A;  2KZ0 A;  2MM9 A;  2DHM A;  4PUI A;  4PUG A;  4PUH A;  2MCQ A;  1NY8 A;  3O2E A;  2NCL A;  1XS3 A; 
#chains in the Genus database with same CATH topology
 4RLQ A;  1IBL C;  5K8F A;  4G37 A;  4FTF A;  5GTD A;  3A25 A;  4GXR A;  1HR0 C;  1O93 A;  4RM2 A;  5BR8 C;  3A26 A;  1AMU A;  1XMQ C;  4B3R C;  3TUF A;  3A9V A;  4PHT A;  2E5L C;  4D56 A;  2NCL A;  3DHV A;  3RG2 A;  1NYE A;  5BSU A;  3DLP X;  3AF6 A;  3LNO A;  4DCS A;  2P2B A;  1MDF A;  2P2Q A;  1XS3 A;  3UX2 A;  4LF5 C;  1N34 C;  2MCQ A;  4RLF A;  1XRC A;  4U5Y D;  5CZX A;  4BSZ A;  1YJ7 A;  5LMU C;  2VSQ A;  2VZE A;  2HHH C;  1USP A;  1WCJ A;  1VEH A;  4WV3 A;  4LF4 C;  5BSM A;  2BJO A;  3K6R A;  4FUT A;  3CQ2 A;  2UXC C;  4ODJ A;  3R44 A;  3A4I A;  2PT7 G;  2HJG A;  1HNW C;  4LF6 C;  3UEB A;  5CZV A;  1IB8 A;  4JM1 A;  4MH4 A;  3CJE A;  4PUH A;  5AE3 A;  3O2E A;  1LQL A;  4MTN A;  2Y4O A;  1RG9 A;  4IR7 A;  1QWI A;  1HNX C;  4LFA C;  1PA4 A;  3GKU A;  2ZZM A;  3G7S A;  4DCT A;  4ZLP A;  3CW8 X;  4DUY C;  1PG4 A;  5KYT A;  1MKY A;  1WH9 A;  2D1Q A;  4JI0 C;  4DG9 A;  2E8F A;  4JYA C;  1PG3 A;  1KKG A;  4LE5 A;  4NXM C;  2YX1 A;  3ETC A;  4YHH C;  4DV2 C;  2E0G A;  3R9W A;  1MXC A;  4AQY C;  2XR1 A;  3T1Y C;  4DUZ C;  4PRO C;  4OYC A;  1IBK C;  5DV9 A;  4KTV A;  4KTT A;  4BC7 A;  4PUG A;  4ZJZ A;  1NY8 A;  2P2J A;  2E8C A;  5BST A;  3J81 D;  4WS9 A;  1XNR C;  4DV4 C;  4RVO A;  1P7L A;  4DV1 C;  5T8T A;  4D57 A;  4DV0 C;  4NXN C;  3T1H C;  2DPL A;  3LAX A;  5KEI A;  5A19 A;  4L7I A;  1V25 A;  3A9U A;  5LCI A;  2JNV A;  3EQ6 A;  2OPL B;  4DR4 C;  5KYV A;  4D4G A;  3KXW A;  4GKK C;  3R9X A;  3UZ0 A;  5BSW A;  1USP B;  1EGA A;  3VNS A;  1BA3 A;  2D27 A;  3I08 A;  1RY2 A;  2JMP A;  2D1R A;  5H9U A;  2P2F A;  3L8C A;  1PU1 A;  2E7G A;  1FUG A;  3B7W A;  3LGX A;  4GS5 A;  2ASB A;  2DHM A;  1M6X A;  4LF8 C;  3DAY A;  4JI3 C;  4B3T C;  3C5E A;  2D7V A;  3GR1 A;  2OBV A;  4XX2 A;  1V60 A;  5AE2 A;  4D4I A;  5IWA C;  3UOW A;  4DCV A;  3VNQ A;  4GXQ A;  2DYJ A;  4TPS B;  4L4Q A;  5BUQ A;  3H2T A;  3E7X A;  1UWD A;  2D1S A;  4IZ6 A;  4DCU A;  1HH2 P;  4DV6 C;  3IEU A;  4JI8 C;  2MM9 A;  4JI6 C;  4B3S C;  3RV2 A;  4HPV A;  3SO4 A;  1FLO A;  1MDB A;  5IFI A;  3AF5 A;  2AYA A;  2YWB A;  5ADZ A;  3TDE A;  2Z51 A;  4DR6 C;  4PZP A;  2KZF A;  4X64 C;  3CW9 A;  3VNR A;  2UUC C;  4PUI A;  5BUR A;  2P20 A;  1J5E C;  4K0B A;  2BH1 X;  1P4E C;  1WF3 A;  3PRO C;  3FCC A;  3S82 A;  1MXB A;  2M5O A;  1ZB9 A;  1FJG C;  2EGT A;  3FCE A;  4K0K C;  2ONF A;  2QW0 X;  1XHJ A;  1V26 A;  1O9T A;  2V7B A;  3IEV A;  5A2Q D;  2UU9 C;  4GKJ C;  3TR3 A;  4EAT A;  5LMN C;  1MD9 A;  2UXD C;  1QM4 A;  2KZ0 A;  2ZM6 C;  3NYQ A;  2OO4 A;  3ETO A;  3TQI A;  4R0M A;  1XNQ C;  2YCB A;  1M6X C;  2QVZ X;  3NYR A;  2P02 A;  4LF7 C;  2Y4N A;  2QVY X;  1ML8 A;  4JI5 C;  2F4V C;  4LF9 C;  1MXA A;  4RMN A;  4B3M C;  1P4E A;  3CQ3 A;  3PES A;  4DR2 C;  5AE1 A;  2CXC A;  4LFC C;  2PRO A;  2WD9 A;  4X62 C;  4I9F A;  4G36 A;  5E7Q A;  3CQ1 A;  3UX3 A;  1N33 C;  3L95 X;  4BBY A;  4RM3 A;  1VLA A;  5BUS A;  4R1M A;  1XMO C;  4BC9 A;  1IBM C;  3GR0 A;  3AY0 A;  4OX9 C;  4DR1 C;  1L2F A;  2P2M A;  3IPL A;  3NI2 A;  2E8E A;  1N32 C;  3LNV A;  2D28 C;  1I94 C;  4DV7 C;  4R1L A;  5K85 A;  4DR3 C;  4X66 C;  4NDN A;  5A1G A;  2VQE C;  3N2Q A;  5FLX D;  1O92 A;  4FUQ A;  3NPD A;  3IML A;  1XRB A;  1ZB8 A;  5JRH A;  1T5H X;  1HNZ C;  2D1T A;  4OXI A;  2MMA B;  1TH5 A;  1JOS A;  3I07 A;  4JI7 C;  1N36 C;  3EER A;  3JAM D;  4LFB C;  2UUA C;  4YY3 C;  2QVX X;  2YWC A;  2KDN A;  5A1I A;  1UKK A;  3PBK A;  2ZZN A;  5BSV A;  1XRA A;  2VQF C;  2UXB C;  4JI4 C;  3J80 D;  4I9G A;  4NOZ A;  5T8S A;  4DR7 C;  4JV5 C;  4G1I A;  1K0R A;  2CY1 A;  1N2F A;  4JI2 C;  4ISB A;  2QL8 A;  3GPC A;  1ULT A;  1T5D X;  2CU6 A;  2WP0 C;  4DG8 A;  2M5H A;  4BCA A;  3N54 B;  3E7W A;  1LCI A;  3LUS A;  4L2Z A;  2UUB C;  4X65 C;  4KHP C;  1O90 A;  4DR5 C;  2Y27 A;  4JI1 C;  2OPL A;  3OTO C;  4DV3 C;  2PN2 A;  4DV5 C;  1GPM A;  5IT9 D;  2ATW A;  4RVN A;  5BSR A; 
#chains in the Genus database with same CATH homology
 5LCI A;  2MMA B;  1V60 A;  2KDN A;  3TR3 A;  2KZ0 A;  2MM9 A;  2DHM A;  4PUI A;  4PUG A;  4PUH A;  2MCQ A;  1NY8 A;  3O2E A;  2NCL A;  1XS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...